PSIBLAST alignment of GI: 254780396 and protein with PDB id: 2f21

>gi|110591318|pdb|2F21|A Chain A, Human Pin1 Fip Mutant Length = 162
 Score = 56.6 bits (134), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 8/103 (7%), Positives = 25/103 (24%), Gaps = 1/103 (0%)

Query: 169 KMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHD 228
               +       R   +         +  ++      ++ +       +   +F+     
Sbjct: 56  CSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSA 115

Query: 229 VSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYI 270
            + G         +   F++          + P  T  G+  I
Sbjct: 116 KARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHII 158