PSIBLAST alignment of GI: 254780396 and protein with PDB id: 3ik8

>gi|259090316|pdb|3IK8|A Chain A, Structure-Based Design Of Novel Pin1 Inhibitors (I) Length = 123
>gi|259090317|pdb|3IK8|B Chain B, Structure-Based Design Of Novel Pin1 Inhibitors (I) Length = 123
>gi|259090318|pdb|3IKD|A Chain A, Structure-Based Design Of Novel Pin1 Inhibitors (I) Length = 123
>gi|259090319|pdb|3IKD|B Chain B, Structure-Based Design Of Novel Pin1 Inhibitors (I) Length = 123
>gi|259090320|pdb|3IKG|A Chain A, Structure-Based Design Of Novel Pin1 Inhibitors (I) Length = 123
>gi|259090321|pdb|3IKG|B Chain B, Structure-Based Design Of Novel Pin1 Inhibitors (I) Length = 123
>gi|293651898|pdb|3JYJ|A Chain A, Structure-Based Design Of Novel Pin1 Inhibitors (Ii) Length = 123
>gi|293651899|pdb|3JYJ|B Chain B, Structure-Based Design Of Novel Pin1 Inhibitors (Ii) Length = 123
>gi|294979472|pdb|3I6C|A Chain A, Structure-Based Design Of Novel Pin1 Inhibitors (Ii) Length = 123
>gi|294979473|pdb|3I6C|B Chain B, Structure-Based Design Of Novel Pin1 Inhibitors (Ii) Length = 123
 Score = 56.6 bits (134), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 8/103 (7%), Positives = 25/103 (24%), Gaps = 1/103 (0%)

Query: 169 KMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHD 228
               +       R   +         +  ++      ++ +       +   +F+     
Sbjct: 17  CSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSA 76

Query: 229 VSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYI 270
            + G         +   F++          + P  T  G+  I
Sbjct: 77  KARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHII 119