BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780396|ref|YP_003064809.1| peptidyl-prolyl cis-trans
isomerase protein [Candidatus Liberibacter asiaticus str. psy62]
         (317 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780396|ref|YP_003064809.1| peptidyl-prolyl cis-trans isomerase protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040073|gb|ACT56869.1| peptidyl-prolyl cis-trans isomerase protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 317

 Score =  157 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 317/317 (100%), Positives = 317/317 (100%)

Query: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI 60
           MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI
Sbjct: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI 60

Query: 61  ALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
           ALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF
Sbjct: 61  ALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180
           SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI
Sbjct: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLES 240
           RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLES
Sbjct: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLES 240

Query: 241 DLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKH 300
           DLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKH
Sbjct: 241 DLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKH 300

Query: 301 EAEYVKKLRSNAIIHYY 317
           EAEYVKKLRSNAIIHYY
Sbjct: 301 EAEYVKKLRSNAIIHYY 317


>gi|209885477|ref|YP_002289334.1| SurA N- domain family [Oligotropha carboxidovorans OM5]
 gi|209873673|gb|ACI93469.1| SurA N- domain family [Oligotropha carboxidovorans OM5]
          Length = 330

 Score =  154 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 76/309 (24%), Positives = 131/309 (42%), Gaps = 6/309 (1%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI 68
           LS F+  +   F   I   V   S      +  I   +NGE IT  DI +R  L+ L   
Sbjct: 24  LSVFVSRIALAFAAFIILAVTAPSV----QAQGIVVMVNGEPITTYDIEQRTKLITLTTR 79

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
                + A+QELI + LK +E +K G+   ++ V+  F   A+   +S++  +  L  QG
Sbjct: 80  KAPTRQQALQELIDDRLKIKEAKKFGVDLSASDVDSAFAGMAQRMRISSDQLAQVLQAQG 139

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIP 188
           +  +  K  L   + W  +V+  F       E ++ A   +  +    E     +   + 
Sbjct: 140 VRPDTMKFRLKADTAWGALVRGRFKQSLLVGERDVQAAVGENPSGERTESYEYHMRPIVL 199

Query: 189 DNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN 248
                + G V++R K+AE  R R+     +  +    +   SI        +DL P  + 
Sbjct: 200 FVPRGSSGAVEQRKKEAEALRERIQSC-EEATRVFKSLRQASIRDTIVKTSADLPPNLRE 258

Query: 249 LLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKK 307
           LL K+     T P VT++G+E +A+C+++    +   K     +    K E     Y++ 
Sbjct: 259 LLDKTPVGRMTAPEVTRQGIEMVALCNRQVTTADTPAKRAARDKLFAQKYEAKSKSYLED 318

Query: 308 LRSNAIIHY 316
           LR  A+I Y
Sbjct: 319 LRKRAMIEY 327


>gi|115525297|ref|YP_782208.1| hypothetical protein RPE_3295 [Rhodopseudomonas palustris BisA53]
 gi|115519244|gb|ABJ07228.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53]
          Length = 305

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 63/305 (20%), Positives = 121/305 (39%), Gaps = 2/305 (0%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +  L    +   F ++      +   +  +   +NGE IT  DI +R  L +L       
Sbjct: 1   MIALRLSRLCFAFALLLTTGLSTELRAQSVVVMVNGEPITSYDIDQRSKLTQLSTRKTPP 60

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            +  ++ELI E +K +E +K GI      ++  F        +S E  +  L   GI  +
Sbjct: 61  RQEVIEELINEKVKIKEGKKFGIDPSGADIDSSFANMGSRMRMSPEQLTQTLANSGIRPD 120

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             K  +  + +W  +V+  F       E +I A            +  +     +   + 
Sbjct: 121 TLKHRMRAEMVWTSLVRGRFKDSLLVGEKDIQAALGDSDKPAGESFEYQMRPVVLIVPRN 180

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK 252
                 + R+K+AE  R R+ + C +       + + +I        +DL P  + LL K
Sbjct: 181 AAPASREARMKEAEALRARV-QTCEEANALFKSMPNAAIRATVSKTSADLPPSLRELLDK 239

Query: 253 SQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
           +   + T P  T++GVE +A+C ++    +   K  +  +    K E     Y++ +R  
Sbjct: 240 TPIGHLTAPEATKQGVEMVALCSRKPTTADTPKKREIREKMFAEKFEAKSKAYLRDVRKA 299

Query: 312 AIIHY 316
           A++ Y
Sbjct: 300 AMVEY 304


>gi|90423813|ref|YP_532183.1| hypothetical protein RPC_2310 [Rhodopseudomonas palustris BisB18]
 gi|90105827|gb|ABD87864.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 320

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 63/305 (20%), Positives = 124/305 (40%), Gaps = 4/305 (1%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           ++L+       +  +   +       +  +   +NGE IT+ DI +R  L+ L       
Sbjct: 18  LRLIRVALCCAVAMLA--ICLGPDLHAQSVAVMVNGEPITNYDIEQRSKLMALSTHKSPS 75

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            +  + ELI E +K +E +K GI      ++  F        +SAE  +  L+ QGI   
Sbjct: 76  RQQVIDELINEKVKIREGKKFGIDPSVADIDGSFAGMGSRMRMSAEQLTKSLEGQGIRPE 135

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             KQ +  + +W  +V+  F       E E+ A        +   +  +     +   + 
Sbjct: 136 TLKQRMRAEMVWTSLVRGRFKDSLLVGEKEVRAALGGDDKSSGESFEYQMRPIVLIVPRN 195

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK 252
                 + R+K+AE  R R+     + +     + + +I        +D+    + +L K
Sbjct: 196 AAPSARELRMKEAEALRSRVQSCA-EADDLFKSMQNAAIRDTVTKTSADIPGVLREVLDK 254

Query: 253 SQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
           +   + T P VT++GVE +A+C ++    +   K  +  +    K E     Y++ +R  
Sbjct: 255 TPIGHLTAPEVTKQGVEMVALCSRKPTTADTPKKREIRDKMFADKFEAKSKSYLRDVRKA 314

Query: 312 AIIHY 316
           A+I Y
Sbjct: 315 AMIEY 319


>gi|229592952|ref|YP_002875071.1| putative chaperone [Pseudomonas fluorescens SBW25]
 gi|229364818|emb|CAY52844.1| putative chaperone [Pseudomonas fluorescens SBW25]
          Length = 444

 Score =  149 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 45/311 (14%), Positives = 100/311 (32%), Gaps = 17/311 (5%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK--------INGE 71
            VL    +    ++ +     ++   ++ +VI    + +R+  ++               
Sbjct: 12  LVLGALLLGTASAHAAVQQLDKVVAIVDNDVIMQSQLDQRVKEVQQTIAKRGGGVPPTSV 71

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L++  ++ LIVE L+ Q  ++SGI      +N      A+   +S + F + L   G+  
Sbjct: 72  LDQQVLERLIVENLQLQIGDRSGIRISDEELNQAVGTIAQRNNMSIDQFRAALAHDGLSY 131

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNK 191
              +  +  + I   V +     +    E E+                +      IP   
Sbjct: 132 EDARDQIRREMIISRVRQRRVAERVQVSEQEVKNFLASDLGKMQLSEELHLANILIPTPD 191

Query: 192 LQNQGFVQKRIKDAEESRLRLPKDCNKLE---KFASKIHDVSIGKAQYLLESDLHPQF-Q 247
             N   +       +    RL    +  +     +   + +  G   +   + L P F +
Sbjct: 192 SANSEQLNAAAAKTQAIYDRLKAGADFAQMAIAQSGSDNALEGGDMGWRKAAQLPPPFDR 251

Query: 248 NLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEY 304
            L        T P  T  G   + + +KR       +     ++  + +  + E    E 
Sbjct: 252 ELSAMEVGGITQPARTPGGFIILKLLEKRGGETSLKDEVHVRHILVKPSEIRTEAQTKEL 311

Query: 305 VKKLRSNAIIH 315
            +K+     I 
Sbjct: 312 AQKIYDR--IE 320



 Score = 90.9 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 15/139 (10%), Positives = 48/139 (34%), Gaps = 3/139 (2%)

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLE 239
                 +  ++++ +   ++  +   +            + F+      ++ G   ++  
Sbjct: 291 HVRHILVKPSEIRTEAQTKELAQKIYDRIESGEDFATLAKSFSEDPGSALNGGDLNWIDP 350

Query: 240 SDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKI 297
             L P+FQ ++    Q   + P+ TQ G   + +  +R        +           K 
Sbjct: 351 KALVPEFQQVMADTPQGVLSKPFKTQYGWHVLEVLGRRATDNTNQAREQQALNVLRNRKY 410

Query: 298 EKHEAEYVKKLRSNAIIHY 316
           ++    +++++R  A +  
Sbjct: 411 DEELQTWLRQIRDEAYVEN 429


>gi|92113046|ref|YP_572974.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Chromohalobacter
           salexigens DSM 3043]
 gi|122070642|sp|Q1QZ33|SURA_CHRSD RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|91796136|gb|ABE58275.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Chromohalobacter
           salexigens DSM 3043]
          Length = 435

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 42/315 (13%), Positives = 112/315 (35%), Gaps = 16/315 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK----- 67
           ++       +++  + P ++        RI   +N + I    +  R+  ++ Q      
Sbjct: 3   LRSFAFLGFMLLVAMAPSMASAQPQPLDRIVAVVNKDAIMQSRLEDRVTQVRRQMASRNV 62

Query: 68  ---INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                 +L +  +  +I+E ++ Q  E++ ++ D   +N      A + G+S ++F+  L
Sbjct: 63  PAPNEADLRRQVLDRMILEQIQLQMAERANLSIDDTQLNATVRGIAEDNGMSMDEFADAL 122

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
           ++ G+     ++ +  + +   V ++    +    + E+     +        Y +  +L
Sbjct: 123 EEDGMSLASMREQVRREMLLRQVQQSQVASRVNVTDREVERYLDQQGETADTAYHLAHIL 182

Query: 185 FSIPDNKLQNQ-GFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLH 243
            S+P++    Q    Q +++D                  +     +S G   +     L 
Sbjct: 183 VSVPESPTPEQVEQAQAKVRDLYRQLQNGANFAQLATAESDGQQALSGGDLGWRRGDQLP 242

Query: 244 PQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEI---ALKAYLSAQNT---PTK 296
             F +++   S    + P  +  G   + + D R   GE      +  +        P +
Sbjct: 243 SLFADVVPTLSNGEVSEPIRSPSGFHLVKLIDTRGQQGEQKRVVTENRVRHILIGTNPNR 302

Query: 297 IEKHEAEYVKKLRSN 311
            ++      + +R  
Sbjct: 303 NDQQAEALARDIRQR 317



 Score = 93.6 bits (230), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 19/138 (13%), Positives = 46/138 (33%), Gaps = 3/138 (2%)

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLL 238
            R     I  N  +N    +   +D  +            ++++      +  G+  +  
Sbjct: 289 NRVRHILIGTNPNRNDQQAEALARDIRQRIANGESFAALAQEYSDDDGSALDGGELGWTR 348

Query: 239 ESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIAL-KAYLSAQNTPTK 296
              + P F++ +K       + P  ++ G   I + D+R         +  +       K
Sbjct: 349 PGQMVPAFEDAVKALDVGELSQPVRSRFGYHVIELEDRRRQDVTRDAQREQIRQTLFQRK 408

Query: 297 IEKHEAEYVKKLRSNAII 314
           +      + +++RS A I
Sbjct: 409 VSDEMEAWTQEIRSGAYI 426


>gi|108758581|ref|YP_628738.1| peptidylprolyl cis-trans isomerase [Myxococcus xanthus DK 1622]
 gi|108462461|gb|ABF87646.1| peptidylprolyl cis-trans isomerase [Myxococcus xanthus DK 1622]
          Length = 325

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 43/304 (14%), Positives = 99/304 (32%), Gaps = 18/304 (5%)

Query: 29  PIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKI----------AVQ 78
                    +  ++   +N ++I   ++ +R A    +  + +  K           A+ 
Sbjct: 18  GSGGAAHAELVDKVAAVVNRDIIALSEVQQRAAPEMARVNDPDPRKRGEQRLQLMKTALD 77

Query: 79  ELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTG-LSAEDFSSFLDKQGIGDNHFKQY 137
            LI E L + EI + GIT     V+       +         F   L  +G+    ++  
Sbjct: 78  TLIGEKLMESEIAQLGITASEAEVDELVADVRQQNNITDPAQFEQLLLGEGLTMATYRDM 137

Query: 138 LAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVRE--YLIRTVLFSIPDNKLQNQ 195
           +  + +   +++     +    E ++ A   +   +   +     R +L  +       Q
Sbjct: 138 MRKRILRDRLLRMKVGPQVKITEEDLKAAYTQYTRMESGDSEVHARHILVQVDAKATAEQ 197

Query: 196 GFVQKRIKDAEESRLR--LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK- 252
               K+  +A  +  R       +     +        G   +     + P F+      
Sbjct: 198 VEAAKKRAEAIATEARRPGMDFASLARARSEGPSAADGGDLGWFKRGVMVPAFEKAAFGL 257

Query: 253 SQNNTTNPYVTQKGVEYIAICDKRD--LGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRS 310
            +   + P  T  G   + + ++R         ++  L  +    K EK   +YV++LR 
Sbjct: 258 PEGGVSEPVRTNFGWHVLKVEERRTVAAASYEEMRPKLEGKLLQEKTEKFLDQYVQELRQ 317

Query: 311 NAII 314
            A +
Sbjct: 318 KANV 321


>gi|85716332|ref|ZP_01047305.1| hypothetical protein NB311A_19130 [Nitrobacter sp. Nb-311A]
 gi|85696848|gb|EAQ34733.1| hypothetical protein NB311A_19130 [Nitrobacter sp. Nb-311A]
          Length = 319

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 62/305 (20%), Positives = 126/305 (41%), Gaps = 2/305 (0%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
            L   +  L +F  +  VS+ S   +  +   +NGE IT  DI +R  L+K+        
Sbjct: 5   SLFRPFSRLAVFAFLSFVSFNSPLSAQSVAVMVNGEPITTFDIEQRSRLIKISTHKSASR 64

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           +  + ELI E +K +E +K G+   S  ++  +       G+S E  +  L  QG+  + 
Sbjct: 65  QEVIDELIGEKVKIKEAKKFGVNPTSADIDRAYANMGARMGMSPEQLTKSLASQGVRPDT 124

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREY-LIRTVLFSIPDNKL 192
            K  L    +W  +V+  F       + ++    +       +   +   +   +     
Sbjct: 125 IKARLRADLVWGSLVRGRFKESLLVSDRDVNEALKNSGEDQSKIEGVEYQMRPVVLIVPR 184

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK 252
                V +  ++   S     + C    +    + + ++        +DL P  ++LL K
Sbjct: 185 GAAASVMEARRNEANSLRERVQSCADAIRIVKAMRNATLRDRVTKTSADLPPPLRDLLDK 244

Query: 253 SQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
           +   + T P +T++G+E +A+C+K+    +   K  +  +    K EK    Y++ +R +
Sbjct: 245 TPVGHLTPPEITRQGIEMVAVCEKKVTSVDTPKKREIREKMFADKYEKRSKSYLENIRRS 304

Query: 312 AIIHY 316
           A+I Y
Sbjct: 305 AMIEY 309


>gi|92117866|ref|YP_577595.1| hypothetical protein Nham_2343 [Nitrobacter hamburgensis X14]
 gi|91800760|gb|ABE63135.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 319

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 60/304 (19%), Positives = 124/304 (40%), Gaps = 2/304 (0%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEK 74
           LL  +  L +F ++      +   +  +   +NGE IT  DI +R  L+++        +
Sbjct: 6   LLRAFCHLALFAVLSFACLNAPLHAQSVAVMVNGEPITSFDIEQRSRLIQISTHKTPTRQ 65

Query: 75  IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF 134
             + ELI E +K +E +K G+   S  ++  +        +S E  +  L  QG+  +  
Sbjct: 66  QVIDELINEKVKVKEAKKFGVNPTSADIDQQYASMGARMRMSPEQLTKSLASQGVRPDTI 125

Query: 135 KQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREY-LIRTVLFSIPDNKLQ 193
           K  L    +W  +V+  F       + ++    +       +       +   +      
Sbjct: 126 KARLKADLVWGSLVRGRFKDSLLVSDRDVNEALRNSGEDQSKTEGFEYQMRPVVLVVPRG 185

Query: 194 NQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS 253
               V +  +   ++     + C    +    + + +I +      +DL P  ++LL K+
Sbjct: 186 AAASVMESRRKEADALRERVQSCADATRIFKAMRNATIRETVVKTSADLPPPIRDLLDKT 245

Query: 254 Q-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNA 312
              + T P +T++GVE +AIC K+    +   K  +  +    K EK   +Y++ +R +A
Sbjct: 246 PVGHLTPPEITRQGVEMVAICGKKATSVDTPKKKEIREKMFAEKYEKKSKDYLEDIRKSA 305

Query: 313 IIHY 316
           +I Y
Sbjct: 306 MIEY 309


>gi|312963417|ref|ZP_07777899.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas fluorescens
           WH6]
 gi|311282223|gb|EFQ60822.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas fluorescens
           WH6]
          Length = 444

 Score =  147 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 44/309 (14%), Positives = 99/309 (32%), Gaps = 15/309 (4%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK--------INGE 71
            VL    +    ++ +     ++   ++ +VI    + +R+  ++               
Sbjct: 12  LVLGALFLGAASAHAAVQQLDKVVAIVDNDVIMQSQLDQRVKEVQQTIAKRGGGVPPTSV 71

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L++  ++ LIVE L+ Q  E+SGI      +N      A+   +S + F + L   G+  
Sbjct: 72  LDQQVLERLIVENLQLQIGERSGIRISDEELNQAVGTIAQRNNMSIDQFRAALAHDGLSY 131

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNK 191
              +  +  + I   V +     +    E E+                +      IP   
Sbjct: 132 EDARDQIRREMIISRVRQRRVAERVQVSEQEVKNFLASDLGKMQLSEELHLANILIPTPD 191

Query: 192 LQNQGFVQKRIKDAEESRLRLPKDCNKLE---KFASKIHDVSIGKAQYLLESDLHPQF-Q 247
             N   +       +    RL    +  +     +   + +  G   +   + L P F +
Sbjct: 192 SANSEQLNAAAAKTQAIYERLKAGADFAQMAIAQSGSDNALEGGDMGWRKAAQLPPPFDR 251

Query: 248 NLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEY 304
            L        T P  T  G   + + ++R       +     ++  + +  + E    E 
Sbjct: 252 ELSAMEVGGITQPARTPGGFIILKLLERRGGETSLKDEVHVRHILVKPSEIRSEAQTKEL 311

Query: 305 VKKLRSNAI 313
            +K+     
Sbjct: 312 AQKIYDRIQ 320



 Score = 89.7 bits (220), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 15/139 (10%), Positives = 50/139 (35%), Gaps = 3/139 (2%)

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLE 239
                 +  ++++++   ++  +   +            + F+      ++ G   ++  
Sbjct: 291 HVRHILVKPSEIRSEAQTKELAQKIYDRIQSGEDFATLAKSFSEDPGSALNGGDLNWIDP 350

Query: 240 SDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKI 297
             L P+FQ ++    Q   + P+ TQ G   + +  +R        +     +     K 
Sbjct: 351 KALVPEFQQVMADTPQGVLSKPFKTQYGWHVLEVLGRRATDNTSQAREQQALSVLRNRKY 410

Query: 298 EKHEAEYVKKLRSNAIIHY 316
           ++    +++++R  A +  
Sbjct: 411 DEELQTWLRQIRDEAYVEN 429


>gi|327479275|gb|AEA82585.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas stutzeri DSM
           4166]
          Length = 435

 Score =  146 bits (368), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 54/322 (16%), Positives = 117/322 (36%), Gaps = 15/322 (4%)

Query: 5   VFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK 64
           + T LSDF++ L    +L+    +   +        R+   ++ +VI    + +RI  ++
Sbjct: 1   MKTKLSDFLRPLLLGTLLLGSATLTTAALAQVQPLDRVVAIVDNDVIMQSQLDQRIQEVR 60

Query: 65  LQK--------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLS 116
                       N  L++  ++ LI E L+ Q  E+SG+      +N      A+   ++
Sbjct: 61  QTIEKRGAEVPPNEVLQQQVLERLISENLQLQIGERSGVRISDEELNQAMATIAQRNNMT 120

Query: 117 AEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITV- 175
            E F   L + G+     ++ +  + I   V +     +    E E+             
Sbjct: 121 PEQFREALARDGLSPETAREQIRREMIISRVRQRRVAERIQVSEQEVQNFLASDLGKLQL 180

Query: 176 -REYLIRTVLFSIPDNKLQNQGFVQKRI-KDAEESRLRLPKDCNKLEKFASKIHDVSIGK 233
             EY +  +L  +P+          +R+ +D  E   +           ++  + +  G 
Sbjct: 181 SEEYHLANILIPVPEAADSATIQAAERMARDTHEQLQKGADFARLAVARSASENALEGGD 240

Query: 234 AQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLS 289
             +   + L P F + + + +    T P  T  G   + + +KR       +     ++ 
Sbjct: 241 MGWRKAAQLPPPFDSLVRELAVGEFTEPVRTPPGFIIVKVLEKRGGETQVRDEVHVRHIL 300

Query: 290 AQNTPTKIEKHEAEYVKKLRSN 311
            + +  + E      VK+LR  
Sbjct: 301 IKPSAIRSEDEARLLVKRLRER 322



 Score = 90.5 bits (222), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 14/139 (10%), Positives = 48/139 (34%), Gaps = 3/139 (2%)

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLE 239
                 I  + ++++   +  +K   E  L           F+      ++ G   ++  
Sbjct: 295 HVRHILIKPSAIRSEDEARLLVKRLRERILAGEDFAELARNFSEDPGSALNGGDLNWIDP 354

Query: 240 SDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKI 297
           + L P+F+ ++   +    + P+ +  G   + +  +R        +           + 
Sbjct: 355 NSLVPEFRQVMANTASGELSQPFQSPYGWHILEVLGRRATDTSEEFREQQARNLLRNRRY 414

Query: 298 EKHEAEYVKKLRSNAIIHY 316
           ++    +++++R  A +  
Sbjct: 415 DEELQAWLRQIRDEAYVEI 433


>gi|91977437|ref|YP_570096.1| hypothetical protein RPD_2969 [Rhodopseudomonas palustris BisB5]
 gi|91683893|gb|ABE40195.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 309

 Score =  146 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 63/306 (20%), Positives = 128/306 (41%), Gaps = 6/306 (1%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           K L     L +FC V +      A +  +   +NGE IT+ DI +R  L +L +      
Sbjct: 4   KFLFRILGLALFCTVTVGGGLGVATAQSVAVMVNGEPITNFDIEQRSKLDRLSRA-SRTR 62

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           +  + ELI E +K +E +K G++   + +   F   +    +S +  +  L  QGI    
Sbjct: 63  QQVLDELIDEKVKIREGKKYGVSPSDSDIESSFSTMSSRMRMSPDQMTKMLSAQGIRPET 122

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITV---REYLIRTVLFSIPDN 190
            K  +  + +W  +V+  F       E +I A               +  +     +  +
Sbjct: 123 LKSKIKAEMVWASLVRGRFKDSLLVGEKDIQAQLGAKGGDEPATTESFEYQLRPVVLIVS 182

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLL 250
           +  +   ++ R K+AE  R R+    +  ++    + + +I        +DL    + +L
Sbjct: 183 RGSDSSALEARRKEAESLRSRVQSCAD-ADRIFKALPNTAIRSTVVKTSADLPQALREIL 241

Query: 251 KKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLR 309
            K+     T P  T++G+E +A+C ++    +   K  +  +    K +    EY++++R
Sbjct: 242 DKTPVGQMTAPEATKQGIEMVALCSRKPTTADTPKKREIREKLFAEKFQAKSKEYLREVR 301

Query: 310 SNAIIH 315
           + A+I 
Sbjct: 302 NAAMIE 307


>gi|330812129|ref|YP_004356591.1| peptidylprolyl isomerase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380237|gb|AEA71587.1| putative peptidylprolyl isomerase [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 438

 Score =  146 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 46/310 (14%), Positives = 109/310 (35%), Gaps = 17/310 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL--------QKINGEL 72
           +++    +   +  +     ++   ++ +V+    + +R+  ++         Q   G L
Sbjct: 12  LMLGALFLGTAANAAVQSIDKVVAIVDNDVVMQSQLDQRVHEVQQTIAKRGGGQPPPGVL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           ++  ++ LIVE L+ Q  E+SGI      +N      A+   +S + F + L + G+   
Sbjct: 72  DQQVLERLIVENLQLQIGERSGIRITDEELNQAVGTIAQRNNMSIDQFRAALARDGLSYE 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             +  +  + +   V +     +    E E+                +      IP  + 
Sbjct: 132 DARDQIRREMVISRVRQRRVAERIQVSEQEVKNFLASDLGKMQLSEELHLANILIPTPES 191

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            N   +Q   + A +   +L +  +        +   + +  G   +   + L P F + 
Sbjct: 192 ANSEAIQSAYRQAMDVYQQLKQGADFGQMAIAKSGSDNALEGGDMGWRKPAQLPPPFDRE 251

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEYV 305
           L   +  + T P  T  G   + + +KR  G    +     ++  + +  + E       
Sbjct: 252 LSAMAVGDITQPARTPGGFIILKVLEKRGGGTQVRDEVHVRHILIKPSEIRSEAETKRLA 311

Query: 306 KKLRSNAIIH 315
           +KL     I 
Sbjct: 312 EKLYDR--IE 319



 Score = 91.7 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 13/139 (9%), Positives = 49/139 (35%), Gaps = 3/139 (2%)

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLE 239
                 I  ++++++   ++  +   +            + F+      ++ G   ++  
Sbjct: 290 HVRHILIKPSEIRSEAETKRLAEKLYDRIEAGEDFAELAKSFSEDPGSALNGGDLNWVDP 349

Query: 240 SDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKI 297
           + L P+F+ ++    Q   + P+ +  G   + +  +R        +           K 
Sbjct: 350 NALVPEFRQVMADTPQGQLSKPFKSPYGWHVLEVLGRRATDSTTQAREQQAMTVLRNRKY 409

Query: 298 EKHEAEYVKKLRSNAIIHY 316
           ++    +++++R  A +  
Sbjct: 410 DEELQTWLRQIRDEAYVEI 428


>gi|257092441|ref|YP_003166082.1| SurA domain-containing protein [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257044965|gb|ACV34153.1| SurA domain protein [Candidatus Accumulibacter phosphatis clade IIA
           str. UW-1]
          Length = 436

 Score =  146 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 46/315 (14%), Positives = 94/315 (29%), Gaps = 16/315 (5%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING---- 70
           LL +  V ++                RI   +N EVIT  ++  R+     Q        
Sbjct: 9   LLMSCLVGVVLAQTASRPLAQPIPVDRIVAVVNDEVITLHELRTRLDGALAQLQRQGTQL 68

Query: 71  ----ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDK 126
                LE+  ++ L+++ ++ Q+    G+  D   +     + A    +S   F + L+K
Sbjct: 69  PPRDVLERQMLERLVIDKVQLQQARDMGVRVDDAQLEQALQRIAAGNKMSLAQFRAALEK 128

Query: 127 QGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
            GI    F++ +  +     V + +   K    E EI                       
Sbjct: 129 DGIAFASFREEIRGEMTIARVREREVESKIFISEGEIDNYLAGASGQGGAVEEFNLAHIL 188

Query: 187 IPDNKLQNQGFVQKRIKDAE---ESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLH 243
           +   +  +   +QK     E   E   +  +       ++     +  G   +     L 
Sbjct: 189 LRSPESASPEQIQKLRAKGEQVAERVRKGEEFAQLAAAYSDAPDGLKGGDLGWRSLDRLP 248

Query: 244 PQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRD----LGGEIALKAYLSAQNTPTKIE 298
           P F +          +    +  G   I +  KR        +     ++  +      E
Sbjct: 249 PLFAEAAATLKVGEVSPLLRSSNGFHLIKLVAKRGGGTLAAVQQTHARHILIKVNEVVSE 308

Query: 299 KHEAEYVKKLRSNAI 313
                 ++ LR    
Sbjct: 309 SEARHKLEGLRERIK 323



 Score = 99.0 bits (244), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 15/139 (10%), Positives = 45/139 (32%), Gaps = 2/139 (1%)

Query: 179 LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLL 238
                   I  N++ ++   + +++   E            + F+        G   ++ 
Sbjct: 292 QTHARHILIKVNEVVSESEARHKLEGLRERIKHGESFAELAKLFSQDGSATKGGDLGWVY 351

Query: 239 ESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTK 296
             D  P+F+  +   +    + P  +  G   I + ++R        +           K
Sbjct: 352 PGDTVPEFERAMNLLAPGEVSEPVQSPFGFHLIEVLERRVQDVSSDRQRAGARQVLRERK 411

Query: 297 IEKHEAEYVKKLRSNAIIH 315
            ++   +++++ R  A + 
Sbjct: 412 RDEAYQDWLRQTRDRAYVE 430


>gi|56476034|ref|YP_157623.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Aromatoleum
           aromaticum EbN1]
 gi|56312077|emb|CAI06722.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Aromatoleum
           aromaticum EbN1]
          Length = 454

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 40/327 (12%), Positives = 104/327 (31%), Gaps = 21/327 (6%)

Query: 6   FTSLSDFIKLLTTYFVLIIFCIVPIV----SYKSWAMSSRIRTTINGEVITDGDISKRIA 61
             +L      L+      + C   +     +         I   +N EVIT  ++ +R+ 
Sbjct: 13  RIALRRISSRLSLVLFAALSCATALFPAHAANPRSVEVDHIAAVVNNEVITARELRERVE 72

Query: 62  LLKLQKING--------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNT 113
               Q             LE+  ++ L++E  + Q   ++ +  D  T+     + A + 
Sbjct: 73  QAIHQLNRQGTPQPPADVLERQLLERLVLERAQLQLARETSLQVDEATLERAIARIAESN 132

Query: 114 GLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNI 173
            L+     + L+K G+  + F+  +  + +   + + +   +    + E+        + 
Sbjct: 133 RLTIAQLQAALEKDGVSWSRFRDNIRTEILLTRLREREVDNRIVVTDAEVDNFLANNADA 192

Query: 174 TVREYLIRTVLFSIPDN--KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI 231
              E      +          Q    +  R + A++              ++     ++ 
Sbjct: 193 LSGEEFELAHILIRVPEAATQQQMAGLVARAETAKQRLNSGDDFARVAASYSDAPDAMNG 252

Query: 232 GKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKR------DLGGEIAL 284
           G   +     L P F + + + S  + +    +  G+  + + D+R          E   
Sbjct: 253 GALGWRSRDRLPPLFAEAVRELSPGSVSPVLRSSAGLHIVKLLDRRGGAAAGPQQLEQTR 312

Query: 285 KAYLSAQNTPTKIEKHEAEYVKKLRSN 311
             ++  + +    +      +  LR  
Sbjct: 313 ARHILIRTSEILNDSEAESRLLGLRER 339



 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 28/282 (9%), Positives = 85/282 (30%), Gaps = 14/282 (4%)

Query: 46  INGEVI-TDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           ++  ++ TD ++   +A         E E   +  +++   +    ++            
Sbjct: 171 VDNRIVVTDAEVDNFLANNADALSGEEFE---LAHILIRVPEAATQQQMAGLVARAETAK 227

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGN------ 158
             +    +    A  +S   D    G   ++    +  ++ + V+               
Sbjct: 228 QRLNSGDDFARVAASYSDAPDAMNGGALGWRSRDRLPPLFAEAVRELSPGSVSPVLRSSA 287

Query: 159 --LEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDC 216
               +++   +        +    R     I  +++ N    + R+    E  +      
Sbjct: 288 GLHIVKLLDRRGGAAAGPQQLEQTRARHILIRTSEILNDSEAESRLLGLRERVVNGASFA 347

Query: 217 NKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDK 275
              +  ++ +     G   +L   D  P+F+  +        + P  +  G   I +  +
Sbjct: 348 ELAKAHSADLSSAKGGDLGWLSPGDTVPEFERTMNALKPGEVSAPVRSPFGWHLIQVEAR 407

Query: 276 R-DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           R     +   +          K ++   +++++LR    + Y
Sbjct: 408 RLQDVSDERKRNAARNALRERKADEAFEDWLRQLRDRTYVEY 449


>gi|122070617|sp|Q5P7I9|SURA_AZOSE RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
          Length = 439

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 40/324 (12%), Positives = 109/324 (33%), Gaps = 25/324 (7%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMS--------SRIRTTINGEVITDGDISKRIALLK 64
           ++ +++   L++F  +   +    A +          I   +N EVIT  ++ +R+    
Sbjct: 1   MRRISSRLSLVLFAALSCATALFPAHAANPRSVEVDHIAAVVNNEVITARELRERVEQAI 60

Query: 65  LQKING--------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLS 116
            Q             LE+  ++ L++E  + Q   ++ +  D  T+     + A +  L+
Sbjct: 61  HQLNRQGTPQPPADVLERQLLERLVLERAQLQLARETSLQVDEATLERAIARIAESNRLT 120

Query: 117 AEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVR 176
                + L+K G+  + F+  +  + +   + + +   +    + E+        +    
Sbjct: 121 IAQLQAALEKDGVSWSRFRDNIRTEILLTRLREREVDNRIVVTDAEVDNFLANNADALSG 180

Query: 177 EYLIRTVLFSIPDN--KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKA 234
           E      +          Q    +  R + A++              ++     ++ G  
Sbjct: 181 EEFELAHILIRVPEAATQQQMAGLVARAETAKQRLNSGDDFARVAASYSDAPDAMNGGAL 240

Query: 235 QYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKR------DLGGEIALKAY 287
            +     L P F + + + S  + +    +  G+  + + D+R          E     +
Sbjct: 241 GWRSRDRLPPLFAEAVRELSPGSVSPVLRSSAGLHIVKLLDRRGGAAAGPQQLEQTRARH 300

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSN 311
           +  + +    +      +  LR  
Sbjct: 301 ILIRTSEILNDSEAESRLLGLRER 324



 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 28/282 (9%), Positives = 85/282 (30%), Gaps = 14/282 (4%)

Query: 46  INGEVI-TDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           ++  ++ TD ++   +A         E E   +  +++   +    ++            
Sbjct: 156 VDNRIVVTDAEVDNFLANNADALSGEEFE---LAHILIRVPEAATQQQMAGLVARAETAK 212

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGN------ 158
             +    +    A  +S   D    G   ++    +  ++ + V+               
Sbjct: 213 QRLNSGDDFARVAASYSDAPDAMNGGALGWRSRDRLPPLFAEAVRELSPGSVSPVLRSSA 272

Query: 159 --LEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDC 216
               +++   +        +    R     I  +++ N    + R+    E  +      
Sbjct: 273 GLHIVKLLDRRGGAAAGPQQLEQTRARHILIRTSEILNDSEAESRLLGLRERVVNGASFA 332

Query: 217 NKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDK 275
              +  ++ +     G   +L   D  P+F+  +        + P  +  G   I +  +
Sbjct: 333 ELAKAHSADLSSAKGGDLGWLSPGDTVPEFERTMNALKPGEVSAPVRSPFGWHLIQVEAR 392

Query: 276 R-DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           R     +   +          K ++   +++++LR    + Y
Sbjct: 393 RLQDVSDERKRNAARNALRERKADEAFEDWLRQLRDRTYVEY 434


>gi|322417707|ref|YP_004196930.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter sp. M18]
 gi|320124094|gb|ADW11654.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter sp. M18]
          Length = 319

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 48/317 (15%), Positives = 99/317 (31%), Gaps = 14/317 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +  +     L+    V   ++      S I   +N EVIT  D+ +  AL++ +      
Sbjct: 1   MAKIIMACTLLALLAVT-PTFAHAKPISGIAAIVNDEVITSTDVDREYALMQKEAEKLPA 59

Query: 72  -----LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDK 126
                L+  A+  L+ + L +Q+I +  I      V        +   L+ E     L  
Sbjct: 60  SEKMGLKSAALNRLVDKKLVEQKIRELDIKVSDEDVRLAIEDVKKQNNLTQEALEQALAT 119

Query: 127 QGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
           QG+    ++  L  Q     ++  +   K    E E+    +  +               
Sbjct: 120 QGLTFAQYQVQLKEQLERMRLMSQEVRSKIQVGEREMREYYESHRADYGGSETFHARHIF 179

Query: 187 IPDNKLQNQGFVQKRIK---DAEESRLRLPKDCNKLEKFASKIHD-VSIGKAQYLLESDL 242
              +   +     K  K   +               +K++         G       SD+
Sbjct: 180 FKVDPKASAEDAAKAEKLAGEVLAKARAGEDFAELAKKYSQDPSAAKDGGDLGTFKRSDM 239

Query: 243 -HPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLG--GEIALKAYLSAQNTPTKIEK 299
                  +      + ++   +  G+  I +  K          +K  +  Q    K ++
Sbjct: 240 LPEIGDTVAAMKPGDVSSIVSSPAGLHIIKLEQKSQEKGRSFEEVKDSIEEQLYKKKSDE 299

Query: 300 HEAEYVKKLRSNAIIHY 316
              ++VK+LR+ A I  
Sbjct: 300 RFNQWVKELRNAASIDI 316


>gi|119899176|ref|YP_934389.1| putative peptidyl-prolyl cis-trans isomerase [Azoarcus sp. BH72]
 gi|119671589|emb|CAL95502.1| putative peptidyl-prolyl cis-trans isomerase [Azoarcus sp. BH72]
          Length = 439

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 40/313 (12%), Positives = 94/313 (30%), Gaps = 17/313 (5%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING----- 70
           L    V      +P+ +        RI   +N EVIT   +  R+     Q         
Sbjct: 11  LFVALVACSALALPVRAAVQPVAVDRIIAVVNNEVITAVQLRDRVDQTTRQLQRQGVQLP 70

Query: 71  ---ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
               LE+  ++ LIVE  + Q    S +  D  T+     + A N  ++     + L++ 
Sbjct: 71  PADVLERQLLERLIVERAQLQLARDSSLRVDDATLERAIGRIAENNKMNTTQLRAALERD 130

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI 187
           G+  + F+  +  + +   + + +   K    + E+        +    E      +   
Sbjct: 131 GVAWDRFRNEIRTEILLSRLREREVDAKIVVTDAEVDNFLTSNPDAFSGEEFHVAHILLR 190

Query: 188 PDNKL--QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ 245
                  +    +++R                     +     +S G   +     L   
Sbjct: 191 APEGATPEQIDRLRQRADTVINRLRNGEDFARVAADSSDAPDGISGGDLGWRQRDRLPAL 250

Query: 246 FQNLLKK-SQNNTTNPYVTQKGVEYIAICDKR------DLGGEIALKAYLSAQNTPTKIE 298
           + + ++       +    +  G+  + + D+R          E     ++  + +    +
Sbjct: 251 YSDAVRDLRPGELSPLMRSAAGLHLVKLVDRRGGAAAGPQRLEQTRARHILIKTSAVLSD 310

Query: 299 KHEAEYVKKLRSN 311
                 +  LR  
Sbjct: 311 AEAEARLLGLRER 323



 Score =  109 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 17/137 (12%), Positives = 42/137 (30%), Gaps = 2/137 (1%)

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESD 241
             +       L +     + +   E             +  ++ +     G   ++   D
Sbjct: 298 RHILIKTSAVLSDAEAEARLLGLRERVVAGGADFGELAKASSADLSAAKGGDLGWVNPGD 357

Query: 242 LHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKIEK 299
             P+F+  +        + P  +  G   I + ++R        K           K E+
Sbjct: 358 TVPEFERAMNVLKPGEVSPPVRSPFGWHLIQVLERRQQDVTDERKRMAARNILRERKAEE 417

Query: 300 HEAEYVKKLRSNAIIHY 316
              ++V++LR +  + Y
Sbjct: 418 AYEDWVRQLRDSTYVEY 434


>gi|307719645|ref|YP_003875177.1| PPIC-type PPIASE domain-containing protein [Spirochaeta thermophila
           DSM 6192]
 gi|306533370|gb|ADN02904.1| PPIC-type PPIASE domain protein [Spirochaeta thermophila DSM 6192]
          Length = 336

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 48/293 (16%), Positives = 99/293 (33%), Gaps = 17/293 (5%)

Query: 41  RIRTTINGEVITDGDISKRIALLKLQKIN----------GELEKIAVQELIVETLKKQEI 90
            +   +NGE +   ++ + +     Q              +L +  +  LI   L  QE 
Sbjct: 45  EVAARVNGEEVPSKEVEREVQRYVAQYQQYGMEVSPEEEQKLREQVLDVLIGRLLLLQEA 104

Query: 91  EKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN 150
           ++ G++ D   V     Q+   +G S E F + L + G  +  F++ L+   +   VV  
Sbjct: 105 KRMGLSVDQAQVEAQIEQYKLQSG-SEETFKNILAQAGYTEEEFREELSRAFLLQQVVDE 163

Query: 151 DFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRI---KDAEE 207
                    + E  A   +      +   IR     I  +   ++   +       + +E
Sbjct: 164 KVTKHLSVSDEEARAYYDENPEQFEQPEQIRARHILIRLDPDASKEEEEAAYAKIHEVQE 223

Query: 208 SRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKG 266
              +          ++      + G   +     + P F+        N  ++   T+ G
Sbjct: 224 KLKQGADFAELARTYSEGPSAPNGGDLGFFGRGQMVPAFEEAAFALEVNQVSDVVRTEYG 283

Query: 267 VEYIAICDKRDLG--GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHYY 317
           +  I + DK++ G      +K  L       K  +     V++L+  A I  Y
Sbjct: 284 LHLIQVTDKQEAGKASFEEVKDQLKEMLLQQKSSEAINALVEELKGKAEIEIY 336


>gi|225023463|ref|ZP_03712655.1| hypothetical protein EIKCOROL_00321 [Eikenella corrodens ATCC
           23834]
 gi|224943812|gb|EEG25021.1| hypothetical protein EIKCOROL_00321 [Eikenella corrodens ATCC
           23834]
          Length = 317

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 48/312 (15%), Positives = 109/312 (34%), Gaps = 10/312 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI---- 68
           +K+ T    L +     + S  +      I   +  EVIT  ++ + +A  + Q      
Sbjct: 1   MKMKTLVLALGMSLAFQVASANTVRSVDNIVAVVENEVITQRELDQAVAHTRSQMPRGTQ 60

Query: 69  --NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDK 126
               EL++  + +L+ ++L  Q   ++ I      V     + A +   S   F +   +
Sbjct: 61  VSEQELQRQTLMQLVNQSLLVQAGRRNNIQVPDAEVEAEIARIAASRRQSLAQFEAAQAR 120

Query: 127 QGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITV--REYLIRTVL 184
            GI     ++ +    I   V +     +    E EI A   + +   +   +   +T  
Sbjct: 121 FGIDKTALRRQVRDSMIAQRVQQGQTAGEAKVSEDEINAAIARARAQGITLPQATPKTQY 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
            +            Q+  +   ++  R         +++      + G   +L E +  P
Sbjct: 181 HAQHILIASQGERAQRLAQRLAQNAQRGADFSALARQYSQDGSAANGGDLGWLSEGETVP 240

Query: 245 QFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKR-DLGGEIALKAYLSAQNTPTKIEKHEA 302
           +F+  ++       + P  TQ G   I + + R     +  ++A +       K +    
Sbjct: 241 EFERAMRGLKPGQVSAPVHTQFGWHVIRLVEARTPNTPDARIRAGVHDAIAAQKTQAAMQ 300

Query: 303 EYVKKLRSNAII 314
             +++L  N+ I
Sbjct: 301 SLLQQLHQNSFI 312


>gi|316933705|ref|YP_004108687.1| SurA domain [Rhodopseudomonas palustris DX-1]
 gi|315601419|gb|ADU43954.1| SurA domain [Rhodopseudomonas palustris DX-1]
          Length = 308

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 62/308 (20%), Positives = 122/308 (39%), Gaps = 4/308 (1%)

Query: 12  FIKLLTTYFVLIIFC--IVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN 69
            +  L+   + ++ C     +      + +  I   +NGE IT+ DI +R  L ++   N
Sbjct: 1   MMSKLSLRIIGLVLCCAAATLGLGTGPSQAQSIVVMVNGEPITNFDIEQRSKLNRMSHKN 60

Query: 70  GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
               +  + +LI E +K +E +K G+    + ++  F   A    +S    ++ L  QGI
Sbjct: 61  ES-RQQVLDDLIDEKVKIKEGKKYGVNPSDSDIDSSFATMASRMRMSTAQMTNMLAAQGI 119

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITV-REYLIRTVLFSIP 188
             +  K  +  + +W  +V+  F       E EI A  +   +      Y  +     + 
Sbjct: 120 RPDTLKSRIKAEMVWGSLVRGRFKDSLQVSEREIQAQLKGNDDSKAVESYEYQLRPIVMI 179

Query: 189 DNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN 248
            ++      +  R K+AE+ R R+         F +  +    G                
Sbjct: 180 VSRGSGSSSLDTRRKEAEQIRGRITSCAEADRIFKAMPNAAIRGTVVKTSADLPPALRDV 239

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKL 308
           L K    + T P VT++GVE +A+C ++    +   K  +  +    K      +Y++++
Sbjct: 240 LDKTPVGHLTAPEVTKQGVEMVALCGRKQSTADTPRKREIREKLFGEKFLAKSKDYLQEV 299

Query: 309 RSNAIIHY 316
           R  A+I Y
Sbjct: 300 RKAAMIEY 307


>gi|254473455|ref|ZP_05086852.1| SurA N-terminal domain family protein [Pseudovibrio sp. JE062]
 gi|211957571|gb|EEA92774.1| SurA N-terminal domain family protein [Pseudovibrio sp. JE062]
          Length = 313

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 73/312 (23%), Positives = 130/312 (41%), Gaps = 12/312 (3%)

Query: 15  LLTTYFVLIIFCIVPIVS-----YKSWAMSSRIRTTINGEVITDGDISKRIALLKL--QK 67
           +  T F   +F    I++       S   +S+I   +NG  IT  ++ +R  L+ L  + 
Sbjct: 1   MKLTRFCASLFVAASILAPVGPMLTSAEAASKIVAVVNGRPITSYELQQRSKLISLTTRA 60

Query: 68  INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
            +   ++ A  ELI E LK  E ++ G++   + V+  F   A+   +S   F   L + 
Sbjct: 61  PSSIAKRKAKDELIDEALKLAEAKRVGVSISDSKVDDAFATIAQRVKMSPSQFKQALSQS 120

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNI---TVREYLIRTVL 184
           G+     K  L  +  W +VV   F       E ++ A  Q  +N               
Sbjct: 121 GVNPRTLKSRLRAEISWSEVVMQRFRATVRINESDVIAALQGRENKDDSGATSVEYDLQR 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
                 K  ++ F  KR+ + ++ R R      +  + AS +++V +      LE+DL P
Sbjct: 181 IIFVIPKNSSKTFKNKRVSEMKKLRARFTSC-EEGTRLASGLNEVVVRPIGKRLETDLPP 239

Query: 245 QF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAE 303
            F + L + S    T P     G E IA+C K  +  +   ++ +  +    K ++    
Sbjct: 240 AFVKKLNEISIGRVTAPTPVDSGFEMIALCGKETINSDATARSTIEGELRNKKGQQLSRR 299

Query: 304 YVKKLRSNAIIH 315
           Y++ LRSNA+I 
Sbjct: 300 YLRDLRSNAVIE 311


>gi|115375725|ref|ZP_01462979.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Stigmatella
           aurantiaca DW4/3-1]
 gi|310825132|ref|YP_003957490.1| peptidylprolyl cis-trans isomerase [Stigmatella aurantiaca DW4/3-1]
 gi|115367288|gb|EAU66269.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Stigmatella
           aurantiaca DW4/3-1]
 gi|309398204|gb|ADO75663.1| Peptidylprolyl cis-trans isomerase [Stigmatella aurantiaca DW4/3-1]
          Length = 322

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 52/299 (17%), Positives = 110/299 (36%), Gaps = 19/299 (6%)

Query: 36  WAMSSRIRTTINGEVITDGDISKRIALLKLQKING-----------ELEKIAVQELIVET 84
             +  R+   +N ++IT  ++++R A    +               ++ K ++  LI E 
Sbjct: 21  AELVDRVAAVVNRDIITLSEVNQRAAPELSRLAGEKDPRRRADGRAQILKQSLDVLIAEK 80

Query: 85  LKKQEIEKSGITFDSNTVNYFFVQHARNTG-LSAEDFSSFLDKQGIGDNHFKQYLAIQSI 143
           L + EI + G+T   + V+       +  G  + E F   L ++G     ++++L+ Q  
Sbjct: 81  LIEAEIRELGMTVSPSEVDEAMADVRKQNGVETPEQFEQLLQREGYTLKSYREFLSKQIA 140

Query: 144 WPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIK 203
              +++     K    E ++ A   +   +   E  +      +  +    Q  V    K
Sbjct: 141 RGRLMQMKVGPKVKVSEEDLKAAYAQYAKLEGGEAEVHARHILVSVDPKATQEQVDAAQK 200

Query: 204 DA----EESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTT 258
            A    EE+R       +     +        G   +     + P F+       +   +
Sbjct: 201 KAQAIAEEARRPGMDFASLARARSEGPSAEDGGDLGFFRRGVMVPAFEKTAFALKEGEVS 260

Query: 259 NPYVTQKGVEYIAICDKR--DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            P  T  G   + + ++R   +     L+A L  Q    K EK+  +YV++LR  + + 
Sbjct: 261 EPIRTNFGWHVLKVEERRAVGVAPFEDLRAKLEQQLRQDKTEKYIDQYVQELRQKSSVE 319


>gi|70732935|ref|YP_262706.1| survival protein SurA [Pseudomonas fluorescens Pf-5]
 gi|68347234|gb|AAY94840.1| survival protein SurA [Pseudomonas fluorescens Pf-5]
          Length = 440

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 45/310 (14%), Positives = 104/310 (33%), Gaps = 17/310 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK--------INGEL 72
           +++    +   +  +     ++   ++ +V+    + +R+  ++               L
Sbjct: 14  LMLGALFLSTAASAAVQSIDKVVAIVDNDVVMQSQLDQRVHEVQQTIAKRGGGVPPTSVL 73

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           E+  ++ LIVE L+ Q  E+SGI      +N      A+   +S E F + L   G+   
Sbjct: 74  EQQVLERLIVENLQLQIGERSGIRITDEELNQAIGTIAQRNSMSIEQFRAALAHDGLSYE 133

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             +  +  + I   V +     +    E E+                +      IP  + 
Sbjct: 134 DARDQVRREMIISRVRQRRVAERIQVSEQEVKNFLASDLGKMQLSEELHLANILIPTPES 193

Query: 193 QNQGFV---QKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            N   +    ++  +  +   +           +   + +  G   +   + L P F + 
Sbjct: 194 ANSEAIQSAARQAMEVYQQLKQGADFAQLAIARSGSDNALEGGDMGWRKAAQLPPPFDRE 253

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEYV 305
           L   +  + T P  T  G   + + DKR  G    +     ++  + +  + E+      
Sbjct: 254 LSAMAVGDITQPARTPGGFIILKLLDKRGGGNQVRDEVHVRHILIKPSEIRSEEETKRLA 313

Query: 306 KKLRSNAIIH 315
           +KL     I 
Sbjct: 314 QKLYDR--IE 321



 Score = 91.3 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 13/139 (9%), Positives = 50/139 (35%), Gaps = 3/139 (2%)

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLE 239
                 I  ++++++   ++  +   +            + ++      ++ G   ++  
Sbjct: 292 HVRHILIKPSEIRSEEETKRLAQKLYDRIEAGEDFAELAKSYSEDPGSALNGGDLNWIDP 351

Query: 240 SDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKI 297
           + L P+F+ ++ K  Q   + P+ +  G   + +  +R        +           K 
Sbjct: 352 NALVPEFREVMAKTPQGQLSKPFKSPYGWHVLEVLGRRATDSTSQAREQQAMTVLRNRKY 411

Query: 298 EKHEAEYVKKLRSNAIIHY 316
           ++    +++++R  A +  
Sbjct: 412 DEELQTWLRQIRDEAYVEI 430


>gi|330878394|gb|EGH12543.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330963847|gb|EGH64107.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 440

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 45/313 (14%), Positives = 106/313 (33%), Gaps = 19/313 (6%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   ++    + +      +   ++ +VI    + +R+  ++              +L
Sbjct: 12  LMLGALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAADL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           +   +  LI+E L+ Q  E+SGI    + +N      A+   +S + F + L   G+  N
Sbjct: 72  QPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVDQFRAALAHDGLSYN 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             ++ +  + I   V +     +    E E+       +               I     
Sbjct: 132 DAREQVRREMIISRVRQRRVAERIQVSEQEVKNFLASDQGKAQLSEEFHLANILIATPDS 191

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLE---KFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +   +Q     A+    +L K  +  +     +S  + +  G   +   + L P F   
Sbjct: 192 ASSDAIQAAAVKAKSIYDQLKKGADFAKIAATTSSSENALEGGDMGWRKAAQLPPPFGDM 251

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-----EIALKAYLSAQNTPTKIEKHEAE 303
           L      + T P  T  G   + + +KR   G     +     ++  + +  + E+    
Sbjct: 252 LSSMPIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILIKPSEIRSEEATKL 311

Query: 304 YVKKLRSNAIIHY 316
             +K+     I  
Sbjct: 312 LAQKIYER--IEN 322



 Score = 93.2 bits (229), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 15/149 (10%), Positives = 52/149 (34%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++++   +   +   E            + F+      +
Sbjct: 282 QGQAQMRDEVHVRHILIKPSEIRSEEATKLLAQKIYERIENGEDFATLAKSFSEDPGSAL 341

Query: 230 SIGKAQYLLESDLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-Y 287
           + G   ++  + L P+F++++    Q   + P+ T  G   + +  +R        +   
Sbjct: 342 NGGDLNWVDPNSLVPEFRDVMSSTPQGELSKPFKTAYGWHVLEVLGRRATDATGQARDQQ 401

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
             +     K ++    +++++R  A +  
Sbjct: 402 ALSVLRNRKYDEELQTWLRQIRDEAYVEI 430


>gi|78224732|ref|YP_386479.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter
           metallireducens GS-15]
 gi|78195987|gb|ABB33754.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter
           metallireducens GS-15]
          Length = 333

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 53/319 (16%), Positives = 103/319 (32%), Gaps = 17/319 (5%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--- 71
           ++ T     +  I  + S     + +RI   +N E+IT   + K  A +  +    +   
Sbjct: 1   MIKTLITATLVLIATLPSPSHAEVVNRILAVVNDEIITSYAVEKEKATILKEAERQQPPP 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L++ A+  LI + L +Q++ +  I      V        R   LS E   S L
Sbjct: 61  PPESLVHLDETALNRLIDKKLVEQKVRELDIKVSEEEVRQAIEDVKRQNKLSQESLVSAL 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
             QG+  + +K  +  Q     +V  +   K    E E+    +        E   R   
Sbjct: 121 ANQGLSFDQYKVQIREQLERLRLVSQEVRSKIQVGEREMREYYEANPGRFGGEENFRARN 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLR---LPKDCNKLEKFASKIHDVS-IGKAQYLLES 240
                ++      V+K +  A                  + +      +  G      + 
Sbjct: 181 IYFKLDEKMPADQVKKIMTTALTVLHEARDGKDFAELARQHSDDPAAKNTGGDLGTFRKG 240

Query: 241 D-LHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDK--RDLGGEIALKAYLSAQNTPTKI 297
           D L    ++L+K      ++      G+  + +  +          +KA +       K 
Sbjct: 241 DILPEFEESLIKMKPGEVSDLIYVSGGLHIVKLEARFAGTPKPFEQVKAEVEDILYRKKS 300

Query: 298 EKHEAEYVKKLRSNAIIHY 316
           E+   ++V  LR  A I  
Sbjct: 301 EERFNQWVADLRKGAAIEI 319


>gi|294671290|ref|ZP_06736142.1| hypothetical protein NEIELOOT_02999 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307017|gb|EFE48260.1| hypothetical protein NEIELOOT_02999 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 320

 Score =  143 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 42/315 (13%), Positives = 97/315 (30%), Gaps = 13/315 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK-----LQK 67
           +K        ++ C     S         +       VIT     + +A  +      + 
Sbjct: 1   MKPQKILTAALLACFFQTASAADIKTVDGVAAVAGDSVITMRQFEQAVAQARRLPAAQRP 60

Query: 68  INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
              EL +  + +LI ++L  Q  ++ G+      V+      A    +S +   +   K 
Sbjct: 61  PENELRQQVLAQLINQSLIVQAGKRRGLAATQAEVDEAVAHAAAEQKISVDQLYARAAKD 120

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP------ANKQKMKNITVREYLIR 181
           G+     ++  A   +   V +   +      E E+         +             R
Sbjct: 121 GLSKAALRRQTADALVAQKVQQQAILQNARVSEAEVDAALARAQQQGVAIPEGKAPRQYR 180

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESD 241
                I   K       +  I        +         +++        G   +  +  
Sbjct: 181 AQHILIKAEKENAVAAAETVINKIRAQAEKGRDFGELARQYSQDGSAPQGGDLGWFGDGM 240

Query: 242 LHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDL-GGEIALKAYLSAQNTPTKIEK 299
           + P+F++ ++K  +   + P  TQ G   I + D R++   E   +  +       K E+
Sbjct: 241 MVPEFESAVQKLKKGQVSRPVRTQFGWHLIKLNDVREVGTPEERRRNTIRQYIMQQKAEQ 300

Query: 300 HEAEYVKKLRSNAII 314
              + +++L  +  +
Sbjct: 301 AAGQLLQQLHESTYV 315


>gi|302130724|ref|ZP_07256714.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           tomato NCPPB 1108]
          Length = 440

 Score =  143 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 45/313 (14%), Positives = 105/313 (33%), Gaps = 19/313 (6%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   ++    + +      +   ++ +VI    + +R+  ++              +L
Sbjct: 12  LMLGALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAADL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           +   +  LI+E L+ Q  E+SGI    + +N      A+   +S E F + L   G+   
Sbjct: 72  QPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVEQFRAALAHDGLSYE 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             ++ +  + I   V +     +    E E+       +               I     
Sbjct: 132 DAREQVRREMIISRVRQRRVAERIQVSEQEVKNFLASDQGKAQLSEEFHLANILIATPDS 191

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLE---KFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +   +Q     A+    +L K  +  +     +S  + +  G   +   + L P F   
Sbjct: 192 ASSDAIQAAAVKAKSIYDQLKKGADFAKIAATTSSSENALEGGDMGWRKAAQLPPPFGDM 251

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-----EIALKAYLSAQNTPTKIEKHEAE 303
           L      + T P  T  G   + + +KR   G     +     ++  + +  + E+    
Sbjct: 252 LSSMPIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILIKPSEIRSEEATKL 311

Query: 304 YVKKLRSNAIIHY 316
             +K+     I  
Sbjct: 312 LAQKIYER--IEN 322



 Score = 92.8 bits (228), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 15/149 (10%), Positives = 52/149 (34%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++++   +   +   E            + F+      +
Sbjct: 282 QGQAQMRDEVHVRHILIKPSEIRSEEATKLLAQKIYERIENGEDFATLAKSFSEDPGSAL 341

Query: 230 SIGKAQYLLESDLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-Y 287
           + G   ++  + L P+F++++    Q   + P+ T  G   + +  +R        +   
Sbjct: 342 NGGDLNWVDPNSLVPEFRDVMSSTPQGELSKPFKTAYGWHVLEVLGRRATDATGQARDQQ 401

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
             +     K ++    +++++R  A +  
Sbjct: 402 ALSVLRNRKYDEELQTWLRQIRDEAYVEI 430


>gi|167031450|ref|YP_001666681.1| SurA domain-containing protein [Pseudomonas putida GB-1]
 gi|166857938|gb|ABY96345.1| SurA domain [Pseudomonas putida GB-1]
          Length = 441

 Score =  143 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 45/322 (13%), Positives = 110/322 (34%), Gaps = 17/322 (5%)

Query: 9   LSDFIKLL-TTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK 67
           ++   KL+     VL+   ++    + +     R+   ++ +V+    + +R+  ++   
Sbjct: 1   MNVKTKLIDRLRPVLLGAALLSGAVHAAVQPLDRVVAIVDNDVVMQSQLDQRVHEVQQTI 60

Query: 68  --------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAED 119
                     G LE+  ++ LIVE L+ Q  E+SGI      +N      A+  G+S + 
Sbjct: 61  AKRGGGVPPTGALEQQVLERLIVENLQLQIGERSGIRITDEELNQAIGTIAQRNGMSLDQ 120

Query: 120 FSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYL 179
           F + L   G+  +  ++ +  + I   V +     +    E E+                
Sbjct: 121 FRAALAHDGLSFDDAREQVKREMIISRVRQRRVAERIQVSEQEVKNFLNSDMGKMQMSEE 180

Query: 180 IR---TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQY 236
            R    ++ +       +     +++ D  +   +           ++  + +  G+  +
Sbjct: 181 YRLANILIPTPEAANSDDIQKAARKVGDVYQQLRQGADFGQMAIANSASENALEGGEMGW 240

Query: 237 LLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG----EIALKAYLSAQ 291
                L P F  +L        T P     G   + + +KR        +     ++  +
Sbjct: 241 RKAGQLPPDFAKMLSSMPVGEITQPIRIPNGFIILKLEEKRGGSENVLRDEVHVRHILIK 300

Query: 292 NTPTKIEKHEAEYVKKLRSNAI 313
            +  + E    +  ++L     
Sbjct: 301 PSEIRSEAATEQLAERLYDRIK 322



 Score = 92.0 bits (226), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 26/274 (9%), Positives = 86/274 (31%), Gaps = 9/274 (3%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELI-----VETLKKQEIEKSGITFDSNTVNYF 105
           +++ ++   +     +    E  ++A   LI       +   Q+  +             
Sbjct: 159 VSEQEVKNFLNSDMGKMQMSEEYRLA-NILIPTPEAANSDDIQKAARKVGDVYQQLRQGA 217

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA 165
                     ++E+     +             A       V +    ++  N  + +  
Sbjct: 218 DFGQMAIANSASENALEGGEMGWRKAGQLPPDFAKMLSSMPVGEITQPIRIPNGFIILKL 277

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK 225
            +++  +  V    +      I  ++++++   ++  +   +            + F+  
Sbjct: 278 EEKRGGSENVLRDEVHVRHILIKPSEIRSEAATEQLAERLYDRIKNGEDFGELAKSFSED 337

Query: 226 I-HDVSIGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIA 283
               ++ G   ++  + L P+F+  +    Q   T P+ TQ G   + +  +R       
Sbjct: 338 PGSALNGGDLNWVDPNSLVPEFREQMANAQQGVVTKPFKTQYGWHVLEVLGRRATDSTEQ 397

Query: 284 LKA-YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            +     +     K ++    +++++R  A +  
Sbjct: 398 AREQQALSVLRNRKYDEELQTWLRQIRDEAYVEI 431


>gi|331017629|gb|EGH97685.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 440

 Score =  143 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 45/313 (14%), Positives = 105/313 (33%), Gaps = 19/313 (6%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   ++    + +      +   ++ +VI    + +R+  ++              +L
Sbjct: 12  LMLGALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAADL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           +   +  LI+E L+ Q  E+SGI    + +N      A+   +S E F + L   G+   
Sbjct: 72  QPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVEQFRAALAHDGLSYE 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             ++ +  + I   V +     +    E E+       +               I     
Sbjct: 132 DAREQVRREMIISRVRQRRVAERIQVSEQEVKNFLASDQGKAQLSEEFHLANILIATPDS 191

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLE---KFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +   +Q     A+    +L K  +  +     +S  + +  G   +   + L P F   
Sbjct: 192 ASSDAIQAAAVKAKSIYDQLKKGADFAKIAATTSSSENALEGGDMGWRKAAQLPPPFGDM 251

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-----EIALKAYLSAQNTPTKIEKHEAE 303
           L      + T P  T  G   + + +KR   G     +     ++  + +  + E+    
Sbjct: 252 LSSMPIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILIKPSEIRSEEATRL 311

Query: 304 YVKKLRSNAIIHY 316
             +K+     I  
Sbjct: 312 LAQKIYER--IEN 322



 Score = 92.4 bits (227), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 15/149 (10%), Positives = 52/149 (34%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++++   +   +   E            + F+      +
Sbjct: 282 QGQAQMRDEVHVRHILIKPSEIRSEEATRLLAQKIYERIENGEDFATLAKSFSEDPGSAL 341

Query: 230 SIGKAQYLLESDLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-Y 287
           + G   ++  + L P+F++++    Q   + P+ T  G   + +  +R        +   
Sbjct: 342 NGGDLNWVDPNSLVPEFRDVMSSTPQGELSKPFKTAYGWHVLEVLGRRATDATGQARDQQ 401

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
             +     K ++    +++++R  A +  
Sbjct: 402 ALSVLRNRKYDEELQTWLRQIRDEAYVEI 430


>gi|254787082|ref|YP_003074511.1| chaperone SurA precursor [Teredinibacter turnerae T7901]
 gi|237683982|gb|ACR11246.1| chaperone SurA precursor [Teredinibacter turnerae T7901]
          Length = 428

 Score =  143 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 46/314 (14%), Positives = 103/314 (32%), Gaps = 15/314 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--- 69
           +  +    + +    + + SY    M  R+   ++  VIT  ++  RIA +  +      
Sbjct: 1   MTSIFVSVLAVFALALSLPSYSQPQMLDRVVVIVDKSVITQSELDSRIANITQRAAQAGM 60

Query: 70  -----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L+K  + +LI ETL+    ++ GI      +N        + G   E F+  +
Sbjct: 61  RLPGRDVLQKQVLDQLISETLQLNMAKRYGIEISDADLNGAIQNIKASRGWDDETFAREI 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNIT---VREYLIR 181
             +    + F++ L  +     V +     +    E EI    +             L  
Sbjct: 121 HAEAANMHEFRENLRREITLQQVSQGVVRGRIRISEQEISNFLKSADAQFWISPDYRLGH 180

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESD 241
            ++   P    +     +KR +   +  +            +S    +  G   +   +D
Sbjct: 181 ILIPLPPAPSKEQTEAAEKRAEAIYQQLVNGANFGEMAIAESSGPSALKGGDLGFRKSAD 240

Query: 242 LHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN---TPTKI 297
           L   F +        + + P  +Q G   + + DKR    ++  +A +       +    
Sbjct: 241 LPTLFAEIAPTLEVGDVSKPARSQAGFHILKLMDKRGETKQVVSQAKVRHILLKPSAILP 300

Query: 298 EKHEAEYVKKLRSN 311
                  ++++R  
Sbjct: 301 SDKARAKLEQMREQ 314



 Score = 88.2 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 20/126 (15%), Positives = 42/126 (33%), Gaps = 3/126 (2%)

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL-L 250
            +     K  +  E+            +  +  I   +S G   +        +F     
Sbjct: 300 PSDKARAKLEQMREQIIKGEADFAELAKDNSEDIGSKMSGGDLGWAEPDTFVGEFAQTIR 359

Query: 251 KKSQNNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTKIEKHEAEYVKKLR 309
                  + P+ TQ G   + + D+R     E A++A      T  + E     +++++R
Sbjct: 360 DTKIGEISEPFQTQFGWHILEVLDRRQEDLTEEAIRAKARQVLTSRRFEDETQVWLQEMR 419

Query: 310 SNAIIH 315
            +A I 
Sbjct: 420 DDAFIE 425


>gi|121596392|ref|YP_988288.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Acidovorax sp. JS42]
 gi|120608472|gb|ABM44212.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Acidovorax sp. JS42]
          Length = 471

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 46/308 (14%), Positives = 100/308 (32%), Gaps = 17/308 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK--------INGEL 72
              +       +  +   +  I   +N E IT+ ++ +R   +  Q             L
Sbjct: 48  AATLLPPAGATASNAPRQADYIVAVVNSEPITNNEVRQRTERVVQQIASQGGQVPPQELL 107

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            K  ++ LI+E ++ Q+ +++GI  D   VN      AR   +S ++    L   GI   
Sbjct: 108 AKEVLERLILEKIQVQQAKETGIKVDDYAVNQAEQSVARQNSISVDEMHRRLAADGISKE 167

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI----RTVLFSIP 188
            F++ L  Q +   + + D   +    ++E+    ++ +       L       ++    
Sbjct: 168 RFREELRNQLLALRLRERDVESRVRVSDLEVDQYLREQRQAAGPGKLELNLGHILVKVPE 227

Query: 189 DNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN 248
           +           R ++A               +++      + G             F N
Sbjct: 228 NAGPDEVAQRSARAQEALAKVQAGGDFGAVAREYSDAPEGANGGLLGLRPADRYPELFVN 287

Query: 249 -LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIAL----KAYLSAQNTPTKIEKHEAE 303
              + S  +   P  +  G   + + DK   G           ++  +      E+  AE
Sbjct: 288 ATQQASVGSVVGPVRSPSGFHILKVVDKTQSGVPTTAVQSHARHILLRTNANLSERQAAE 347

Query: 304 YVKKLRSN 311
            ++ LR  
Sbjct: 348 RLEDLRDR 355



 Score =  102 bits (253), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 16/139 (11%), Positives = 45/139 (32%), Gaps = 2/139 (1%)

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLE 239
               +    +  L  +   ++     +              +++        G   +   
Sbjct: 328 HARHILLRTNANLSERQAAERLEDLRDRVARGGADFAALAREYSQDGSAKDGGDLGWASP 387

Query: 240 SDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKI 297
               P+F+  L        + P V++ GV  I + ++R+       +   +       K+
Sbjct: 388 GRYVPEFEEALNALRPGEISRPVVSRFGVHLIQLLERREAKLTQREQREMVRDTVREKKL 447

Query: 298 EKHEAEYVKKLRSNAIIHY 316
           ++  A ++++ R  A + Y
Sbjct: 448 DEAFATWIQEARGRAYVEY 466


>gi|222056791|ref|YP_002539153.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter sp.
           FRC-32]
 gi|221566080|gb|ACM22052.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter sp.
           FRC-32]
          Length = 320

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 49/318 (15%), Positives = 97/318 (30%), Gaps = 16/318 (5%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING---- 70
           +        +  +    +     + + +   +N +VIT  ++ K    +  +        
Sbjct: 1   MNKFLLYFAVSVLFICPAAAKGELITAVAAIVNDDVITTLEVQKETDQIIKEMEKKGPAE 60

Query: 71  -----ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLD 125
                 L KIA+  LI + L +Q+I++  I      +        +   L+ E   + L 
Sbjct: 61  TPDKAALRKIALDRLIDKKLVEQKIKELDIKVPEEELRQSIEDVKKQNNLTQEALVAALA 120

Query: 126 KQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLF 185
            QG+    +K  L  Q     ++  +   K    E EI    +   N    E   R    
Sbjct: 121 GQGLSFEQYKTQLREQLERLRLMSQEVRSKIQVGEREIREYYEANHNRYGEEEFFRARHI 180

Query: 186 SIPDNKLQNQGFVQKRI---KDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESD 241
                K   +    K +       +             +F+         G      + D
Sbjct: 181 FFKVGKDAPESEAAKVMTTATQVLQEARSGKDFAELARQFSDDPAAKKDGGDLGTFKKGD 240

Query: 242 LHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICD--KRDLGGEIALKAYLSAQNTPTKIE 298
           +  + +  +        ++P  T  G   I + +  K        +KA +       K E
Sbjct: 241 MIGEIEAAVSGMKPGEVSDPVKTAAGFHIIKLEERSKGKPRPFEEVKAEIEDLLYKKKSE 300

Query: 299 KHEAEYVKKLRSNAIIHY 316
           +   ++V  LR  A I  
Sbjct: 301 ERFNQWVNDLRKGAAIEI 318


>gi|325922420|ref|ZP_08184189.1| parvulin-like peptidyl-prolyl isomerase [Xanthomonas gardneri ATCC
           19865]
 gi|325547117|gb|EGD18202.1| parvulin-like peptidyl-prolyl isomerase [Xanthomonas gardneri ATCC
           19865]
          Length = 466

 Score =  142 bits (357), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 37/320 (11%), Positives = 106/320 (33%), Gaps = 17/320 (5%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK- 67
           ++    +L    ++I   + P+ S +      RI   ++ +V+   ++ + +  +K Q  
Sbjct: 1   MTKPFSVLLASLLVITSTVSPMASAQQSQPLDRIAAIVDEDVVLQSELDRAVRNVKSQYA 60

Query: 68  -------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
                   +  L++  ++ L++  L+    + +GI      +N      A+  G + +  
Sbjct: 61  GRDNQLPPDDVLQRQVLERLVLVKLQVGRADSTGIRVSDEELNRAIASIAQQNGTTVDGL 120

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180
              L   G+G   F+  +  + I   + ++    +    E E+     +      + +L 
Sbjct: 121 RQKLAADGMGYGDFRASVRDEIIVQRLRQSFAQSRISVSEGEVDTALAQQATTGSQYHLA 180

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKIHDVSIGKAQYLLE 239
             ++        +     QK++   +    +          +++   + +  G   +   
Sbjct: 181 HILVGLPEGANAEQIATGQKKVDGVKALIDKGELDFSAAAVRYSDSPNALEGGDLGWRSL 240

Query: 240 SDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-------AYLSAQ 291
            ++   F   +          P     G + + + + RD       K        ++  +
Sbjct: 241 DEIPNAFAQLIRDMQPGQVAGPLRGPSGFQLLKLVEMRDANAGGEKKLVTEYNARHILVR 300

Query: 292 NTPTKIEKHEAEYVKKLRSN 311
               + E      +  LR+ 
Sbjct: 301 IGDNQTEAQAKAKIDTLRAR 320



 Score = 91.3 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 17/155 (10%), Positives = 41/155 (26%), Gaps = 3/155 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +                       +     Q +   + +I                 ++ 
Sbjct: 275 VEMRDANAGGEKKLVTEYNARHILVRIGDNQTEAQAKAKIDTLRARITGGADFQATAKES 334

Query: 223 ASKI-HDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG 280
           +         G   +       P F + +   +    + P+ TQ G   +     R    
Sbjct: 335 SEDTNSRGQGGDLGWFPADAFGPDFGKQVEGLADGAVSEPFRTQAGWHIVQRVGSRQTDV 394

Query: 281 E-IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
              + +A +       K+E+    Y+++LR  A +
Sbjct: 395 SAESQRAQIRETIGRRKLEEEYNRYLQELRGEAYV 429


>gi|26987145|ref|NP_742570.1| survival protein SurA [Pseudomonas putida KT2440]
 gi|24981777|gb|AAN66034.1|AE016232_7 survival protein SurA [Pseudomonas putida KT2440]
          Length = 439

 Score =  142 bits (357), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 45/329 (13%), Positives = 110/329 (33%), Gaps = 25/329 (7%)

Query: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI 60
           M +K+   L           VL+   ++    + +     R+   ++ +V+    + +R+
Sbjct: 1   MKTKLIDRLRP---------VLLGVALLSGAVHAAVQPLDRVVAIVDNDVVMQSQLDQRV 51

Query: 61  ALLKLQK--------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
             ++               LE+  ++ LIVE L+ Q  E+SGI      +N      A+ 
Sbjct: 52  HEVQQTIAKRGGGVPPTSALEQQVLERLIVENLQLQIGERSGIRITDEELNQAIGTIAQR 111

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN 172
            G+S + F + L + G+  +  ++ +  + I   V +     +    E E+         
Sbjct: 112 NGMSLDQFRAALARDGLSFDDAREQVKREMIISRVRQRRVAERIQVSEQEVKNFLASDLG 171

Query: 173 ITVREYLIR---TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV 229
                   R    ++ +       +     +++ D  +   +           ++  + +
Sbjct: 172 KMQMSEEYRLANILIPTPEAANSDDIQKAARKVGDVYQQLRQGADFGQMAIANSASENAL 231

Query: 230 SIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG----EIAL 284
             G+  +     L P F  +L        T P     G   + + +KR        +   
Sbjct: 232 EGGEMGWRKAGQLPPDFAKMLSSMPVGEITQPIRIPNGFIILKLEEKRGGSENVLRDEVH 291

Query: 285 KAYLSAQNTPTKIEKHEAEYVKKLRSNAI 313
             ++  + +  + E    +  ++L     
Sbjct: 292 VRHILIKPSEIRSEAATEQLAERLYDRIK 320



 Score = 92.0 bits (226), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 22/233 (9%), Positives = 72/233 (30%), Gaps = 3/233 (1%)

Query: 87  KQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPD 146
            Q+  +                       ++E+     +             A       
Sbjct: 197 IQKAARKVGDVYQQLRQGADFGQMAIANSASENALEGGEMGWRKAGQLPPDFAKMLSSMP 256

Query: 147 VVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAE 206
           V +    ++  N  + +   +++  +  V    +      I  ++++++   ++  +   
Sbjct: 257 VGEITQPIRIPNGFIILKLEEKRGGSENVLRDEVHVRHILIKPSEIRSEAATEQLAERLY 316

Query: 207 ESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQ 264
           +            + F+      ++ G   ++  + L P+F+  +    Q   T P+ TQ
Sbjct: 317 DRIKNGEDFGELAKSFSEDPGSALNGGDLNWVDPNSLVPEFREQMANAQQGVVTKPFKTQ 376

Query: 265 KGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            G   + +  +R        +     +     K ++    +++++R  A +  
Sbjct: 377 YGWHVLEVLGRRATDSTEQAREQQALSVLRNRKYDEELQTWLRQIRDEAYVEI 429


>gi|313496769|gb|ADR58135.1| Chaperone surA [Pseudomonas putida BIRD-1]
          Length = 439

 Score =  142 bits (357), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 45/329 (13%), Positives = 109/329 (33%), Gaps = 25/329 (7%)

Query: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI 60
           M +K+   L           VL+   ++    + +     R+   ++ +V+    + +R+
Sbjct: 1   MKTKLIDRLRP---------VLLGVALLSGAVHAAVQPLDRVVAIVDNDVVMQSQLDQRV 51

Query: 61  ALLKLQK--------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
             ++               LE+  ++ LIVE L+ Q  E+SGI      +N      A+ 
Sbjct: 52  HEVQQTIAKRGGGVPPTSALEQQVLERLIVENLQLQIGERSGIRITDEELNQAIGTIAQR 111

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN 172
            G+S + F + L + G+     ++ +  + I   V +     +    E E+         
Sbjct: 112 NGMSLDQFRAALARDGLSFEDAREQVKREMIISRVRQRRVAERIQVSEQEVKNFLASDLG 171

Query: 173 ITVREYLIR---TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV 229
                   R    ++ +       +     +++ D  +   +           ++  + +
Sbjct: 172 KMQMSEEYRLANILIPTPEAANSDDIQKAARKVGDVYQQLRQGADFGQMAIANSASENAL 231

Query: 230 SIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG----EIAL 284
             G+  +     L P F  +L        T P     G   + + +KR        +   
Sbjct: 232 EGGEMGWRKAGQLPPDFAKMLSSMPVGEITQPIRIPNGFIILKLEEKRGGSENVLRDEVH 291

Query: 285 KAYLSAQNTPTKIEKHEAEYVKKLRSNAI 313
             ++  + +  + E    +  ++L     
Sbjct: 292 VRHILIKPSEIRSEAATQQLAERLYDRIK 320



 Score = 90.9 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/233 (9%), Positives = 71/233 (30%), Gaps = 3/233 (1%)

Query: 87  KQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPD 146
            Q+  +                       ++E+     +             A       
Sbjct: 197 IQKAARKVGDVYQQLRQGADFGQMAIANSASENALEGGEMGWRKAGQLPPDFAKMLSSMP 256

Query: 147 VVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAE 206
           V +    ++  N  + +   +++  +  V    +      I  ++++++   Q+  +   
Sbjct: 257 VGEITQPIRIPNGFIILKLEEKRGGSENVLRDEVHVRHILIKPSEIRSEAATQQLAERLY 316

Query: 207 ESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQ 264
           +            + F+      ++ G   ++  + L P+F+  +    Q   T P+ TQ
Sbjct: 317 DRIKNGEDFGELAKSFSEDPGSALNGGDLNWVDPNSLVPEFREQMANAQQGVVTKPFKTQ 376

Query: 265 KGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            G   + +  +R        +           K ++    +++++R  A +  
Sbjct: 377 YGWHVLEVLGRRATDSTEQAREQQALGVLRNRKYDEELQTWLRQIRDEAYVEI 429


>gi|146281122|ref|YP_001171275.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas stutzeri
           A1501]
 gi|145569327|gb|ABP78433.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas stutzeri
           A1501]
          Length = 451

 Score =  142 bits (357), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 39/301 (12%), Positives = 96/301 (31%), Gaps = 15/301 (4%)

Query: 28  VPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK--------INGELEKIAVQE 79
           +   +        R+   ++ +VI    +++R+  ++               L++  ++ 
Sbjct: 40  LAPAALAQVQPLDRVVAIVDNDVIMQSQLNQRMREVQQTIEKRGADAPPTDVLQQQVLER 99

Query: 80  LIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLA 139
           LI E L+ Q  E+SGI      +N      A+   +S E F   L + G+     ++ + 
Sbjct: 100 LITENLQLQIGERSGIRISDEELNQAMGTIAQRNNMSLEQFREALARDGLSLETAREQIR 159

Query: 140 IQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIR---TVLFSIPDNKLQNQG 196
            + +   V +     +      E+                      ++            
Sbjct: 160 REMVISRVRQRRVAERIQVSNQEVQNFLASDLGKLQLSEEYHLANILIAVPEGADSATIQ 219

Query: 197 FVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQN 255
             ++   D  +   +           +   + +  G   +   + L P F   +++ S  
Sbjct: 220 AAERTAMDTYQQLQQGADFARLAVSRSGSENALEGGDMGWRKAAQLPPPFDTEVRELSVG 279

Query: 256 NTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNA 312
             T P  T  G   + + DKR       +     ++  + +  + ++     V++LR   
Sbjct: 280 EVTQPVRTPPGFIMLKLLDKRGGETQVRDEVHVRHILIKPSAIRSDEEARLLVQRLRDRI 339

Query: 313 I 313
            
Sbjct: 340 N 340



 Score = 88.6 bits (217), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 11/138 (7%), Positives = 45/138 (32%), Gaps = 3/138 (2%)

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLE 239
                 I  + +++    +  ++   +              F+      ++ G   ++  
Sbjct: 311 HVRHILIKPSAIRSDEEARLLVQRLRDRINAGEDFAQLARSFSEDPGSALNGGDLNWIDP 370

Query: 240 SDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKI 297
           + L P+F+ ++        +  + +  G   + +  +R        +     +     K 
Sbjct: 371 ASLVPEFREVMANTPSGELSQVFKSPYGWHILEVLGRRATDASEQFREQQALSLLRNRKY 430

Query: 298 EKHEAEYVKKLRSNAIIH 315
           ++    +++++R  A + 
Sbjct: 431 DEELQAWLRQIRDEAYVE 448


>gi|148545689|ref|YP_001265791.1| SurA domain-containing protein [Pseudomonas putida F1]
 gi|148509747|gb|ABQ76607.1| SurA N-terminal domain [Pseudomonas putida F1]
          Length = 439

 Score =  142 bits (357), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 45/329 (13%), Positives = 110/329 (33%), Gaps = 25/329 (7%)

Query: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI 60
           M +K+   L           VL+   ++    + +     R+   ++ +V+    + +R+
Sbjct: 1   MKTKLIDRLRP---------VLLGVALLSGAVHAAVQPLDRVVAIVDNDVVMQSQLDQRV 51

Query: 61  ALLKLQK--------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
             ++               LE+  ++ LIVE L+ Q  E+SGI      +N      A+ 
Sbjct: 52  HEVQQTIAKRGGGVPPTSALEQQVLERLIVENLQLQIGERSGIRITDEELNQAIGTIAQR 111

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN 172
            G+S + F + L + G+  +  ++ +  + I   V +     +    E E+         
Sbjct: 112 NGMSLDQFRAALARDGLSFDDAREQVKREMIISRVRQRRVAERIQVSEQEVKNFLASDLG 171

Query: 173 ITVREYLIR---TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV 229
                   R    ++ +       +     +++ D  +   +           ++  + +
Sbjct: 172 KMQMSEEYRLANILIPTPEAANSDDIQKAARKVGDVYQQLRQGADFGQMAIANSASENAL 231

Query: 230 SIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG----EIAL 284
             G+  +     L P F  +L        T P     G   + + +KR        +   
Sbjct: 232 EGGEMGWRKAGQLPPDFAKMLSSMPVGEITQPIRIPNGFIILKLEEKRGGSENVLRDEVH 291

Query: 285 KAYLSAQNTPTKIEKHEAEYVKKLRSNAI 313
             ++  + +  + E    +  ++L     
Sbjct: 292 VRHILIKPSEIRSEAATQQLAERLYDRIK 320



 Score = 91.3 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/233 (9%), Positives = 72/233 (30%), Gaps = 3/233 (1%)

Query: 87  KQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPD 146
            Q+  +                       ++E+     +             A       
Sbjct: 197 IQKAARKVGDVYQQLRQGADFGQMAIANSASENALEGGEMGWRKAGQLPPDFAKMLSSMP 256

Query: 147 VVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAE 206
           V +    ++  N  + +   +++  +  V    +      I  ++++++   Q+  +   
Sbjct: 257 VGEITQPIRIPNGFIILKLEEKRGGSENVLRDEVHVRHILIKPSEIRSEAATQQLAERLY 316

Query: 207 ESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQ 264
           +            + F+      ++ G   ++  + L P+F+  +    Q   T P+ TQ
Sbjct: 317 DRIKNGEDFGELAKSFSEDPGSALNGGDLNWVDPNSLVPEFREQMANAQQGVVTKPFKTQ 376

Query: 265 KGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            G   + +  +R        +     +     K ++    +++++R  A +  
Sbjct: 377 YGWHVLEVLGRRATDSTEQAREQQALSVLRNRKYDEELQTWLRQIRDEAYVEI 429


>gi|222112631|ref|YP_002554895.1| sura domain-containing protein [Acidovorax ebreus TPSY]
 gi|221732075|gb|ACM34895.1| SurA domain protein [Acidovorax ebreus TPSY]
          Length = 471

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 45/308 (14%), Positives = 100/308 (32%), Gaps = 17/308 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK--------INGEL 72
              +       +  +   +  I   +N E IT+ ++ +R   +  Q             L
Sbjct: 48  AATLLPPAGATASNAPRQADYIVAVVNSEPITNNEVRQRTERVVQQIASQGGKVPPQELL 107

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            K  ++ LI+E ++ Q+ +++GI  D   V+      AR   +S ++    L   GI   
Sbjct: 108 AKEVLERLILEKIQVQQAKETGIKVDDYAVSQAEQSVARQNSISVDEMHRRLAADGISKE 167

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI----RTVLFSIP 188
            F++ L  Q +   + + D   +    ++E+    ++ +       L       ++    
Sbjct: 168 RFREELRNQLLALRLRERDVESRVRVSDLEVDQYLREQRQAAGPGKLELNLGHILVKVPE 227

Query: 189 DNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN 248
           +           R ++A               +++      + G             F N
Sbjct: 228 NAGPDEVAQRSARAQEALAKVQAGGDFGAVAREYSDAPEGANGGLLGLRPADRYPELFVN 287

Query: 249 -LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIAL----KAYLSAQNTPTKIEKHEAE 303
              + S  +   P  +  G   + + DK   G           ++  +      E+  AE
Sbjct: 288 ATQQASVGSVVGPVRSPAGFHILKVVDKTQSGVPTTAVQSHARHILLRTNANLSERQAAE 347

Query: 304 YVKKLRSN 311
            ++ LR  
Sbjct: 348 RLEDLRDR 355



 Score =  102 bits (253), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 16/139 (11%), Positives = 45/139 (32%), Gaps = 2/139 (1%)

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLE 239
               +    +  L  +   ++     +              +++        G   +   
Sbjct: 328 HARHILLRTNANLSERQAAERLEDLRDRVARGGADFAALAREYSQDGSAKDGGDLGWASP 387

Query: 240 SDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEI-ALKAYLSAQNTPTKI 297
               P+F+  L        + P V++ GV  I + ++R+        +  +       K+
Sbjct: 388 GRYVPEFEEALNALRPGEISRPVVSRFGVHLIQLLERREAKLTQREQRDMVRDTVREKKL 447

Query: 298 EKHEAEYVKKLRSNAIIHY 316
           ++  A ++++ R  A + Y
Sbjct: 448 DEAFATWIQEARGRAYVEY 466


>gi|104779703|ref|YP_606201.1| peptidyl-prolyl cis-trans isomerase A [Pseudomonas entomophila L48]
 gi|95108690|emb|CAK13384.1| putative peptidyl-prolyl cis-trans isomerase A [Pseudomonas
           entomophila L48]
          Length = 439

 Score =  142 bits (356), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 51/329 (15%), Positives = 115/329 (34%), Gaps = 25/329 (7%)

Query: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI 60
           M SK+   L   +         +   ++    + +     R+   ++ +V+    + +R+
Sbjct: 1   MKSKLIDRLRPLM---------LGAVLLSGAVHAAVQPIDRVVAIVDNDVVMQSQLDQRV 51

Query: 61  ALLKLQKIN--------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
             ++             G LE+  ++ LIVE L+ Q  E+SGI      +N      A+ 
Sbjct: 52  HEVQQTIAKRGGGVPPAGALEQQVLERLIVENLQLQIGERSGIRITDEELNQAVGTIAQR 111

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN 172
            G+S E F + L   G+  +  ++ +  + I   V +     +    E E+         
Sbjct: 112 NGMSLEQFRAALAHDGLSYDDAREQIKREMIISRVRQRRVAERIQVSEQEVKNFLNSDLG 171

Query: 173 ITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE---KFASKIHDV 229
                   R     IP  +  N   +Q   + A +   +L +  +        ++  + +
Sbjct: 172 KMQLSEEYRLANILIPTPESANSDAIQAAARQAGDVYQQLKQGADFARLAIARSASENAL 231

Query: 230 SIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG----EIAL 284
             G+  +     L P F + L   +  + T P     G   + + +KR        +   
Sbjct: 232 EGGEMGWRKAGQLPPDFAKMLSSMATGDVTQPIRIPNGFIILKLEEKRGGESSVLRDEVH 291

Query: 285 KAYLSAQNTPTKIEKHEAEYVKKLRSNAI 313
             ++  + +  + +K   +  ++L     
Sbjct: 292 VRHILIKPSEIRSDKATEQLAERLYDRIK 320



 Score = 89.7 bits (220), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 16/139 (11%), Positives = 48/139 (34%), Gaps = 3/139 (2%)

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLE 239
                 I  +++++    ++  +   +            + F+      ++ G   ++  
Sbjct: 291 HVRHILIKPSEIRSDKATEQLAERLYDRIKNGEDFSELAKSFSEDPGSALNGGDLNWVDP 350

Query: 240 SDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKI 297
           + L P+F+  +    Q   T P+ TQ G   + +  +R        +           K 
Sbjct: 351 NSLVPEFREQMANAQQGEVTRPFRTQYGWHVLEVMGRRATDSTAQAREQQAMNVLRNRKY 410

Query: 298 EKHEAEYVKKLRSNAIIHY 316
           ++    +++++R  A +  
Sbjct: 411 DEELQTWLRQIRDEAYVEI 429


>gi|330961060|gb|EGH61320.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas syringae
           pv. maculicola str. ES4326]
          Length = 440

 Score =  142 bits (356), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 41/313 (13%), Positives = 100/313 (31%), Gaps = 19/313 (6%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   ++    + +      +   ++ +VI    + +R+  ++               L
Sbjct: 12  LMLGALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAEAL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           +K  +  LI+E L+ Q  E++GI      +N      A+   +S + F + L   G+  +
Sbjct: 72  QKQVLDRLILENLQLQMGERAGIRVSDEELNQAIGTIAQRNNMSVDQFRAALAHDGLSYD 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             ++ +  + I   V +     +    E E+       +               I     
Sbjct: 132 DAREQVRREMIISRVRQRRVAERIQVSEQEVKNFLASDQGKAQLSEEFHLANILIATPDS 191

Query: 193 QNQGFVQKRIKD---AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +   +Q          +   +           +S  + +  G   +   + L P F   
Sbjct: 192 ASSEAIQAAAIKAKSIYDQLKKGADFGKLATTNSSSENALEGGDMGWRKAAQLPPPFGDM 251

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-----EIALKAYLSAQNTPTKIEKHEAE 303
           L      + T P  T  G   + + +KR   G     +     ++  + +  + E+    
Sbjct: 252 LSSMPIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILIKPSEIRSEEATKL 311

Query: 304 YVKKLRSNAIIHY 316
             +K+     I  
Sbjct: 312 LAQKIYDR--IEN 322



 Score = 90.9 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 14/149 (9%), Positives = 50/149 (33%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++++   +   +   +            + F+      +
Sbjct: 282 QGQAQMRDEVHVRHILIKPSEIRSEEATKLLAQKIYDRIENGEDFATLAKSFSEDPGSAL 341

Query: 230 SIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-Y 287
           + G   ++  + L P+F + +    Q   + P+ T  G   + +  +R        +   
Sbjct: 342 NGGDLNWVDPNSLVPEFREVMSNTPQGVLSKPFKTAYGWHVLEVLGRRATDATGQAREQQ 401

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
             +     K ++    +++++R  A +  
Sbjct: 402 ALSVLRNRKYDEELQTWLRQIRDEAYVEI 430


>gi|285019522|ref|YP_003377233.1| ppic-type peptidyl-prolyl cis-trans isomerase [Xanthomonas
           albilineans GPE PC73]
 gi|283474740|emb|CBA17239.1| probable ppic-type peptidyl-prolyl cis-trans isomerase protein
           [Xanthomonas albilineans]
          Length = 455

 Score =  142 bits (356), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 37/320 (11%), Positives = 108/320 (33%), Gaps = 22/320 (6%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQK-- 67
           +    + F+L +  I  + +  +   +    RI   ++ +V+   ++ + +  +K Q   
Sbjct: 1   MTKTLSAFLLAVLAIAGVSAQAAVQQTQPLDRIAAVVDEDVVLQSELDRAVRNVKAQYAG 60

Query: 68  ------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFS 121
                  +  L +  ++ L++  L+      +GI    + +N      A+      +   
Sbjct: 61  RDTQLPPDNVLRRQVLERLVLVKLQVARANSTGIHVSDDELNRAIASIAQQNNTDVDGLR 120

Query: 122 SFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIR 181
             +   G+  + F+  +  +     + ++    +    E E+ A   +    T  +Y + 
Sbjct: 121 KKIAADGMSYDDFRNSVRDEITVQRLRQSFAQSRINVSESEVDAALTQQAT-TGTQYHLA 179

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP--KDCNKLEKFASKIHDVSIGKAQYLLE 239
            +L  +P+     Q    +   D  +S +            +++   + +  G   +   
Sbjct: 180 HILVGLPEGATAEQIKTAQGKIDGVKSLIDKGEIDFNAAAVRYSDSPNALEGGDLGWRSL 239

Query: 240 SDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-------AYLSAQ 291
            ++   F   +          P     G + + + + RD       K        ++ A+
Sbjct: 240 DEIPNAFAQLIRDMKPGQVAGPLRGPSGFQLLKLVEVRDAAANPEKKTVTEYHARHILAR 299

Query: 292 NTPTKIEKHEAEYVKKLRSN 311
            +  + +      ++ LR+ 
Sbjct: 300 VSDAQPDAAAKAKIETLRAR 319



 Score = 83.6 bits (204), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 12/155 (7%), Positives = 44/155 (28%), Gaps = 3/155 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +                          +  Q     + +I+                ++ 
Sbjct: 274 VEVRDAAANPEKKTVTEYHARHILARVSDAQPDAAAKAKIETLRARIAGGADFQKVAKEA 333

Query: 223 ASKIHDVS-IGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIA-ICDKRDLG 279
           +   +  +  G   +         F + ++       + P+ T+ G   +  + +++   
Sbjct: 334 SDDTNSRNQGGDLGWFPIDAFGADFGHQVESLQDGQISPPFRTEAGWHILQRVGERQTDV 393

Query: 280 GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
                +A +       K+E+    +++++R  A +
Sbjct: 394 TSDTQRAQVRETIGRRKLEEEYNRFLQEMRGEAYV 428


>gi|122070668|sp|Q4K4X7|SURA_PSEF5 RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
          Length = 426

 Score =  142 bits (356), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 45/306 (14%), Positives = 101/306 (33%), Gaps = 17/306 (5%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK--------INGELEKIA 76
              +   +  +     ++   ++ +V+    + +R+  ++               LE+  
Sbjct: 4   ALFLSTAASAAVQSIDKVVAIVDNDVVMQSQLDQRVHEVQQTIAKRGGGVPPTSVLEQQV 63

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           ++ LIVE L+ Q  E+SGI      +N      A+   +S E F + L   G+     + 
Sbjct: 64  LERLIVENLQLQIGERSGIRITDEELNQAIGTIAQRNSMSIEQFRAALAHDGLSYEDARD 123

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQG 196
            +  + I   V +     +    E E+                +      IP  +  N  
Sbjct: 124 QVRREMIISRVRQRRVAERIQVSEQEVKNFLASDLGKMQLSEELHLANILIPTPESANSE 183

Query: 197 FV---QKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKK 252
            +    ++  +  +   +           +   + +  G   +   + L P F + L   
Sbjct: 184 AIQSAARQAMEVYQQLKQGADFAQLAIARSGSDNALEGGDMGWRKAAQLPPPFDRELSAM 243

Query: 253 SQNNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEYVKKLR 309
           +  + T P  T  G   + + DKR  G    +     ++  + +  + E+      +KL 
Sbjct: 244 AVGDITQPARTPGGFIILKLLDKRGGGNQVRDEVHVRHILIKPSEIRSEEETKRLAQKLY 303

Query: 310 SNAIIH 315
               I 
Sbjct: 304 DR--IE 307



 Score = 90.5 bits (222), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 13/139 (9%), Positives = 50/139 (35%), Gaps = 3/139 (2%)

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLE 239
                 I  ++++++   ++  +   +            + ++      ++ G   ++  
Sbjct: 278 HVRHILIKPSEIRSEEETKRLAQKLYDRIEAGEDFAELAKSYSEDPGSALNGGDLNWIDP 337

Query: 240 SDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKI 297
           + L P+F+ ++ K  Q   + P+ +  G   + +  +R        +           K 
Sbjct: 338 NALVPEFREVMAKTPQGQLSKPFKSPYGWHVLEVLGRRATDSTSQAREQQAMTVLRNRKY 397

Query: 298 EKHEAEYVKKLRSNAIIHY 316
           ++    +++++R  A +  
Sbjct: 398 DEELQTWLRQIRDEAYVEI 416


>gi|28867781|ref|NP_790400.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|81732691|sp|Q88A44|SURA_PSESM RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|28851016|gb|AAO54095.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           tomato str. DC3000]
          Length = 428

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 45/309 (14%), Positives = 102/309 (33%), Gaps = 19/309 (6%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GELEKIA 76
             ++    + +      +   ++ +VI    + +R+  ++              +L+   
Sbjct: 4   ALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAADLQPQV 63

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           +  LI+E L+ Q  E+SGI    + +N      A+   +S E F + L   G+     ++
Sbjct: 64  LDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVEQFRAALAHDGLSYEDARE 123

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQG 196
            +  + I   V +     +    E E+       +               I      +  
Sbjct: 124 QVRREMIISRVRQRRVAERIQVSEQEVKNFLASDQGKAQLSEEFHLANILIATPDSASSD 183

Query: 197 FVQKRIKDAEESRLRLPKDCNKLE---KFASKIHDVSIGKAQYLLESDLHPQF-QNLLKK 252
            +Q     A+    +L K  +  +     +S  + +  G   +   + L P F   L   
Sbjct: 184 AIQAAAVKAKSIYDQLKKGADFAKIAATTSSSENALEGGDMGWRKAAQLPPPFGDMLSSM 243

Query: 253 SQNNTTNPYVTQKGVEYIAICDKRDLGG-----EIALKAYLSAQNTPTKIEKHEAEYVKK 307
              + T P  T  G   + + +KR   G     +     ++  + +  + E+      +K
Sbjct: 244 PIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILIKPSEIRSEEATKLLAQK 303

Query: 308 LRSNAIIHY 316
           +     I  
Sbjct: 304 IYER--IEN 310



 Score = 92.4 bits (227), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 15/149 (10%), Positives = 52/149 (34%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++++   +   +   E            + F+      +
Sbjct: 270 QGQAQMRDEVHVRHILIKPSEIRSEEATKLLAQKIYERIENGEDFATLAKSFSEDPGSAL 329

Query: 230 SIGKAQYLLESDLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-Y 287
           + G   ++  + L P+F++++    Q   + P+ T  G   + +  +R        +   
Sbjct: 330 NGGDLNWVDPNSLVPEFRDVMSSTPQGELSKPFKTAYGWHVLEVLGRRATDATGQARDQQ 389

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
             +     K ++    +++++R  A +  
Sbjct: 390 ALSVLRNRKYDEELQTWLRQIRDEAYVEI 418


>gi|237803361|ref|ZP_04590946.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331025342|gb|EGI05398.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 440

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 45/313 (14%), Positives = 108/313 (34%), Gaps = 19/313 (6%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   ++    + +      +   ++ +VI    + +R+  ++               L
Sbjct: 12  LMLGALLLSGAVHAAVQPLDSVAAIVDNDVIMKSQVDQRVHEVQQTIAKRGSGVPPAEAL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           +K  +  LI+E L+ Q  E+SGI    + +N      A+   +S E F + L   G+  +
Sbjct: 72  QKQVLDRLILENLQLQMGERSGIRVSDDELNQAIASIAQRNNMSVEQFRAALIHDGVSYD 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITV--REYLIRTVLFSIPDN 190
             ++ +  + I   V +     +    E E+       +       E+ +  +L + PD+
Sbjct: 132 DAREQVRREMIISRVRQRRVAERIQVSEQEVKNFLASDQGKAQLSEEFHLANILIATPDS 191

Query: 191 KLQNQGFVQKRIKDAE-ESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
              +          +  +   +           +S  + +  G   +   + L P F   
Sbjct: 192 ASSDVIQAAALKAKSIYDQAKKGADFAKLAATTSSSENALEGGDMGWRKAAQLPPPFGDM 251

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-----EIALKAYLSAQNTPTKIEKHEAE 303
           L      + T P  T  G   + + +KR   G     +     ++  + +  + E+    
Sbjct: 252 LSSMPIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILIKPSEIRSEEATKL 311

Query: 304 YVKKLRSNAIIHY 316
             +K+     I  
Sbjct: 312 LAQKIYER--IEN 322



 Score = 90.9 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 15/149 (10%), Positives = 51/149 (34%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++++   +   +   E            + F+      +
Sbjct: 282 QGQAQMRDEVHVRHILIKPSEIRSEEATKLLAQKIYERIENGEDFAALAKSFSEDPGSAL 341

Query: 230 SIGKAQYLLESDLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-Y 287
           + G   ++  + L P+F+ ++    Q   + P+ T  G   + +  +R        +   
Sbjct: 342 NGGDLNWVDPNSLVPEFREVMNSTPQGTLSKPFKTAYGWHVLEVLGRRATDATGQAREQQ 401

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
             +     K ++    +++++R  A +  
Sbjct: 402 ALSVLRNRKYDEELQTWLRQIRDEAYVEI 430


>gi|66047852|ref|YP_237693.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas syringae
           pv. syringae B728a]
 gi|63258559|gb|AAY39655.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas syringae
           pv. syringae B728a]
 gi|330970840|gb|EGH70906.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas syringae
           pv. aceris str. M302273PT]
          Length = 442

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 42/313 (13%), Positives = 98/313 (31%), Gaps = 19/313 (6%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   ++    + +      +   ++ +VI    + +R+  ++               L
Sbjct: 14  LMLGALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAEAL 73

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           +   +  LI+E L+ Q  E+SGI      +N      A+   +S E F + L   G+  N
Sbjct: 74  QPQVLDRLILENLQLQMGERSGIRVSDEELNQAIGTIAQRNNMSVEQFRAALAHDGLSYN 133

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             ++ +  + I   V +     +    + E+                       I     
Sbjct: 134 DAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDMGKAQLSEEFHLANILIATPDS 193

Query: 193 QNQGFVQKRIKD---AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +   +Q          +   +           +S  + +  G   +   + L P F   
Sbjct: 194 ASSDAIQAAAVKAKGIYDQLKKGADFTRLAATSSSSENALEGGDMGWRKAAQLPPPFGDM 253

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-----EIALKAYLSAQNTPTKIEKHEAE 303
           L      + T P  T  G   + + +KR   G     +     ++  + +  + E+    
Sbjct: 254 LSSMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILIKPSEIRNEEETKR 313

Query: 304 YVKKLRSNAIIHY 316
             +K+     I  
Sbjct: 314 LAQKIYDR--IEN 324



 Score = 95.1 bits (234), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 17/149 (11%), Positives = 55/149 (36%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++N+   ++  +   +            + F+      +
Sbjct: 284 QGQAQMRDEVHVRHILIKPSEIRNEEETKRLAQKIYDRIENGEDFAELAKSFSEDPGSAL 343

Query: 230 SIGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAY 287
           + G   ++  + L P+F+ ++ +  Q   + P+ TQ G   + +  +R     + A +  
Sbjct: 344 NGGDLNWVDPNSLVPEFRQVMSETPQGVLSKPFQTQYGWHVLEVLGRRSTDATDQAREQQ 403

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                   K ++    +++++R  A +  
Sbjct: 404 ALNVLRNRKYDEELQTWLRQIRDEAYVEI 432


>gi|217969876|ref|YP_002355110.1| SurA domain protein [Thauera sp. MZ1T]
 gi|217507203|gb|ACK54214.1| SurA domain protein [Thauera sp. MZ1T]
          Length = 438

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 44/318 (13%), Positives = 100/318 (31%), Gaps = 18/318 (5%)

Query: 12  FIKLLTTYF-VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK--- 67
           F   +     +      +P+ S        RI   +N EVIT  ++  RI   + Q    
Sbjct: 6   FRSRVAIAIGLAATTLALPVHSAPRAVEVDRIVAVVNNEVITGLELRARIEQTRRQLARQ 65

Query: 68  -----INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSS 122
                    L++  ++ LIVE  + Q   +S +  D  T++    + A N  LS +   +
Sbjct: 66  GAQLPPEEVLQRQLLERLIVERAQLQLARESSLRVDDVTLDRAIERIASNNKLSIDQLRA 125

Query: 123 FLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRT 182
            L+K G+  + F+  +  + +   + + +   +    + EI        +    +     
Sbjct: 126 TLEKDGVTWSRFRDEIRSEILLTRLREREVDSRIVVTDAEIDNFIANNPDAFSGQEFAVA 185

Query: 183 VLFSIPDNKL--QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLES 240
            +          Q    V +R +                 + +     +  G   +    
Sbjct: 186 HILLRTPEGASPQQVEAVARRAEQVMARLRSGEDFARVAAEVSDAPDGLQGGSLGWRPLD 245

Query: 241 DLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRD------LGGEIALKAYLSAQNT 293
            L   F + + +     T+    +  G+  + + D R          E     ++  + +
Sbjct: 246 RLPALFADAVRRMRPGETSPVLRSAAGLHIVRLVDARGGGAAAVQKLEQTRARHILIKTS 305

Query: 294 PTKIEKHEAEYVKKLRSN 311
               +      +  +R  
Sbjct: 306 EVLSDADAEARLLAIRER 323



 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 19/144 (13%), Positives = 50/144 (34%), Gaps = 2/144 (1%)

Query: 175 VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKA 234
            +    R     I  +++ +    + R+    E  +         +  ++ +     G  
Sbjct: 290 QKLEQTRARHILIKTSEVLSDADAEARLLAIRERVVNGADFAELAKASSADLSAARGGDL 349

Query: 235 QYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKR-DLGGEIALKAYLSAQN 292
            +L   D  P+F+  +        + P  +  G   I + ++R     +   +A      
Sbjct: 350 GWLNPGDTVPEFERAMNALRPGEVSAPVRSPFGWHLIQLVERRMQDVTDERKRAAARQAL 409

Query: 293 TPTKIEKHEAEYVKKLRSNAIIHY 316
              K E+   +++++LR +  + Y
Sbjct: 410 RERKAEQAYEDWLRQLRDSTYVDY 433


>gi|21230267|ref|NP_636184.1| peptidyl-prolyl cis-trans isomerase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66769740|ref|YP_244502.1| peptidyl-prolyl cis-trans isomerase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|81304306|sp|Q4UR41|SURA_XANC8 RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|81796311|sp|Q8PCE1|SURA_XANCP RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|21111813|gb|AAM40108.1| peptidyl-prolyl cis-trans isomerase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575072|gb|AAY50482.1| peptidyl-prolyl cis-trans isomerase [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 463

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 40/320 (12%), Positives = 106/320 (33%), Gaps = 17/320 (5%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK- 67
           ++    +L    ++I   + P+ S +      RI   ++ +V+   ++ + +  +K Q  
Sbjct: 1   MTKPFSVLLASLLVITSTVSPLASAQQSQPLDRIAAIVDEDVVLQSELDRAVRNVKSQYA 60

Query: 68  -------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
                   +  L++  ++ L++  L+    E SGI      +N      A+  G S +  
Sbjct: 61  GRDNQLPPDDVLQRQVLERLVLVKLQVGRAEGSGIRVSDEELNRAIASIAQQNGTSVDGL 120

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180
              L   G+G   F+  +  + I   + ++    +    E E+     +      + +L 
Sbjct: 121 RQKLAADGMGYADFRASVRDEIIVQRLRQSFAQSRISVSEGEVDTALAQQATTGSQYHLA 180

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKIHDVSIGKAQYLLE 239
             ++        +     QK++   +    +          +++   + +  G   +   
Sbjct: 181 HILVGLPEGATAEQIATGQKKVDGVKALIDKGELDFSAAAVRYSDSPNALEGGDLGWRSL 240

Query: 240 SDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-------AYLSAQ 291
            ++   F   +          P     G + + + + RD       K        ++  +
Sbjct: 241 DEIPNAFAQLIRDMQPGQVAGPLRGPSGFQLLKLVEMRDANAGGEKKVLTEYNARHILVR 300

Query: 292 NTPTKIEKHEAEYVKKLRSN 311
               + E      +  LR+ 
Sbjct: 301 IGDNQTEAQAKAKIDTLRAR 320



 Score = 91.3 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 17/155 (10%), Positives = 41/155 (26%), Gaps = 3/155 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +                       +     Q +   + +I       +         ++ 
Sbjct: 275 VEMRDANAGGEKKVLTEYNARHILVRIGDNQTEAQAKAKIDTLRARIVGGADFQATAKES 334

Query: 223 ASKI-HDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG 280
           +         G   +       P F + +   +    + P+ TQ G   +     R    
Sbjct: 335 SEDTNSRGQGGDLGWFPADAFGPDFGKQVEGLTDGAVSEPFRTQAGWHIVQRVGTRQTDV 394

Query: 281 E-IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
                +A +       K+E+    Y+++LR  A +
Sbjct: 395 SAENQRAQIRETIGRRKLEEEYNRYLQELRGEAFV 429


>gi|254429963|ref|ZP_05043670.1| SurA N-terminal domain family [Alcanivorax sp. DG881]
 gi|196196132|gb|EDX91091.1| SurA N-terminal domain family [Alcanivorax sp. DG881]
          Length = 442

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 41/308 (13%), Positives = 100/308 (32%), Gaps = 14/308 (4%)

Query: 1   MTSKVFTSLSDFI--KLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISK 58
           M  +   +    +  +      + +   ++P  S     M  RI   +N   I   ++ +
Sbjct: 1   MIDRTLHAARRTLHARHTLLGLLAMAVLMLPAWSQAKVQMLDRIVAVVNDGAIMASELDE 60

Query: 59  RIALLKLQKI--------NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           RI  + LQ             + +  +  +++E L+ Q  E+ GI  D  ++N      A
Sbjct: 61  RINTIALQFQEKGQQLPPPAVMREQVLDRMVLERLQLQLAERGGIKVDDASLNQALAGIA 120

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
           R  G+S EDF++ L + G     F++ +    +   + +     +    + E+       
Sbjct: 121 RQNGMSLEDFAAALRQDGYDWPQFREQIREDMVISRLQQRSVASRIQVTDREVDRFLSSE 180

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIH 227
               + +         +      +   V +    AE    +L    +        +    
Sbjct: 181 LGKQMFQEDFHLGHILVRVPAEASPEDVTQARSKAESIVKKLNDGGDFQQLAVAESDGPK 240

Query: 228 DVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA 286
            +  G       +     F +N +   +   + P  +  G   + + D++    ++  + 
Sbjct: 241 ALEGGDLGSRPAAQWPTLFAENAINLQKGEISEPLRSGAGFHILKMIDRKGGSEKVVTQY 300

Query: 287 YLSAQNTP 294
            +      
Sbjct: 301 QVRHVLIK 308



 Score = 83.2 bits (203), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 17/141 (12%), Positives = 54/141 (38%), Gaps = 3/141 (2%)

Query: 179 LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYL 237
                +    D     +   ++ I+  +E      +  +   +F+       S G+  ++
Sbjct: 300 YQVRHVLIKTDALTSAEQAHKQAIRLHDEIAAGERQFSDTAAEFSDDPGSARSGGELGWV 359

Query: 238 LESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLSAQNTPT 295
            + ++ P+F++++  +     +  + +Q G  ++ + D RD       +    +      
Sbjct: 360 NKGEMVPEFEDMMLNTPVGELSPVFESQFGWHFLRVDDVRDADMSAEFRRMQATQALQKR 419

Query: 296 KIEKHEAEYVKKLRSNAIIHY 316
           + E+    +V++ RS + +  
Sbjct: 420 RFEEELETWVQEKRSESYVDI 440


>gi|188992953|ref|YP_001904963.1| Peptidylprolyl isomerase [Xanthomonas campestris pv. campestris
           str. B100]
 gi|167734713|emb|CAP52923.1| Peptidylprolyl isomerase [Xanthomonas campestris pv. campestris]
          Length = 463

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 40/320 (12%), Positives = 106/320 (33%), Gaps = 17/320 (5%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK- 67
           ++    +L    ++I   + P+ S +      RI   ++ +V+   ++ + +  +K Q  
Sbjct: 1   MTKPFSVLLASLLVITSTVSPLASAQQSQPLDRIAAIVDEDVVLQSELDRAVRNVKSQYA 60

Query: 68  -------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
                   +  L++  ++ L++  L+    E SGI      +N      A+  G S +  
Sbjct: 61  GRDNQLPPDDVLQRQVLERLVLVKLQVGRAEGSGIRVSDEELNRAIASIAQQNGTSVDGL 120

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180
              L   G+G   F+  +  + I   + ++    +    E E+     +      + +L 
Sbjct: 121 RQKLAADGMGYADFRASVRDEIIVQRLRQSFAQSRISVSEGEVDTALAQQATTGSQYHLA 180

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKIHDVSIGKAQYLLE 239
             ++        +     QK++   +    +          +++   + +  G   +   
Sbjct: 181 HILVGLPEGATAEQIATGQKKVDGVKALIDKGELDFSAAAVRYSDSPNALEGGDLGWRSL 240

Query: 240 SDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-------AYLSAQ 291
            ++   F   +          P     G + + + + RD       K        ++  +
Sbjct: 241 DEIPNAFAQLIRDMQPGQVAGPLRGPSGFQLLKLVEMRDANAGGEKKVVTEYNARHILVR 300

Query: 292 NTPTKIEKHEAEYVKKLRSN 311
               + E      +  LR+ 
Sbjct: 301 IGDNQTEAQAKAKIDTLRAR 320



 Score = 91.3 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 17/155 (10%), Positives = 41/155 (26%), Gaps = 3/155 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +                       +     Q +   + +I       +         ++ 
Sbjct: 275 VEMRDANAGGEKKVVTEYNARHILVRIGDNQTEAQAKAKIDTLRARIVGGADFQATAKES 334

Query: 223 ASKI-HDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG 280
           +         G   +       P F + +   +    + P+ TQ G   +     R    
Sbjct: 335 SEDTNSRGQGGDLGWFPADAFGPDFGKQVEGLTDGAVSEPFRTQAGWHIVQRVGTRQTDV 394

Query: 281 E-IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
                +A +       K+E+    Y+++LR  A +
Sbjct: 395 SAENQRAQIRETIGRRKLEEEYNRYLQELRGEAFV 429


>gi|166710727|ref|ZP_02241934.1| peptidyl-prolyl cis-trans isomerase [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 463

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 38/320 (11%), Positives = 105/320 (32%), Gaps = 17/320 (5%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK- 67
           ++    ++    + I   I P+ S +      RI   ++ +V+   ++ + +  +K Q  
Sbjct: 1   MTKPFSVVLASLLAITSTISPLASAQQSQPLDRIAAIVDEDVVLQSELDRAVRNVKSQYA 60

Query: 68  -------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
                   +  L++  ++ LI+  L+    + SGI      +N      A+  G + +  
Sbjct: 61  GRENQLPPDDVLQRQVLERLILVKLQVGRADGSGIRVSDEELNRAIASIAQQNGTTVDGL 120

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180
              L   G+G   F+  +  + I   + ++    +    E E+     +      + +L 
Sbjct: 121 RQKLAADGMGYADFRASVRDEIIVQRLRQSFAQSRISVSEGEVDTALTQQAATGSKYHLA 180

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKIHDVSIGKAQYLLE 239
             ++        +     QK++   +    +          +++   + +  G   +   
Sbjct: 181 HILIGLPEGATAEQIATGQKKVDGVKALIDKGELDFSAAAVRYSDSPNALEGGDLGWRSL 240

Query: 240 SDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-------AYLSAQ 291
            ++   F   +          P     G + + + + RD       K        ++  +
Sbjct: 241 DEIPNAFAQLIRDMKPGQVAGPLRGPSGFQLLKLVEMRDANAGGEKKMVTEYNARHILVR 300

Query: 292 NTPTKIEKHEAEYVKKLRSN 311
               + E      +  +R+ 
Sbjct: 301 VGDNQTEAQAKAKIDTIRAR 320



 Score = 92.4 bits (227), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 18/157 (11%), Positives = 42/157 (26%), Gaps = 3/157 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +                       +     Q +   + +I       +         ++ 
Sbjct: 275 VEMRDANAGGEKKMVTEYNARHILVRVGDNQTEAQAKAKIDTIRARIVGGADFQATAKES 334

Query: 223 ASKI-HDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG 280
           +         G   +       P F + +   +    + P+ TQ G   +     R    
Sbjct: 335 SEDTNSRGQGGDLGWFPADAFGPDFGKQVESLADGAVSEPFRTQAGWHIVQRVGSRQTDV 394

Query: 281 E-IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                +A +       K+E+    Y+++LR  A + Y
Sbjct: 395 SAENQRAQVRETIGRRKLEEEYNRYLQELRGEAYVSY 431


>gi|330891199|gb|EGH23860.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           mori str. 301020]
          Length = 440

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 99/310 (31%), Gaps = 17/310 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   ++    + +      +   ++ +VI    + +R+  ++               L
Sbjct: 12  LMLGALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAEAL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           +   +  LI+E L+ Q  E+SGI    + +N      A+   +S E F + L   G+  N
Sbjct: 72  QPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVEQFRAALAHDGLSYN 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             ++ +  + I   V +     +    + E+       +               I     
Sbjct: 132 DAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDQGKAQLSEEFHLANILIATPDS 191

Query: 193 QNQGFVQKRIKD---AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +   +Q          +   +           +S  + +  G   +   + L P F   
Sbjct: 192 ASSDAIQAAAVKAKGIYDQLKKGADFTQLAATSSSSENALEGGDMGWRKAAQLPPPFGDM 251

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-----EIALKAYLSAQNTPTKIEKHEAE 303
           L      + T P  T  G   + + +KR   G     +     ++  + +  + E+    
Sbjct: 252 LSAMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILIKPSEIRNEEETKR 311

Query: 304 YVKKLRSNAI 313
             +K+     
Sbjct: 312 LAEKIYDRIQ 321



 Score = 95.5 bits (235), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 16/149 (10%), Positives = 53/149 (35%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++N+   ++  +   +            + F+      +
Sbjct: 282 QGQAQMRDEVHVRHILIKPSEIRNEEETKRLAEKIYDRIQNGEDFAELAKSFSEDPGSAL 341

Query: 230 SIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAY 287
           + G   ++  + L P+F+  + +  Q   + P+ T  G   + +  +R     + A +  
Sbjct: 342 NGGDLNWVDPNSLVPEFRQVMNETPQGELSKPFKTAYGWHVLEVLGRRSTDATDQAREQQ 401

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                   K ++    +++++R  A +  
Sbjct: 402 ALNVLRNRKYDEELQTWLRQIRDEAYVEI 430


>gi|330980962|gb|EGH79065.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas syringae
           pv. aptata str. DSM 50252]
          Length = 442

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 42/310 (13%), Positives = 97/310 (31%), Gaps = 17/310 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   ++    + +      +   ++ +VI    + +R+  ++               L
Sbjct: 14  LMLGALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAEAL 73

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           +   +  LI+E L+ Q  E+SGI      +N      A+   +S E F + L   G+  N
Sbjct: 74  QPQVLDRLILENLQLQMGERSGIRVSDEELNQAIGTIAQRNNMSVEQFRAALAHDGLSYN 133

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             ++ +  + I   V +     +    + E+                       I     
Sbjct: 134 DAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDMGKAQLSEEFHLANILIATPDS 193

Query: 193 QNQGFVQKRIKD---AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +   +Q          +   +           +S  + +  G   +   + L P F   
Sbjct: 194 ASSDAIQAAAVKAKGIYDQLKKGADFTRLAATSSSSENALEGGDMGWRKAAQLPPPFGDM 253

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-----LSAQNTPTKIEKHEAE 303
           L      + T P  T  G   + + +KR   GE  ++       +  + +  + E     
Sbjct: 254 LSSMPVGDVTPPARTPGGFIILKLLEKRGGQGEAQMRDEVHVRHILIKPSEIRNEAETKR 313

Query: 304 YVKKLRSNAI 313
             +K+     
Sbjct: 314 LAEKIYDRIQ 323



 Score = 94.0 bits (231), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 17/149 (11%), Positives = 55/149 (36%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++N+   ++  +   +            + F+      +
Sbjct: 284 QGEAQMRDEVHVRHILIKPSEIRNEAETKRLAEKIYDRIQNGEDFAELAKSFSEDPGSAL 343

Query: 230 SIGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAY 287
           + G   ++  + L P+F+ ++ +  Q   + P+ TQ G   + +  +R     + A +  
Sbjct: 344 NGGDLNWVDPNSLVPEFRQVMSETPQGVLSKPFQTQYGWHVLEVLGRRSKDATDQAREQQ 403

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                   K ++    +++++R  A +  
Sbjct: 404 ALNVLRNRKYDEELQTWLRQIRDEAYVEI 432


>gi|289676168|ref|ZP_06497058.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas syringae
           pv. syringae FF5]
 gi|330938460|gb|EGH42067.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas syringae
           pv. pisi str. 1704B]
          Length = 440

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 42/310 (13%), Positives = 97/310 (31%), Gaps = 17/310 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   ++    + +      +   ++ +VI    + +R+  ++               L
Sbjct: 12  LMLGALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAEAL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           +   +  LI+E L+ Q  E+SGI      +N      A+   +S E F + L   G+  N
Sbjct: 72  QPQVLDRLILENLQLQMGERSGIRVSDEELNQAIGTIAQRNNMSVEQFRAALAHDGLSYN 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             ++ +  + I   V +     +    + E+                       I     
Sbjct: 132 DAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDMGKAQLSEEFHLANILIATPDS 191

Query: 193 QNQGFVQKRIKD---AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +   +Q          +   +           +S  + +  G   +   + L P F   
Sbjct: 192 ASSDAIQAAAVKAKGIYDQLKKGADFTRLAATSSSSENALEGGDMGWRKAAQLPPPFGDM 251

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-----LSAQNTPTKIEKHEAE 303
           L      + T P  T  G   + + +KR   GE  ++       +  + +  + E     
Sbjct: 252 LSSMPVGDVTPPARTPGGFIILKLLEKRGGQGEAQMRDEVHVRHILIKPSEIRNEAETKR 311

Query: 304 YVKKLRSNAI 313
             +K+     
Sbjct: 312 LAEKIYDRIQ 321



 Score = 94.0 bits (231), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 17/149 (11%), Positives = 55/149 (36%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++N+   ++  +   +            + F+      +
Sbjct: 282 QGEAQMRDEVHVRHILIKPSEIRNEAETKRLAEKIYDRIQNGEDFAELAKSFSEDPGSAL 341

Query: 230 SIGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAY 287
           + G   ++  + L P+F+ ++ +  Q   + P+ TQ G   + +  +R     + A +  
Sbjct: 342 NGGDLNWVDPNSLVPEFRQVMSETPQGVLSKPFQTQYGWHVLEVLGRRSKDATDQAREQQ 401

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                   K ++    +++++R  A +  
Sbjct: 402 ALNVLRNRKYDEELQTWLRQIRDEAYVEI 430


>gi|58583369|ref|YP_202385.1| peptidyl-prolyl cis-trans isomerase [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|188575375|ref|YP_001912304.1| peptidyl-prolyl cis-trans isomerase [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|75508083|sp|Q5GWC1|SURA_XANOR RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|58427963|gb|AAW77000.1| peptidyl-prolyl cis-trans isomerase [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|188519827|gb|ACD57772.1| peptidyl-prolyl cis-trans isomerase [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 463

 Score =  141 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 38/320 (11%), Positives = 105/320 (32%), Gaps = 17/320 (5%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK- 67
           ++    ++    + I   I P+ S +      RI   ++ +V+   ++ + +  +K Q  
Sbjct: 1   MTKPFSVVLASLLAITSTISPLASAQQSQPLDRIAAIVDEDVVLQSELDRAVRNVKSQYA 60

Query: 68  -------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
                   +  L++  ++ LI+  L+    + SGI      +N      A+  G + +  
Sbjct: 61  GRENQLPPDDVLQRQVLERLILVKLQVGRADGSGIRVSDEELNRAIASIAQQNGTTVDGL 120

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180
              L   G+G   F+  +  + I   + ++    +    E E+     +      + +L 
Sbjct: 121 RQKLAADGMGYADFRASVRDEIIVQRLRQSFAQSRISVSEGEVDTALTQQAATGSKYHLA 180

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKIHDVSIGKAQYLLE 239
             ++        +     QK++   +    +          +++   + +  G   +   
Sbjct: 181 HILIGLPEGATAEQIATGQKKVDGVKALIDKGELDFPAAAVRYSDSPNALEGGDLGWRSL 240

Query: 240 SDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-------AYLSAQ 291
            ++   F   +          P     G + + + + RD       K        ++  +
Sbjct: 241 DEIPNAFAQLIRDMKPGQVAGPLRGPSGFQLLKLMEMRDANAGGEKKMVTEYNARHILVR 300

Query: 292 NTPTKIEKHEAEYVKKLRSN 311
               + E      +  +R+ 
Sbjct: 301 VGDNQTEAQAKAKIDTIRAR 320



 Score = 91.7 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 18/156 (11%), Positives = 41/156 (26%), Gaps = 3/156 (1%)

Query: 164 PANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFA 223
                                  +     Q +   + +I       +         ++ +
Sbjct: 276 EMRDANAGGEKKMVTEYNARHILVRVGDNQTEAQAKAKIDTIRARIVGGADFQATAKESS 335

Query: 224 SKI-HDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
                    G   +       P F + +   +    + P+ TQ G   +     R     
Sbjct: 336 EDTNSRGQGGDLGWFPADAFGPDFGKQVEGLADGAVSEPFRTQAGWHIVQRVGSRQTDVS 395

Query: 282 -IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
               +A +       K+E+    Y+++LR  A + Y
Sbjct: 396 AENQRAQVRETIGRRKLEEEYNRYLQELRGEAYVSY 431


>gi|320326011|gb|EFW82069.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|330985794|gb|EGH83897.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 440

 Score =  141 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 99/310 (31%), Gaps = 17/310 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   ++    + +      +   ++ +VI    + +R+  ++               L
Sbjct: 12  LMLGALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAEAL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           +   +  LI+E L+ Q  E+SGI    + +N      A+   +S E F + L   G+  N
Sbjct: 72  QPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVEQFRAALAHDGLSYN 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             ++ +  + I   V +     +    + E+       +               I     
Sbjct: 132 DAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDQGKAQLSEEFHLANILIATPDS 191

Query: 193 QNQGFVQKRIKD---AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +   +Q          +   +           +S  + +  G   +   + L P F   
Sbjct: 192 ASSDAIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMGWRKAAQLPPPFGDM 251

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-----EIALKAYLSAQNTPTKIEKHEAE 303
           L      + T P  T  G   + + +KR   G     +     ++  + +  + E+    
Sbjct: 252 LSAMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILIKPSEIRNEEETKR 311

Query: 304 YVKKLRSNAI 313
             +K+     
Sbjct: 312 LAEKIYDRIQ 321



 Score = 95.9 bits (236), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 16/149 (10%), Positives = 53/149 (35%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++N+   ++  +   +            + F+      +
Sbjct: 282 QGQAQMRDEVHVRHILIKPSEIRNEEETKRLAEKIYDRIQNGEDFAELAKSFSEDPGSAL 341

Query: 230 SIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAY 287
           + G   ++  + L P+F+  + +  Q   + P+ T  G   + +  +R     + A +  
Sbjct: 342 NGGDLNWVDPNSLVPEFRQVMNETPQGELSKPFKTAYGWHVLEVLGRRSTDATDQAREQQ 401

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                   K ++    +++++R  A +  
Sbjct: 402 ALNVLRNRKYDEELQTWLRQIRDEAYVEI 430


>gi|320332054|gb|EFW87990.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 440

 Score =  141 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 99/310 (31%), Gaps = 17/310 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   ++    + +      +   ++ +VI    + +R+  ++               L
Sbjct: 12  LMLGALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAEAL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           +   +  LI+E L+ Q  E+SGI    + +N      A+   +S E F + L   G+  N
Sbjct: 72  QPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVEQFRAALAHDGLSYN 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             ++ +  + I   V +     +    + E+       +               I     
Sbjct: 132 DAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDQGKAQLSEKFHLANILIATPDS 191

Query: 193 QNQGFVQKRIKD---AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +   +Q          +   +           +S  + +  G   +   + L P F   
Sbjct: 192 ASSDAIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMGWRKAAQLPPPFGDM 251

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-----EIALKAYLSAQNTPTKIEKHEAE 303
           L      + T P  T  G   + + +KR   G     +     ++  + +  + E+    
Sbjct: 252 LSAMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILIKPSEIRNEEETKR 311

Query: 304 YVKKLRSNAI 313
             +K+     
Sbjct: 312 LAEKIYDRIQ 321



 Score = 95.9 bits (236), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 16/149 (10%), Positives = 53/149 (35%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++N+   ++  +   +            + F+      +
Sbjct: 282 QGQAQMRDEVHVRHILIKPSEIRNEEETKRLAEKIYDRIQNGEDFAELAKSFSEDPGSAL 341

Query: 230 SIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAY 287
           + G   ++  + L P+F+  + +  Q   + P+ T  G   + +  +R     + A +  
Sbjct: 342 NGGDLNWVDPNSLVPEFRQVMNETPQGELSKPFKTAYGWHVLEVLGRRSTDATDQAREQQ 401

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                   K ++    +++++R  A +  
Sbjct: 402 ALNVLRNRKYDEELQTWLRQIRDEAYVEI 430


>gi|289663554|ref|ZP_06485135.1| peptidyl-prolyl cis-trans isomerase [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 463

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 38/320 (11%), Positives = 105/320 (32%), Gaps = 17/320 (5%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK- 67
           ++    ++    + I   I P+ S +      RI   ++ +V+   ++ + +  +K Q  
Sbjct: 1   MTKPFSVVLASLLAITSTISPLASAQQSQPLDRIAAIVDEDVVLQSELDRAVRNVKSQYA 60

Query: 68  -------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
                   +  L++  ++ LI+  L+    + SGI      +N      A+  G + +  
Sbjct: 61  GRENQLPPDDVLQRQVLERLILVKLQVGRADGSGIRVSDEELNRAIASIAQQNGTTVDGL 120

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180
              L   G+G   F+  +  + I   + ++    +    E E+     +      + +L 
Sbjct: 121 RQKLAADGMGYADFRASVRDEIIVQRLRQSFAQSRISVSEGEVDTALAQQAATGSQYHLA 180

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKIHDVSIGKAQYLLE 239
             ++        +     QK++   +    +          +++   + +  G   +   
Sbjct: 181 HILIGLPEGATAEQIATGQKKVDGVKALIDKGELDFPAAAVRYSDSPNALEGGDLGWRSL 240

Query: 240 SDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-------AYLSAQ 291
            ++   F   +          P     G + + + + RD       K        ++  +
Sbjct: 241 DEIPNAFAQLIRDMKPGQVAGPLRGPSGFQLLKLVEMRDANAGGEKKMVTEYNARHILVR 300

Query: 292 NTPTKIEKHEAEYVKKLRSN 311
               + E      +  +R+ 
Sbjct: 301 VGDNQTEAQAKAKIDTIRAR 320



 Score = 92.4 bits (227), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 18/157 (11%), Positives = 42/157 (26%), Gaps = 3/157 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +                       +     Q +   + +I       +         ++ 
Sbjct: 275 VEMRDANAGGEKKMVTEYNARHILVRVGDNQTEAQAKAKIDTIRARIVGGADFQATAKES 334

Query: 223 ASKI-HDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG 280
           +         G   +       P F + +   +    + P+ TQ G   +     R    
Sbjct: 335 SEDTNSRGQGGDLGWFPADAFGPDFGKQVEGLADGAVSEPFRTQAGWHIVQRVGSRQTDV 394

Query: 281 E-IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                +A +       K+E+    Y+++LR  A + Y
Sbjct: 395 SAENQRAQVRETIGRRKLEEEYNRYLQELRGEAYVSY 431


>gi|86749597|ref|YP_486093.1| hypothetical protein RPB_2477 [Rhodopseudomonas palustris HaA2]
 gi|86572625|gb|ABD07182.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 309

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 60/306 (19%), Positives = 122/306 (39%), Gaps = 4/306 (1%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           K     F   + C V   S    A +  +   +NGE IT+ DI +R  L KL        
Sbjct: 4   KFSFRIFAAALCCAVASWSGIGLARAQSVAVMVNGEPITNFDIEQRSKLDKLSNQ-SRTR 62

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           +  + ELI E +K +E +K G+    + ++  F   +    +S +     L  QGI    
Sbjct: 63  QQVLDELIDEKVKIREGKKFGVNPSDSDIDSSFASMSSRMRMSPDQMVKMLAAQGIRPGT 122

Query: 134 FKQYLAIQSIWPDVVKNDFMLK--YGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNK 191
            K  +  + +W  +V+  F      G  +++     +   + +  E     +   +    
Sbjct: 123 LKSKIKAEMVWTSLVRGRFKDSLLVGEKDIQAQLAAKGGDDKSTTESFEYQMRPVVLIVS 182

Query: 192 LQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLK 251
             +     +  +   E+     + C   ++    + + +I        +DL P  + +L 
Sbjct: 183 RGSGAGAVEARRKEAEALRSRVQSCADADRIFKALPNAAIRATVVKTSADLPPALREILD 242

Query: 252 KSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRS 310
           K+     T P  T++GVE +A+C ++    +  +K  +  +    K +    +Y+++ R+
Sbjct: 243 KTPVGQMTAPEATKQGVEMVALCSRKPTTADTPMKREIREKMYAEKFQAKSKDYLRESRN 302

Query: 311 NAIIHY 316
            A+I Y
Sbjct: 303 AAMIEY 308


>gi|320354702|ref|YP_004196041.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Desulfobulbus
           propionicus DSM 2032]
 gi|320123204|gb|ADW18750.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Desulfobulbus
           propionicus DSM 2032]
          Length = 327

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 49/323 (15%), Positives = 105/323 (32%), Gaps = 23/323 (7%)

Query: 17  TTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDIS-----------KRIALLKL 65
              F L+  C+V + +  +  +  R    +N + IT  +++           +     +L
Sbjct: 4   RILFFLVSICLVFVSAASNANVVDRSVAIVNNDTITLSEVNELGRSFFKKVTEETPADRL 63

Query: 66  QKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLD 125
            +   +     + +LI + L  QE +K GI      V+    +   N   + E F   L 
Sbjct: 64  PEALQQARNTVIDKLIDKKLLVQEAKKLGIQVSDQEVDNALQRVLANNKATMEQFHKELL 123

Query: 126 KQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLF 185
             G+ +  +K+ L  Q +   ++ ++   K    E +I    Q      V    +     
Sbjct: 124 AMGMTEKQYKEELRDQILSSKLINHEVRTKVVIPEEKILEYYQSNYTRQVGGGELHLQQI 183

Query: 186 SIPDNKL------QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLE 239
                +        +Q   +++I+ A E            +K++        G       
Sbjct: 184 GCTWGEPLANGVVPSQDDAKEKIRKAYEKAKDGDDFNELAKKYSDLPSAEDGGDLGTFQL 243

Query: 240 SDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKR-----DLGGEIALKAYLSAQNT 293
            +L P  Q  + +      +       G  +  +   +           A+K  +  +  
Sbjct: 244 HELAPAMQQAVAQLKSGEISPVVQIDNGYHFFKLVSSQGGATVSKADYEAVKEEIRERLY 303

Query: 294 PTKIEKHEAEYVKKLRSNAIIHY 316
              +E    ++VK +R  A I  
Sbjct: 304 KQAMEARFKDWVKSIRDKAYIKI 326


>gi|301382733|ref|ZP_07231151.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           tomato Max13]
 gi|302063472|ref|ZP_07255013.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           tomato K40]
          Length = 440

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 45/313 (14%), Positives = 105/313 (33%), Gaps = 19/313 (6%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   ++    + +      +   ++ +VI    + +R+  ++              +L
Sbjct: 12  LMLGALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMGQRVREVQQTIAKRGSGVPPAADL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           +   +  LI+E L+ Q  E+SGI    + +N      A+   +S E F + L   G+   
Sbjct: 72  QPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVEQFRAALAHDGLSYE 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             ++ +  + I   V +     +    E E+       +               I     
Sbjct: 132 DAREQVRREMIISRVRQRRVAERIQVSEQEVKNFLASDQGKAQLSEEFHLANILIATPDS 191

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLE---KFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +   +Q     A+    +L K  +  +     +S  + +  G   +   + L P F   
Sbjct: 192 ASSDAIQAAAVKAKSIYDQLKKGADFAKIAATTSSSENALEGGDMGWRKAAQLPPPFGDM 251

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-----EIALKAYLSAQNTPTKIEKHEAE 303
           L      + T P  T  G   + + +KR   G     +     ++  + +  + E+    
Sbjct: 252 LSSMPIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILIKPSEIRSEEATKL 311

Query: 304 YVKKLRSNAIIHY 316
             +K+     I  
Sbjct: 312 LAQKIYER--IEN 322



 Score = 93.2 bits (229), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 15/149 (10%), Positives = 52/149 (34%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++++   +   +   E            + F+      +
Sbjct: 282 QGQAQMRDEVHVRHILIKPSEIRSEEATKLLAQKIYERIENGEDFATLAKSFSEDPGSAL 341

Query: 230 SIGKAQYLLESDLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-Y 287
           + G   ++  + L P+F++++    Q   + P+ T  G   + +  +R        +   
Sbjct: 342 NGGDLNWVDPNSLVPEFRDVMSSTPQGELSKPFKTAYGWHVLEVLGRRATDATGQARDQQ 401

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
             +     K ++    +++++R  A +  
Sbjct: 402 ALSVLRNRKYDEELQTWLRQIRDEAYVEI 430


>gi|325917324|ref|ZP_08179542.1| parvulin-like peptidyl-prolyl isomerase [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325536458|gb|EGD08236.1| parvulin-like peptidyl-prolyl isomerase [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 463

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 36/320 (11%), Positives = 104/320 (32%), Gaps = 17/320 (5%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK- 67
           ++    +L    ++I   + P+ S +      RI   ++ +V+   ++ + +  +K Q  
Sbjct: 1   MTKPFSVLLASLLVITSTVSPLASAQQSQPLDRIAAIVDEDVVLQSELDRAVRNVKSQYA 60

Query: 68  -------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
                   +  L++  ++ L++  L+    + SGI      +N      A+  G + +  
Sbjct: 61  GRENQLPPDDVLQRQVLERLVLVKLQVGRADGSGIRVSDEELNRAIASIAQQNGTTVDGL 120

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180
              L   G+    F+  +  + I   + ++    +    E E+     +      + +L 
Sbjct: 121 RQKLAADGMAYGDFRSSVRDEIIVQRLRQSFAQSRISVSEGEVDTALAQQATTGSQYHLA 180

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKIHDVSIGKAQYLLE 239
             ++              QK++   +    +          +++   + +  G   +   
Sbjct: 181 HILVGLPEGATADQIATGQKKVDGVKALIDKGELDFSAAAVRYSDSPNALEGGDLGWRSL 240

Query: 240 SDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-------AYLSAQ 291
            ++   F   +          P     G + + + + RD       K        ++  +
Sbjct: 241 DEIPNAFAQLIRDMQPGQVAGPLRGPSGFQLLKLVEMRDANAGGEKKMVTEYNARHILVR 300

Query: 292 NTPTKIEKHEAEYVKKLRSN 311
               + +      +  LR+ 
Sbjct: 301 IGDNQTDAQAKAKIDTLRAR 320



 Score = 93.6 bits (230), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 17/157 (10%), Positives = 43/157 (27%), Gaps = 3/157 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +                       +     Q     + +I           +     ++ 
Sbjct: 275 VEMRDANAGGEKKMVTEYNARHILVRIGDNQTDAQAKAKIDTLRARIAGGAEFQATAKES 334

Query: 223 ASKI-HDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIA-ICDKRDLG 279
           +         G   +       P F + +   +    + P+ TQ G   +  +  ++   
Sbjct: 335 SEDTNSRGQGGDLGWFPADAFGPDFGKQVEGLADGAVSEPFRTQAGWHIVQRVGSRQTDI 394

Query: 280 GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                +A +       K+E+    Y+++LR  A + Y
Sbjct: 395 SAENQRAQIRETIGRRKLEEEYNRYLQELRGEAYVSY 431


>gi|84625193|ref|YP_452565.1| peptidyl-prolyl cis-trans isomerase [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|121956520|sp|Q2NZI6|SURA_XANOM RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|84369133|dbj|BAE70291.1| peptidyl-prolyl cis-trans isomerase [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
          Length = 463

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 38/320 (11%), Positives = 105/320 (32%), Gaps = 17/320 (5%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK- 67
           ++    ++    + I   I P+ S +      RI   ++ +V+   ++ + +  +K Q  
Sbjct: 1   MTKPFSVVLASLLAITSTISPLASAQQSQPLDRIAAIVDEDVVLQSELDRAVRNVKSQYA 60

Query: 68  -------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
                   +  L++  ++ LI+  L+    + SGI      +N      A+  G + +  
Sbjct: 61  GRENQLPPDDVLQRQVLERLILVKLQVGRADGSGIRVSDEELNRAIASIAQQNGTTVDGL 120

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180
              L   G+G   F+  +  + I   + ++    +    E E+     +      + +L 
Sbjct: 121 RQKLAADGMGYADFRASVRDEIIVQRLRQSFAQSRISVSEGEVDTALTQQAATGSKYHLA 180

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKIHDVSIGKAQYLLE 239
             ++        +     QK++   +    +          +++   + +  G   +   
Sbjct: 181 HILIGLPEGATAEQIATGQKKVDGVKTLIDKGELDFPAAAVRYSDSPNALEGGDLGWRSL 240

Query: 240 SDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-------AYLSAQ 291
            ++   F   +          P     G + + + + RD       K        ++  +
Sbjct: 241 DEIPNAFAQLIRDMKPGQVAGPLRGPSGFQLLKLMEMRDANAGGEKKMVTEYNARHILVR 300

Query: 292 NTPTKIEKHEAEYVKKLRSN 311
               + E      +  +R+ 
Sbjct: 301 VGDNQTEAQAKAKIDTIRAR 320



 Score = 91.7 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 18/156 (11%), Positives = 41/156 (26%), Gaps = 3/156 (1%)

Query: 164 PANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFA 223
                                  +     Q +   + +I       +         ++ +
Sbjct: 276 EMRDANAGGEKKMVTEYNARHILVRVGDNQTEAQAKAKIDTIRARIVGGADFQATAKESS 335

Query: 224 SKI-HDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
                    G   +       P F + +   +    + P+ TQ G   +     R     
Sbjct: 336 EDTNSRGQGGDLGWFPADAFGPDFGKQVEGLADGAVSEPFRTQAGWHIVQRVGSRQTDVS 395

Query: 282 -IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
               +A +       K+E+    Y+++LR  A + Y
Sbjct: 396 AENQRAQVRETIGRRKLEEEYNRYLQELRGEAYVSY 431


>gi|331011659|gb|EGH91715.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 440

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 99/310 (31%), Gaps = 17/310 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   ++    + +      +   ++ +VI    + +R+  ++               L
Sbjct: 12  LMLGALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAEAL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           +   +  LI+E L+ Q  E+SGI    + +N      A+   +S E F + L   G+  N
Sbjct: 72  QPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVEQFRAALAHDGLSYN 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             ++ +  + I   V +     +    + E+       +               I     
Sbjct: 132 DAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDQGKAQLSEEFHLANILIATPDS 191

Query: 193 QNQGFVQKRIKD---AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +   +Q          +   +           +S  + +  G   +   + L P F   
Sbjct: 192 ASSDAIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMGWRKAAQLPPPFGDM 251

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-----EIALKAYLSAQNTPTKIEKHEAE 303
           L      + T P  T  G   + + +KR   G     +     ++  + +  + E+    
Sbjct: 252 LSAMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILIKPSEIRNEEETKR 311

Query: 304 YVKKLRSNAI 313
             +K+     
Sbjct: 312 LAEKIYDRIQ 321



 Score = 95.9 bits (236), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 16/149 (10%), Positives = 53/149 (35%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++N+   ++  +   +            + F+      +
Sbjct: 282 QGQAQMRDEVHVRHILIKPSEIRNEEETKRLAEKIYDRIQNGEDFAELAKSFSEDPGSAL 341

Query: 230 SIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAY 287
           + G   ++  + L P+F+  + +  Q   + P+ T  G   + +  +R     + A +  
Sbjct: 342 NGGDLNWIDPNSLVPEFRQVMNETPQGELSKPFKTAYGWHVLEVLGRRSTDATDQAREQQ 401

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                   K ++    +++++R  A +  
Sbjct: 402 ALNVLRNRKYDEELQTWLRQIRDEAYVEI 430


>gi|257483108|ref|ZP_05637149.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 442

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 99/310 (31%), Gaps = 17/310 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   ++    + +      +   ++ +VI    + +R+  ++               L
Sbjct: 14  LMLGALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAEAL 73

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           +   +  LI+E L+ Q  E+SGI    + +N      A+   +S E F + L   G+  N
Sbjct: 74  QPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVEQFRAALAHDGLSYN 133

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             ++ +  + I   V +     +    + E+       +               I     
Sbjct: 134 DAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDQGKAQLSEEFHLANILIATPDS 193

Query: 193 QNQGFVQKRIKD---AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +   +Q          +   +           +S  + +  G   +   + L P F   
Sbjct: 194 ASSDAIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMGWRKAAQLPPPFGDM 253

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-----EIALKAYLSAQNTPTKIEKHEAE 303
           L      + T P  T  G   + + +KR   G     +     ++  + +  + E+    
Sbjct: 254 LSAMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILIKPSEIRNEEETKR 313

Query: 304 YVKKLRSNAI 313
             +K+     
Sbjct: 314 LAEKIYDRIQ 323



 Score = 95.9 bits (236), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 16/149 (10%), Positives = 53/149 (35%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++N+   ++  +   +            + F+      +
Sbjct: 284 QGQAQMRDEVHVRHILIKPSEIRNEEETKRLAEKIYDRIQNGEDFAELAKSFSEDPGSAL 343

Query: 230 SIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAY 287
           + G   ++  + L P+F+  + +  Q   + P+ T  G   + +  +R     + A +  
Sbjct: 344 NGGDLNWIDPNSLVPEFRQVMNETPQGELSKPFKTAYGWHVLEVLGRRSTDATDQAREQQ 403

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                   K ++    +++++R  A +  
Sbjct: 404 ALNVLRNRKYDEELQTWLRQIRDEAYVEI 432


>gi|110834907|ref|YP_693766.1| survival protein SurA [Alcanivorax borkumensis SK2]
 gi|122070614|sp|Q0VMV4|SURA_ALCBS RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|110648018|emb|CAL17494.1| Survival protein surA precursor (Peptidyl-prolyl cis-trans
           isomerase surA) [Alcanivorax borkumensis SK2]
          Length = 435

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 46/306 (15%), Positives = 105/306 (34%), Gaps = 17/306 (5%)

Query: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI 60
           M +K   +     K      + +   ++P+ S     M  RI   +N   I   ++ +RI
Sbjct: 1   MINKTLHT-----KHTLLGLLAMAVLMIPVWSQAKVQMLDRIVAVVNDGAIMASELDERI 55

Query: 61  ALLKLQKI--------NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
             + LQ             L +  +  +I+E L+ Q  E++GI  D  ++N      AR 
Sbjct: 56  NTIALQFQEKGQQLPSPAILREQVLDRMILERLQLQLAERAGIKVDEASLNEALAGIARQ 115

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN 172
             +S EDF++ L + G     F++ +    +   + +     +    + E+         
Sbjct: 116 NDMSLEDFAATLREDGYSWTQFREQIRQDMVISRLQQRSVASRIQITDREVDRFLSSELG 175

Query: 173 ITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDV 229
             + +   R     I          + +    A+E   RL    +        +   + +
Sbjct: 176 KQMFQEDFRLGHILIRVPSEARPQQISQARAKAKEIIERLEAGSDFQQLAIALSDGPNAL 235

Query: 230 SIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
             G   +   +     F +N +   +   + P  +  G   + + D++    ++  + ++
Sbjct: 236 EGGDLGWRPAAQWPTLFAENAINLKKGEFSQPLRSGAGFHILKMIDRKGGAEKVVTQYHV 295

Query: 289 SAQNTP 294
                 
Sbjct: 296 RHVLIK 301



 Score = 80.5 bits (196), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 31/279 (11%), Positives = 84/279 (30%), Gaps = 19/279 (6%)

Query: 51  ITDGDISKRIAL-LKLQKINGELE---------KIAVQELIVETLKKQEIEKSGITFDSN 100
           ITD ++ + ++  L  Q    +             A  + I +   K +     +   S+
Sbjct: 161 ITDREVDRFLSSELGKQMFQEDFRLGHILIRVPSEARPQQISQARAKAKEIIERLEAGSD 220

Query: 101 TVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLE 160
                         L   D       Q             +  +   +++          
Sbjct: 221 FQQLAIALSDGPNALEGGDLGWRPAAQWPTLFAENAINLKKGEFSQPLRSGAGFHI---- 276

Query: 161 MEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE 220
             +    +K     V        +    D     +   Q+ I+  +E      +      
Sbjct: 277 --LKMIDRKGGAEKVVTQYHVRHVLIKADALTSAEQAQQRAIRLHDEVAAGKRQFKETAA 334

Query: 221 KFASKI-HDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDL 278
           +F+       + G+  ++ + ++ P+F+ ++  +     +  + +Q G  ++ + D RD 
Sbjct: 335 EFSDDPGSARNGGELGWVNKGEMVPEFEQVMLNTPVGELSPVFESQFGWHFLRVDDIRDA 394

Query: 279 GGEIALKA-YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                 +    +      + E+    +V++ RS + +  
Sbjct: 395 DMSTEFRRMQATQALQKRRFEEELETWVQEKRSESYVDI 433


>gi|325276043|ref|ZP_08141858.1| SurA domain-containing protein [Pseudomonas sp. TJI-51]
 gi|324098828|gb|EGB96859.1| SurA domain-containing protein [Pseudomonas sp. TJI-51]
          Length = 428

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 45/309 (14%), Positives = 106/309 (34%), Gaps = 16/309 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +L+   ++    + +     R+   ++ +V+    + +R+  ++             G L
Sbjct: 1   MLLGVALLSGAVHAAVQPLDRVVAIVDNDVVMQSQLDQRVHEVQQTIAKRGGSVPPAGAL 60

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           E+  ++ LIVE L+ Q  E+SGI      +N      A+  G+S + F + L   G+  +
Sbjct: 61  EQQVLERLIVENLQLQIGERSGIRITDEELNQAIGTIAQRNGMSLDQFRAALAHDGLSFD 120

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             +  +  + I   V +     +    E E+                 R     IP  + 
Sbjct: 121 DARDQVKREMIISRVRQRRVAERIQVSEQEVKNFLNSDMGKMQMSEEYRLANILIPTPEA 180

Query: 193 QNQGFVQKRIK---DAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            N   +QK  +   +  +   +           ++  + +  G+  +   + L P F + 
Sbjct: 181 ANSADIQKAARQVGEVYQQLKQGADFGQLAIARSASENALEGGEMGWRKAAQLPPDFAKM 240

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG----EIALKAYLSAQNTPTKIEKHEAEY 304
           L        T P     G   + + +KR        +     ++  + +  + +    + 
Sbjct: 241 LSSMPVGEITQPIRIPNGFIILKLEEKRGGSENVLRDEVHVRHILIKPSEIRSDAATEQL 300

Query: 305 VKKLRSNAI 313
            ++L     
Sbjct: 301 AERLYERIK 309



 Score = 92.8 bits (228), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 26/274 (9%), Positives = 84/274 (30%), Gaps = 9/274 (3%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELI-----VETLKKQEIEKSGITFDSNTVNYF 105
           +++ ++   +     +    E  ++A   LI       +   Q+  +             
Sbjct: 146 VSEQEVKNFLNSDMGKMQMSEEYRLA-NILIPTPEAANSADIQKAARQVGEVYQQLKQGA 204

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA 165
                     ++E+     +             A       V +    ++  N  + +  
Sbjct: 205 DFGQLAIARSASENALEGGEMGWRKAAQLPPDFAKMLSSMPVGEITQPIRIPNGFIILKL 264

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK 225
            +++  +  V    +      I  +++++    ++  +   E            + ++  
Sbjct: 265 EEKRGGSENVLRDEVHVRHILIKPSEIRSDAATEQLAERLYERIKNGEDFAELAKSYSED 324

Query: 226 I-HDVSIGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIA 283
               ++ G   ++  + L P+F+  +    Q   T P+ TQ G   + +  +R       
Sbjct: 325 PGSALNGGDLNWVDPNSLVPEFREQMANAQQGVVTKPFKTQYGWHVLEVLGRRATDSTEQ 384

Query: 284 LKA-YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            +           K ++    +++++R  A +  
Sbjct: 385 AREQQALNVLRNRKYDEELQTWLRQIRDEAYVEI 418


>gi|289670942|ref|ZP_06492017.1| peptidyl-prolyl cis-trans isomerase [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 463

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 36/320 (11%), Positives = 104/320 (32%), Gaps = 17/320 (5%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK- 67
           ++    ++    + I   + P  S +      RI   ++ +V+   ++ + +  +K Q  
Sbjct: 1   MTKPFSVVLASLLAITSTVSPFASAQQSQPLDRIAAIVDEDVVLQSELDRAVRNVKSQYA 60

Query: 68  -------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
                   +  L++  ++ L++  L+    + SGI      +N      A+  G + +  
Sbjct: 61  GRENQLPPDDVLQRQVLERLVLVKLQVGRADGSGIRVSDEELNRAIASIAQQNGTTVDGL 120

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180
              L   G+G   F+  +  + I   + ++    +    E E+     +      + +L 
Sbjct: 121 RQKLAADGMGYADFRASVRDEIIVQRLRQSFAQSRISVSEGEVDTALAQQAATGSQYHLA 180

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKIHDVSIGKAQYLLE 239
             ++        +     QK++   +    +          +++   + +  G   +   
Sbjct: 181 HILIGLPEGATAEQIATGQKKVDGVKALIDKGELDFPAAAVRYSDSPNALEGGDLGWRSL 240

Query: 240 SDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-------AYLSAQ 291
            ++   F   +          P     G + + + + RD       K        ++  +
Sbjct: 241 DEIPNAFAQLIRDMKPGQVAGPLRGPSGFQLLKLVEMRDANAGGEKKMVTEYNARHILVR 300

Query: 292 NTPTKIEKHEAEYVKKLRSN 311
               + E      +  +R+ 
Sbjct: 301 VGDNQTEAQAKAKIDTIRAR 320



 Score = 92.8 bits (228), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 18/157 (11%), Positives = 42/157 (26%), Gaps = 3/157 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +                       +     Q +   + +I       +         ++ 
Sbjct: 275 VEMRDANAGGEKKMVTEYNARHILVRVGDNQTEAQAKAKIDTIRARIVGGADFQATAKES 334

Query: 223 ASKI-HDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG 280
           +         G   +       P F + +   +    + P+ TQ G   +     R    
Sbjct: 335 SEDTNSRGQGGDLGWFPADAFGPDFGKQVEGLADGAVSEPFRTQAGWHIVQRVGSRQTDV 394

Query: 281 E-IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                +A +       K+E+    Y+++LR  A + Y
Sbjct: 395 SAENQRAQVRETIGRRKLEEEYNRYLQELRGEAYVSY 431


>gi|78046458|ref|YP_362633.1| peptidylprolyl isomerase precursor [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325928237|ref|ZP_08189442.1| parvulin-like peptidyl-prolyl isomerase [Xanthomonas perforans
           91-118]
 gi|121956510|sp|Q3BX80|SURA_XANC5 RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|78034888|emb|CAJ22533.1| peptidylprolyl isomerase precursor [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325541397|gb|EGD12934.1| parvulin-like peptidyl-prolyl isomerase [Xanthomonas perforans
           91-118]
          Length = 463

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/320 (10%), Positives = 105/320 (32%), Gaps = 17/320 (5%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK- 67
           ++    ++    + I   + P+ S +      RI   ++ +V+   ++ + +  +K Q  
Sbjct: 1   MTKPFSVVLASLLAITSTVSPLASAQQSQPLDRIAAIVDEDVVLQSELDRAVRNVKSQYA 60

Query: 68  -------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
                   +  L++  ++ L++  L+    + +GI      +N      A+  G + +  
Sbjct: 61  GRENQLPPDDVLQRQVLERLVLVKLQVSRADGNGIRVSDEELNRAIASIAQQNGTTVDGL 120

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180
              L   G+G   F+  +  + I   + ++    +    E E+     +      + +L 
Sbjct: 121 RQKLAADGMGYADFRASVRDEIIVQRLRQSFAQSRISVSEGEVDTALAQQAATGSQYHLA 180

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKIHDVSIGKAQYLLE 239
             ++        +     QK++   +    +          +++   + +  G   +   
Sbjct: 181 HILIGLPEGATAEQIATGQKKVDGVKALIDKGELDFSAAAVRYSDSPNALEGGDLGWRSL 240

Query: 240 SDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-------AYLSAQ 291
            ++   F   +          P     G + + + + RD       K        ++  +
Sbjct: 241 DEIPNAFAQLIRDMQPGQVAGPLRGPSGFQLLKLVEMRDANAGGEKKMVTEYHARHILVR 300

Query: 292 NTPTKIEKHEAEYVKKLRSN 311
               + E      +  +R+ 
Sbjct: 301 IGENQTEAQAKAKIDTIRAR 320



 Score = 93.2 bits (229), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 18/157 (11%), Positives = 43/157 (27%), Gaps = 3/157 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +                       +   + Q +   + +I       +         ++ 
Sbjct: 275 VEMRDANAGGEKKMVTEYHARHILVRIGENQTEAQAKAKIDTIRARIVGGADFQATAKES 334

Query: 223 ASKI-HDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG 280
           +         G   +       P F + +   +    + P+ TQ G   +     R    
Sbjct: 335 SEDTNSRGQGGDLGWFPADAFGPDFGKQVESLTDGAVSEPFRTQAGWHIVQRVGSRQTDV 394

Query: 281 E-IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                +A +       K+E+    Y+++LR  A + Y
Sbjct: 395 SAENQRAQVRETIGRRKLEEEYNRYLQELRGEAYVSY 431


>gi|330719900|gb|EGG98375.1| Survival protein SurA precursor (Peptidyl-prolyl cis-trans
           isomerase SurA) [gamma proteobacterium IMCC2047]
          Length = 429

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 50/314 (15%), Positives = 112/314 (35%), Gaps = 16/314 (5%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI-------- 60
           L+   K  TT  +L   C+ P + Y +     RI   +N ++I    + + I        
Sbjct: 2   LNSLRKYFTT--LLAALCLAPSMLYAAIQPLDRIAVIVNDDIIMQSQVQQAIDSAIRNLQ 59

Query: 61  ALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
              +       L +  V+ LI+E+L+ Q  E+ GI  D  ++N    + A    ++ E F
Sbjct: 60  QRNQQMPPKKVLIQQVVESLIMESLQLQIAERGGIRVDDTSLNEAISRIAAQNNMTLEQF 119

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNIT--VREY 178
              +  +G      ++ +  + +     +     +    + EI       +       ++
Sbjct: 120 QQAIIAEGSDYAATREQIRRELLTTRARQGSVGPRIQITDQEIDNFLDSAEGKALLASKF 179

Query: 179 LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLL 238
            I  +L    +N    +   +K+ +   +            ++++   +    G   +  
Sbjct: 180 HIAHILVKPDNNTQPARQKAKKQAQALYQQLQSGADFAALTKQYSDGPNAEQGGSMGWRD 239

Query: 239 ESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQNTP 294
           ES L   F+N +K  +    + P  +  G   + + +KR       +     ++  Q   
Sbjct: 240 ESQLPSLFKNTVKALNDGEVSEPIASSNGFHLVKLLEKRGGTSIIQDQTQVRHILIQPNE 299

Query: 295 TKIEKHEAEYVKKL 308
            + E+   E +  L
Sbjct: 300 IRSERQAEEMIYDL 313



 Score = 80.5 bits (196), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 16/141 (11%), Positives = 52/141 (36%), Gaps = 3/141 (2%)

Query: 179 LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYL 237
             +     I  N+++++   ++ I D                 +++        G+  ++
Sbjct: 287 QTQVRHILIQPNEIRSERQAEEMIYDLFTRIQSGEDFAELARLYSADPGSRAKGGELGWI 346

Query: 238 LESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPT 295
             + L P F + + +   +  + P+ ++ G   + +  +R    G  A +          
Sbjct: 347 TPAGLVPSFVKVMKETPVDGISAPFKSRYGWHILEVQGRRQQDIGADAARQQAREVIYRR 406

Query: 296 KIEKHEAEYVKKLRSNAIIHY 316
           K  +    +++++R++A +  
Sbjct: 407 KFNEELQLWLREIRNDAFVDI 427


>gi|121956435|sp|Q88QT4|SURA_PSEPK RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
          Length = 427

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 40/305 (13%), Positives = 102/305 (33%), Gaps = 16/305 (5%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK--------INGELEKIA 76
             ++    + +     R+   ++ +V+    + +R+  ++               LE+  
Sbjct: 4   VALLSGAVHAAVQPLDRVVAIVDNDVVMQSQLDQRVHEVQQTIAKRGGGVPPTSALEQQV 63

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           ++ LIVE L+ Q  E+SGI      +N      A+  G+S + F + L + G+  +  ++
Sbjct: 64  LERLIVENLQLQIGERSGIRITDEELNQAIGTIAQRNGMSLDQFRAALARDGLSFDDARE 123

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIR---TVLFSIPDNKLQ 193
            +  + I   V +     +    E E+                 R    ++ +       
Sbjct: 124 QVKREMIISRVRQRRVAERIQVSEQEVKNFLASDLGKMQMSEEYRLANILIPTPEAANSD 183

Query: 194 NQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS 253
           +     +++ D  +   +           ++  + +  G+  +     L P F  +L   
Sbjct: 184 DIQKAARKVGDVYQQLRQGADFGQMAIANSASENALEGGEMGWRKAGQLPPDFAKMLSSM 243

Query: 254 Q-NNTTNPYVTQKGVEYIAICDKRDLGG----EIALKAYLSAQNTPTKIEKHEAEYVKKL 308
                T P     G   + + +KR        +     ++  + +  + E    +  ++L
Sbjct: 244 PVGEITQPIRIPNGFIILKLEEKRGGSENVLRDEVHVRHILIKPSEIRSEAATEQLAERL 303

Query: 309 RSNAI 313
                
Sbjct: 304 YDRIK 308



 Score = 91.7 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 22/233 (9%), Positives = 72/233 (30%), Gaps = 3/233 (1%)

Query: 87  KQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPD 146
            Q+  +                       ++E+     +             A       
Sbjct: 185 IQKAARKVGDVYQQLRQGADFGQMAIANSASENALEGGEMGWRKAGQLPPDFAKMLSSMP 244

Query: 147 VVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAE 206
           V +    ++  N  + +   +++  +  V    +      I  ++++++   ++  +   
Sbjct: 245 VGEITQPIRIPNGFIILKLEEKRGGSENVLRDEVHVRHILIKPSEIRSEAATEQLAERLY 304

Query: 207 ESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQ 264
           +            + F+      ++ G   ++  + L P+F+  +    Q   T P+ TQ
Sbjct: 305 DRIKNGEDFGELAKSFSEDPGSALNGGDLNWVDPNSLVPEFREQMANAQQGVVTKPFKTQ 364

Query: 265 KGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            G   + +  +R        +     +     K ++    +++++R  A +  
Sbjct: 365 YGWHVLEVLGRRATDSTEQAREQQALSVLRNRKYDEELQTWLRQIRDEAYVEI 417


>gi|71275093|ref|ZP_00651380.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Xylella fastidiosa
           Dixon]
 gi|71899689|ref|ZP_00681842.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Xylella fastidiosa
           Ann-1]
 gi|170731077|ref|YP_001776510.1| peptidyl-prolyl cis-trans isomerase [Xylella fastidiosa M12]
 gi|71163902|gb|EAO13617.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Xylella fastidiosa
           Dixon]
 gi|71730557|gb|EAO32635.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Xylella fastidiosa
           Ann-1]
 gi|167965870|gb|ACA12880.1| peptidyl-prolyl cis-trans isomerase [Xylella fastidiosa M12]
          Length = 468

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 42/325 (12%), Positives = 112/325 (34%), Gaps = 24/325 (7%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMS--SRIRTTINGEVITDGDISKRIALLKLQ 66
           ++ +  ++ +  + +    +P+ S +        RI   ++  V+   ++ + I  +K Q
Sbjct: 1   MTRYFSIVLSLLLAVSCVFLPVASARQQQHQPLDRIVAVVDDNVVLKSELDRAIHNVKSQ 60

Query: 67  K--------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
                     +  L++  ++ LI+  L+    + +GI    + +N      A N   S +
Sbjct: 61  YVGHEGQLPPDEVLQRQVLERLILIKLQVARAQTNGIRVSDDELNQAISSIAENNKTSVD 120

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREY 178
                L  +GI    F+Q +  +     + +     +    E E+       +  +  +Y
Sbjct: 121 GLRQKLVAEGISFPEFRQSVRDEITVHHLRQGFAQSRIVVSEGEVDTAL--AQANSGAQY 178

Query: 179 LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK--FASKIHDVSIGKAQY 236
            ++ +L ++PD     Q  V ++  +  +S +   +         ++   + +  G   +
Sbjct: 179 HLQHILVALPDGATSEQIAVAQKKINGIKSVIDKGELAFSAAAVRYSDSPNALESGDLGW 238

Query: 237 LLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKRD---------LGGEIALKA 286
               ++   F  +           P     G + + + + RD                  
Sbjct: 239 RSLDEIPEAFAQMVQTMKPGQIVGPLRGTSGFQLLKLVEVRDSAAAAAGPRQMATEYHAR 298

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSN 311
           ++  + T  + E      +  LR+ 
Sbjct: 299 HILVRITEKQKEAQAKAKIDTLRAR 323



 Score = 86.3 bits (211), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 18/156 (11%), Positives = 47/156 (30%), Gaps = 3/156 (1%)

Query: 162 EIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK 221
           E+  +                    +   + Q +   + +I                  +
Sbjct: 277 EVRDSAAAAAGPRQMATEYHARHILVRITEKQKEAQAKAKIDTLRARIAGGADFQTVARE 336

Query: 222 FASKIHDVS-IGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLG 279
            +   ++ +  G   +         F N +K  +  N + P+ +  G   +     R   
Sbjct: 337 SSEDANNSNQGGDLGWFPSDAFGADFGNHVKALADGNVSEPFRSAAGWHIVQRLGTRQTD 396

Query: 280 G-EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
             +   +A +       K+E+    ++++LRS A +
Sbjct: 397 VTKENQRAQIRDTIGQRKLEESYERFLRELRSEAYV 432


>gi|28199704|ref|NP_780018.1| peptidyl-prolyl cis-trans isomerase [Xylella fastidiosa Temecula1]
 gi|182682448|ref|YP_001830608.1| SurA domain-containing protein [Xylella fastidiosa M23]
 gi|81724959|sp|Q87AJ0|SURA_XYLFT RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|28057825|gb|AAO29667.1| peptidyl-prolyl cis-trans isomerase [Xylella fastidiosa Temecula1]
 gi|182632558|gb|ACB93334.1| SurA domain [Xylella fastidiosa M23]
 gi|307578730|gb|ADN62699.1| SurA domain-containing protein [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 463

 Score =  140 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 42/324 (12%), Positives = 112/324 (34%), Gaps = 23/324 (7%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMS--SRIRTTINGEVITDGDISKRIALLKLQ 66
           ++ +  ++ +  + +    +P+ S +        RI   ++  V+   ++ + I  +K Q
Sbjct: 1   MTRYFSIVLSLLLAVSCVFLPVASARQQQHQPLDRIVAVVDDNVVLKSELDRAIHNVKSQ 60

Query: 67  K--------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
                     +  L++  ++ LI+  L+    + +GI    + +N      A N   S +
Sbjct: 61  YVGHEGQLPPDEVLQRQVLERLILIKLQVARAQTNGIRVSDDELNQAISSIAENNKTSVD 120

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREY 178
                L  +GI    F+Q +  +     + +     +    E E+       +  +  +Y
Sbjct: 121 GLRQKLVAEGISFPEFRQSVRDEITVHHLRQGFAQSRIVVSEGEVDTAL--AQANSGAQY 178

Query: 179 LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK--FASKIHDVSIGKAQY 236
            ++ +L S+PD     Q  + ++  +  +S +   +         ++   + +  G   +
Sbjct: 179 HLQHILVSLPDGATSEQIAIAQKKINGIKSVIDKGELAFSAAAVRYSDSPNALESGDLGW 238

Query: 237 LLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKRDLG--------GEIALKAY 287
               ++   F  +           P     G + + + + RD                 +
Sbjct: 239 RSLDEIPEAFAQMVQTMKPGQIVGPLRGTSGFQLLKLVEVRDSTAAAGPRQMATEYHARH 298

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSN 311
           +  + T  + E      +  LR+ 
Sbjct: 299 ILVRITDKQKEAQAKAKIDTLRAR 322



 Score = 85.1 bits (208), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 17/138 (12%), Positives = 42/138 (30%), Gaps = 3/138 (2%)

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLL 238
                  +     Q +   + +I                  + +   ++ +  G   +  
Sbjct: 294 YHARHILVRITDKQKEAQAKAKIDTLRARIAGGADFQTVARESSEDANNSNQGGDLGWFP 353

Query: 239 ESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGE-IALKAYLSAQNTPTK 296
                  F N +K  +  N + P+ +  G   +     R         +A +       K
Sbjct: 354 SDAFGADFGNHVKALADGNVSEPFRSAAGWHIVQRLGTRQTDVTRENQRAQIRDTIGQRK 413

Query: 297 IEKHEAEYVKKLRSNAII 314
           +E+    ++++LRS A +
Sbjct: 414 LEESYERFLRELRSEAYV 431


>gi|302185941|ref|ZP_07262614.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas syringae
           pv. syringae 642]
          Length = 440

 Score =  140 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 42/313 (13%), Positives = 98/313 (31%), Gaps = 19/313 (6%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   ++    + +      +   ++ +VI    + +R+  ++               L
Sbjct: 12  LMLGALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAEAL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           +   +  LI+E L+ Q  E+SGI    + +N      A+   +S E F + L   G+  N
Sbjct: 72  QPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVEQFRAALAHDGLSYN 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             ++ +  + I   V +     +    + E+                       I     
Sbjct: 132 DAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDMGKAQLSEEFHLANILIATPDS 191

Query: 193 QNQGFVQKRIKD---AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +   +Q          +   +           +S  + +  G   +   + L P F   
Sbjct: 192 ASSEAIQAAAAKAKGIYDQLKKGADFTRLAATSSSSENALEGGDMGWRKAAQLPPPFGDM 251

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-----EIALKAYLSAQNTPTKIEKHEAE 303
           L      + T P  T  G   + + +KR   G     +     ++  + +  + E     
Sbjct: 252 LSSMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILIKPSEIRNEAETKR 311

Query: 304 YVKKLRSNAIIHY 316
             +K+     I  
Sbjct: 312 LAQKIYDR--IEN 322



 Score = 96.7 bits (238), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 17/149 (11%), Positives = 55/149 (36%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++N+   ++  +   +            + F+      +
Sbjct: 282 QGQAQMRDEVHVRHILIKPSEIRNEAETKRLAQKIYDRIENGEDFAELAKSFSEDPGSAL 341

Query: 230 SIGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAY 287
           + G   ++  + L P+F+ ++ +  Q   + P+ TQ G   + +  +R     + A +  
Sbjct: 342 NGGDLNWVDPNSLVPEFRQVMSETPQGELSKPFQTQYGWHVLEVLGRRSTDATDQAREQQ 401

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                   K ++    +++++R  A +  
Sbjct: 402 ALNVLRNRKYDEELQTWLRQIRDEAYVEI 430


>gi|121956444|sp|Q4ZMG7|SURA_PSEU2 RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
          Length = 428

 Score =  140 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 42/309 (13%), Positives = 95/309 (30%), Gaps = 19/309 (6%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GELEKIA 76
             ++    + +      +   ++ +VI    + +R+  ++               L+   
Sbjct: 4   ALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAEALQPQV 63

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           +  LI+E L+ Q  E+SGI      +N      A+   +S E F + L   G+  N  ++
Sbjct: 64  LDRLILENLQLQMGERSGIRVSDEELNQAIGTIAQRNNMSVEQFRAALAHDGLSYNDARE 123

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQG 196
            +  + I   V +     +    + E+                       I      +  
Sbjct: 124 QVRREMIISRVRQRRVAERIQVSQQEVKNFLASDMGKAQLSEEFHLANILIATPDSASSD 183

Query: 197 FVQKRIKD---AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKK 252
            +Q          +   +           +S  + +  G   +   + L P F   L   
Sbjct: 184 AIQAAAVKAKGIYDQLKKGADFTRLAATSSSSENALEGGDMGWRKAAQLPPPFGDMLSSM 243

Query: 253 SQNNTTNPYVTQKGVEYIAICDKRDLGG-----EIALKAYLSAQNTPTKIEKHEAEYVKK 307
              + T P  T  G   + + +KR   G     +     ++  + +  + E+      +K
Sbjct: 244 PVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILIKPSEIRNEEETKRLAQK 303

Query: 308 LRSNAIIHY 316
           +     I  
Sbjct: 304 IYDR--IEN 310



 Score = 94.4 bits (232), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 17/149 (11%), Positives = 55/149 (36%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++N+   ++  +   +            + F+      +
Sbjct: 270 QGQAQMRDEVHVRHILIKPSEIRNEEETKRLAQKIYDRIENGEDFAELAKSFSEDPGSAL 329

Query: 230 SIGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAY 287
           + G   ++  + L P+F+ ++ +  Q   + P+ TQ G   + +  +R     + A +  
Sbjct: 330 NGGDLNWVDPNSLVPEFRQVMSETPQGVLSKPFQTQYGWHVLEVLGRRSTDATDQAREQQ 389

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                   K ++    +++++R  A +  
Sbjct: 390 ALNVLRNRKYDEELQTWLRQIRDEAYVEI 418


>gi|294625755|ref|ZP_06704374.1| peptidyl-prolyl cis-trans isomerase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294664833|ref|ZP_06730154.1| peptidyl-prolyl cis-trans isomerase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292599925|gb|EFF44043.1| peptidyl-prolyl cis-trans isomerase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292605389|gb|EFF48719.1| peptidyl-prolyl cis-trans isomerase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 463

 Score =  140 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 35/320 (10%), Positives = 105/320 (32%), Gaps = 17/320 (5%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK- 67
           ++    ++    + I   + P+ S +      RI   ++ +V+   ++ + +  +K Q  
Sbjct: 1   MTKPFSVVLASLLAITSTVSPLASAQQSQPLDRIAAIVDEDVVLQSELDRAVRNVKSQYA 60

Query: 68  -------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
                   +  L++  ++ L++  L+    + +GI      +N      A+  G + +  
Sbjct: 61  GRENQLPPDDVLQRQVLERLVLVKLQVSRADGNGIRVSDEELNRAIASIAQQNGTTVDGL 120

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180
              L   G+G   F+  +  + I   + ++    +    E E+     +      + +L 
Sbjct: 121 RQKLAADGMGYADFRASVRDEIIVQRLRQSFAQSRISVSEGEVDTALAQQAATGSQYHLA 180

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKIHDVSIGKAQYLLE 239
             ++        +     QK++   +    +          +++   + +  G   +   
Sbjct: 181 HILIGLPEGANAEQIATGQKKVDGVKALIDKGELDFSAAAVRYSDSPNALEGGDLGWRSL 240

Query: 240 SDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-------AYLSAQ 291
            ++   F   +          P     G + + + + RD       K        ++  +
Sbjct: 241 DEIPNAFAQLIRDMQPGQVAGPLRGPSGFQLLKLVEMRDANAGGEKKMVTEYHARHILVR 300

Query: 292 NTPTKIEKHEAEYVKKLRSN 311
               + E      +  +R+ 
Sbjct: 301 IGDNQTEAQAKAKIDTIRAR 320



 Score = 93.6 bits (230), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 18/157 (11%), Positives = 42/157 (26%), Gaps = 3/157 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +                       +     Q +   + +I       +         ++ 
Sbjct: 275 VEMRDANAGGEKKMVTEYHARHILVRIGDNQTEAQAKAKIDTIRARIVGGADFQATAKES 334

Query: 223 ASKI-HDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG 280
           +         G   +       P F + +   +    + P+ TQ G   +     R    
Sbjct: 335 SEDTNSRGQGGDLGWFPADAFGPDFGKQVESLTDGAVSEPFRTQAGWHIVQRVGSRQTDV 394

Query: 281 E-IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                +A +       K+E+    Y+++LR  A + Y
Sbjct: 395 SAENQRAQVRETIGRRKLEEEYNRYLQELRGEAYVSY 431


>gi|21241635|ref|NP_641217.1| peptidyl-prolyl cis-trans isomerase [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|81804731|sp|Q8PP23|SURA_XANAC RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|21106996|gb|AAM35753.1| peptidyl-prolyl cis-trans isomerase [Xanthomonas axonopodis pv.
           citri str. 306]
          Length = 463

 Score =  140 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 35/320 (10%), Positives = 105/320 (32%), Gaps = 17/320 (5%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK- 67
           ++    ++    + I   + P+ S +      RI   ++ +V+   ++ + +  +K Q  
Sbjct: 1   MTKPFSVVLASLLAITSTVSPLASAQQSQPLDRIAAIVDEDVVLQSELDRAVRNVKSQYA 60

Query: 68  -------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
                   +  L++  ++ L++  L+    + +GI      +N      A+  G + +  
Sbjct: 61  GRENQLPPDDVLQRQVLERLVLVKLQVSRADGNGIRVSDEELNRAIASIAQQNGTTVDGL 120

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180
              L   G+G   F+  +  + I   + ++    +    E E+     +      + +L 
Sbjct: 121 RQKLAADGMGYADFRASVRDEIIVQRLRQSFAQSRISVSEGEVDTALAQQAATGSQYHLA 180

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKIHDVSIGKAQYLLE 239
             ++        +     QK++   +    +          +++   + +  G   +   
Sbjct: 181 HILIGLPEGANAEQIATGQKKVDGVKALIDKGELDFSAAAVRYSDSPNALEGGDLGWRSL 240

Query: 240 SDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-------AYLSAQ 291
            ++   F   +          P     G + + + + RD       K        ++  +
Sbjct: 241 DEIPNAFAQLIRDMQPGQVAGPLRGPSGFQLLKLVEMRDANAGGEKKMVTEYHARHILVR 300

Query: 292 NTPTKIEKHEAEYVKKLRSN 311
               + E      +  +R+ 
Sbjct: 301 IGDNQTEAQAKAKIDTIRAR 320



 Score = 93.6 bits (230), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 18/157 (11%), Positives = 42/157 (26%), Gaps = 3/157 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +                       +     Q +   + +I       +         ++ 
Sbjct: 275 VEMRDANAGGEKKMVTEYHARHILVRIGDNQTEAQAKAKIDTIRARIVGGADFQATAKES 334

Query: 223 ASKI-HDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG 280
           +         G   +       P F + +   +    + P+ TQ G   +     R    
Sbjct: 335 SEDTNSRGQGGDLGWFPADAFGPDFGKQVESLTDGAVSEPFRTQAGWHIVQRVGSRQTDV 394

Query: 281 E-IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                +A +       K+E+    Y+++LR  A + Y
Sbjct: 395 SAENQRAQVRETIGRRKLEEEYNRYLQELRGEAYVSY 431


>gi|91776502|ref|YP_546258.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Methylobacillus
           flagellatus KT]
 gi|122070650|sp|Q1GZC0|SURA_METFK RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|91710489|gb|ABE50417.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Methylobacillus
           flagellatus KT]
          Length = 437

 Score =  140 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 46/317 (14%), Positives = 104/317 (32%), Gaps = 16/317 (5%)

Query: 11  DFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING 70
            F  +     + + F           A   RI   ++  VIT+ ++  RI  +  Q    
Sbjct: 5   VFKTIARHGLIALFFFFSISAMAAEVAKMDRIVAIVDQGVITEKELEDRIQTVIAQLEKQ 64

Query: 71  --------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSS 122
                    L+K  ++ LI + L+ Q   ++G+  D   ++    + A    LS  +F  
Sbjct: 65  GTQLPPRDVLQKQILERLINDRLQLQYAAQTGLRVDDAQLDKTIERIAEQNKLSTGEFRK 124

Query: 123 FLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRT 182
            L+ +GI    F++ +  + I   + + +   +    E EI        +    +     
Sbjct: 125 ALEAEGIPYRKFREDIRNEIILARLREREVDNRVNVTESEIDNFLTTQSSRNDIQDEFEV 184

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK---FASKIHDVSIGKAQYLLE 239
               I   +      +QK    AE +   L    +  +    ++   + +  G   +   
Sbjct: 185 AHILIRAPEESTPEELQKLKAKAEAALKELQSGADFAQVSAGYSDAPNALEGGILGWKAS 244

Query: 240 SDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTP 294
           S L   F   L        +    +  G   + + ++R     L  +     ++  + + 
Sbjct: 245 SQLPSLFVDALQALQPGQLSPVLRSPNGYHILKLLNRRGGSSPLVVDQTHVRHILIKLSE 304

Query: 295 TKIEKHEAEYVKKLRSN 311
              E    + +  ++  
Sbjct: 305 VVSELEAEQKINSIKER 321



 Score =  102 bits (253), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 18/140 (12%), Positives = 48/140 (34%), Gaps = 2/140 (1%)

Query: 179 LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLL 238
                   I  +++ ++   +++I   +E             +++      + G   +  
Sbjct: 292 QTHVRHILIKLSEVVSELEAEQKINSIKERLDHGADFAELARQYSEDASANNGGDLGWTN 351

Query: 239 ESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTK 296
             D  P F+  +     N  + P  T  G   I + ++R     + + +     +    K
Sbjct: 352 AGDTVPAFEKAMNALDINEISAPVRTPFGWHIIQVLERRKQDMTQESARLKARQEIRARK 411

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
            +    +++ +LR  A + Y
Sbjct: 412 ADDAFQDWLSELRDRAYVEY 431


>gi|319943017|ref|ZP_08017300.1| peptidyl-prolyl cis-trans isomerase [Lautropia mirabilis ATCC
           51599]
 gi|319743559|gb|EFV95963.1| peptidyl-prolyl cis-trans isomerase [Lautropia mirabilis ATCC
           51599]
          Length = 491

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 54/286 (18%), Positives = 110/286 (38%), Gaps = 11/286 (3%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALLKLQK---------INGELEKIAVQELIVET 84
                  RI   +N  VIT+ ++  +I L++ +             EL K  ++++I++ 
Sbjct: 79  PGIESLDRIVAVVNQGVITESELQAQIHLIEGRAAQTPGAGVPPPDELRKQVLEQMILQL 138

Query: 85  LKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIW 144
            ++Q     G+      V+      A+N GLS +  +  L  +G+  + F++ L  + + 
Sbjct: 139 AQEQYAADYGLKPSDAEVDRAVADVAQNNGLSTQQLTERLKDEGVSLDTFRRQLVAEIVS 198

Query: 145 PDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQK-RIK 203
             + + +        E EI A   K   ++  EY IR +L  +P+   Q +   QK R  
Sbjct: 199 ARLRERETASNVSISEGEIDAELAKSGKVSQPEYDIRQILLKLPEGADQKEVARQKARAD 258

Query: 204 DAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYV 262
           +      +        ++ +      + G   +    DL   F + ++K      + P  
Sbjct: 259 ELVAKARKGADFGALAQENSEAGDAATGGSMGWRKADDLPGLFADTVRKLKPGEISAPVR 318

Query: 263 TQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKL 308
           +  G   + + D+RD G       +      P    +  AE  ++L
Sbjct: 319 SPAGFHILKLQDRRDGGATTVELTHARHILLPANSPETAAEAERRL 364



 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/274 (11%), Positives = 80/274 (29%), Gaps = 6/274 (2%)

Query: 48  GEVITDGDISKRIALLKLQKINGELEKIAVQEL---IVETLKKQEIEKSGITFDSNTVNY 104
              I++G+I   +A            +  + +L     +    ++  ++           
Sbjct: 209 NVSISEGEIDAELAKSGKVSQPEYDIRQILLKLPEGADQKEVARQKARADELVAKARKGA 268

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP 164
            F   A+    + +  +          +      A         +    ++       + 
Sbjct: 269 DFGALAQENSEAGDAATG-GSMGWRKADDLPGLFADTVRKLKPGEISAPVRSPAGFHILK 327

Query: 165 ANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFAS 224
              ++    T  E      +    ++        ++      +            ++F+S
Sbjct: 328 LQDRRDGGATTVELTHARHILLPANSPETAAEAERRLSLFRRDIEAGKADFAKLAKEFSS 387

Query: 225 KIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKR-DLGGEI 282
                  G   +L   D  P+F+  +K       + P  TQ GV  + +  +R D     
Sbjct: 388 DGSAAKGGDLGWLYPGDTVPEFEQAMKSLHDGEISEPVQTQFGVHLVQVLGRRTDTESPE 447

Query: 283 ALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            L+    A+    K  +   +++++LR    + Y
Sbjct: 448 RLRNAARAKLREAKGGEAYQQWLRELRDRTYVEY 481


>gi|298485302|ref|ZP_07003394.1| Survival protein surA precursor (Peptidyl-prolyl cis-trans
           isomerase surA) [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|298160152|gb|EFI01181.1| Survival protein surA precursor (Peptidyl-prolyl cis-trans
           isomerase surA) [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
          Length = 428

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 41/306 (13%), Positives = 96/306 (31%), Gaps = 17/306 (5%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GELEKIA 76
             ++    + +      +   ++ +VI    + +R+  ++               L+   
Sbjct: 4   ALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAEALQPQV 63

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           +  LI+E L+ Q  E+SGI    + +N      A+   +S E F + L   G+  N  ++
Sbjct: 64  LDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVEQFRAALAHDGLSYNDARE 123

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQG 196
            +  + I   V +     +    + E+       +               I      +  
Sbjct: 124 QVRREMIISRVRQRRVAERIQVSQQEVKNFLASDQGKAQLSEEFHLANILIATPDSASSD 183

Query: 197 FVQKRIKD---AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKK 252
            +Q          +   +           +S  + +  G   +   + L P F   L   
Sbjct: 184 AIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMGWRKAAQLPPPFGDMLSAM 243

Query: 253 SQNNTTNPYVTQKGVEYIAICDKRDLGG-----EIALKAYLSAQNTPTKIEKHEAEYVKK 307
              + T P  T  G   + + +KR   G     +     ++  + +  + E+      +K
Sbjct: 244 PVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILIKPSEIRNEEETKRLAEK 303

Query: 308 LRSNAI 313
           +     
Sbjct: 304 IYDRIQ 309



 Score = 95.1 bits (234), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 16/149 (10%), Positives = 53/149 (35%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++N+   ++  +   +            + F+      +
Sbjct: 270 QGQAQMRDEVHVRHILIKPSEIRNEEETKRLAEKIYDRIQNGEDFAELAKSFSEDPGSAL 329

Query: 230 SIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAY 287
           + G   ++  + L P+F+  + +  Q   + P+ T  G   + +  +R     + A +  
Sbjct: 330 NGGDLNWVDPNSLVPEFRQVMNETPQGELSKPFKTAYGWHVLEVLGRRSTDATDQAREQQ 389

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                   K ++    +++++R  A +  
Sbjct: 390 ALNVLRNRKYDEELQTWLRQIRDEAYVEI 418


>gi|170723956|ref|YP_001751644.1| SurA domain-containing protein [Pseudomonas putida W619]
 gi|169761959|gb|ACA75275.1| SurA domain [Pseudomonas putida W619]
          Length = 441

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 43/309 (13%), Positives = 109/309 (35%), Gaps = 16/309 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK--------INGEL 72
           VL+   ++    + +     R+   ++ +V+    + +R+  ++               L
Sbjct: 14  VLLGAVLLSGAVHAAVQPLDRVVAIVDNDVVMQSQLDQRVQEVQQTIAKRGGGVPPTSAL 73

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           E+  ++ LIVE L+ Q  E+SGI      +N      A+  G+S + F + L + G+  +
Sbjct: 74  EQQVLERLIVENLQLQIGERSGIRITDEELNQAIGTIAQRNGMSLDQFRAALARDGLSFD 133

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIR---TVLFSIPD 189
             ++ +  + I   V +     +    E E+                 R    ++ +   
Sbjct: 134 DAREQVKREMIISRVRQRRVAERIQVSEQEVKNFLASDMGKMQMSEDYRLANILIPTPEG 193

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
               +     +++ D  +   +           ++  + +  G+  +   + L P+F + 
Sbjct: 194 ANSDDIQKAARKVGDVYQQLRQGADFGQMAIANSASENALEGGEMGWRKAAQLPPEFAKL 253

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG----EIALKAYLSAQNTPTKIEKHEAEY 304
           L   +  + T P     G   I + +KR        +     ++  + +  + E    + 
Sbjct: 254 LSSMATGDITQPLRIPSGFIIIKLEEKRGGSENVLRDEVHVRHILIKPSEIRSEAATEQL 313

Query: 305 VKKLRSNAI 313
            ++L     
Sbjct: 314 AERLYERIK 322



 Score = 90.9 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 19/165 (11%), Positives = 59/165 (35%), Gaps = 3/165 (1%)

Query: 155 KYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
           +  +  + I   +++  +  V    +      I  ++++++   ++  +   E       
Sbjct: 267 RIPSGFIIIKLEEKRGGSENVLRDEVHVRHILIKPSEIRSEAATEQLAERLYERIKGGED 326

Query: 215 DCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAI 272
                + F+      ++ G   ++  + L P+F+  +    Q   T P+ TQ G   + +
Sbjct: 327 FAELAKSFSEDPGSALNGGDLNWVDPNSLVPEFREQMANAQQGVVTKPFKTQYGWHVLEV 386

Query: 273 CDKRDLGGEIALKA-YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
             +R        +           K ++    +++++R  A +  
Sbjct: 387 LGRRATDSTEQAREQQAMNVLRNRKYDEELQTWLRQIRDEAYVEI 431


>gi|213967673|ref|ZP_03395820.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           tomato T1]
 gi|213927449|gb|EEB60997.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           tomato T1]
          Length = 428

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 45/309 (14%), Positives = 102/309 (33%), Gaps = 19/309 (6%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GELEKIA 76
             ++    + +      +   ++ +VI    + +R+  ++              +L+   
Sbjct: 4   ALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMGQRVREVQQTIAKRGSGVPPAADLQPQV 63

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           +  LI+E L+ Q  E+SGI    + +N      A+   +S E F + L   G+     ++
Sbjct: 64  LDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVEQFRAALAHDGLSYEDARE 123

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQG 196
            +  + I   V +     +    E E+       +               I      +  
Sbjct: 124 QVRREMIISRVRQRRVAERIQVSEQEVKNFLASDQGKAQLSEEFHLANILIATPDSASSD 183

Query: 197 FVQKRIKDAEESRLRLPKDCNKLE---KFASKIHDVSIGKAQYLLESDLHPQF-QNLLKK 252
            +Q     A+    +L K  +  +     +S  + +  G   +   + L P F   L   
Sbjct: 184 AIQAAAVKAKSIYDQLKKGADFAKIAATTSSSENALEGGDMGWRKAAQLPPPFGDMLSSM 243

Query: 253 SQNNTTNPYVTQKGVEYIAICDKRDLGG-----EIALKAYLSAQNTPTKIEKHEAEYVKK 307
              + T P  T  G   + + +KR   G     +     ++  + +  + E+      +K
Sbjct: 244 PIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILIKPSEIRSEEATKLLAQK 303

Query: 308 LRSNAIIHY 316
           +     I  
Sbjct: 304 IYER--IEN 310



 Score = 92.4 bits (227), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 15/149 (10%), Positives = 52/149 (34%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++++   +   +   E            + F+      +
Sbjct: 270 QGQAQMRDEVHVRHILIKPSEIRSEEATKLLAQKIYERIENGEDFATLAKSFSEDPGSAL 329

Query: 230 SIGKAQYLLESDLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-Y 287
           + G   ++  + L P+F++++    Q   + P+ T  G   + +  +R        +   
Sbjct: 330 NGGDLNWVDPNSLVPEFRDVMSSTPQGELSKPFKTAYGWHVLEVLGRRATDATGQARDQQ 389

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
             +     K ++    +++++R  A +  
Sbjct: 390 ALSVLRNRKYDEELQTWLRQIRDEAYVEI 418


>gi|71733994|ref|YP_272934.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71554547|gb|AAZ33758.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 440

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 42/310 (13%), Positives = 99/310 (31%), Gaps = 17/310 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   ++    + +      +   ++ +VI    + +R+  ++               L
Sbjct: 12  LMLGALLLSGAVHAAVQPLESVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAEAL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           +   +  LI+E L+ Q  E+SGI    N +N      A+   +S E F + L   G+  N
Sbjct: 72  QPQVLDRLILENLQLQMGERSGIRVSDNELNQAIGTIAQRNNMSVEQFRAALAHDGLSYN 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             ++ +  + I   V +     +    + E+       +               I     
Sbjct: 132 DAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDQGKAQLSEEFHLANILIATPDS 191

Query: 193 QNQGFVQKRIKD---AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +   +Q          +   +           +S  + +  G   +   + L P F   
Sbjct: 192 ASSDAIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMGWRKAAQLPPPFGDM 251

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-----EIALKAYLSAQNTPTKIEKHEAE 303
           L      + T P  T  G   + + +KR   G     +     ++  + +  + E+    
Sbjct: 252 LSAMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILIKPSEIRNEEETKR 311

Query: 304 YVKKLRSNAI 313
             +K+     
Sbjct: 312 LAEKIYDRIQ 321



 Score = 95.5 bits (235), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 16/149 (10%), Positives = 53/149 (35%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++N+   ++  +   +            + F+      +
Sbjct: 282 QGQAQMRDEVHVRHILIKPSEIRNEEETKRLAEKIYDRIQNGEDFAELAKSFSEDPGSAL 341

Query: 230 SIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAY 287
           + G   ++  + L P+F+  + +  Q   + P+ T  G   + +  +R     + A +  
Sbjct: 342 NGGDLNWVDPNSLVPEFRQVMNETPQGELSKPFKTAYGWHVLEVLGRRSTDATDQAREQQ 401

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                   K ++    +++++R  A +  
Sbjct: 402 ALNVLRNRKYDEELQTWLRQIRDEAYVEI 430


>gi|255020576|ref|ZP_05292639.1| Survival protein SurA precursor (Peptidyl-prolyl cis-trans
           isomerase SurA) [Acidithiobacillus caldus ATCC 51756]
 gi|254969961|gb|EET27460.1| Survival protein SurA precursor (Peptidyl-prolyl cis-trans
           isomerase SurA) [Acidithiobacillus caldus ATCC 51756]
          Length = 479

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 36/288 (12%), Positives = 107/288 (37%), Gaps = 13/288 (4%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE---------LEKIAVQELIVET 84
            +     ++   +N ++IT   +++R+A ++ +    +         L +  +Q++I++ 
Sbjct: 68  SNAEDLDKVVAVVNDDIITSLQLAQRVAAIRARLQQQDPNALPPEEVLRRQVLQQMILQD 127

Query: 85  LKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIW 144
           ++ Q  +++GI  D  T++      AR   L+ +     L +QG     F+  L  + + 
Sbjct: 128 VELQIAKRAGIKVDQATLDQAIGNIARANNLTPDQLRQALAQQGQSWTQFEDDLRDRILV 187

Query: 145 PDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRI-K 203
             + + +   +      E+    +++K +    + ++ +   +PDN   +     +R  +
Sbjct: 188 DRLTQQEVESRIHIGPDEVKTFARQLKELGGVSFDLQQIFIPLPDNPTPDAISAARRQAQ 247

Query: 204 DAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYV 262
           +  +             + +S    +  G+  ++  ++L P   Q L+       +    
Sbjct: 248 EIRDRLEAGASFSRLAAEVSSSRDALQGGRLGWVKAAELPPAISQTLMSLKPGEISPVIP 307

Query: 263 TQKGVEYIAICDKR--DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKL 308
              G     + D +  +        A +  + +     +      + +
Sbjct: 308 GPTGFHIFKVLDTKHEEPTVTEVKAAAIVLRASNGLQLQEAEARAQDI 355



 Score = 75.1 bits (182), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 13/124 (10%), Positives = 40/124 (32%), Gaps = 3/124 (2%)

Query: 196 GFVQKRIKDAEESRLRLPKDCNKLEKFASKIH-DVSIGKAQYLLESDLHPQFQNLLKK-S 253
              + R +D E +     +      +++       + G+  ++    L  + +  L    
Sbjct: 346 QEAEARAQDIETALQGGTRFSELARRYSQDPSTAAAGGELGWVAPGKLPDELERTLLALQ 405

Query: 254 QNNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNA 312
               ++P      +  +    +R +   +  + A    Q       +   E+ +++R  A
Sbjct: 406 PGAVSSPVRVGDAIYILQAQAQRQVPVGDEQILAAARMQLYNRIARQRLEEWQRRIRDGA 465

Query: 313 IIHY 316
            +  
Sbjct: 466 YVEI 469


>gi|289627686|ref|ZP_06460640.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289649005|ref|ZP_06480348.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330868493|gb|EGH03202.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 440

 Score =  139 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 100/310 (32%), Gaps = 17/310 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   ++    + +      +   ++ +VI    + +R+  ++               L
Sbjct: 12  LMLGALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAEAL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           +   +  LI+E L+ Q  E+SGI    + +N      A+   +S E F + L   G+  N
Sbjct: 72  QPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVEQFRAALAHDGLSYN 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             ++ +  + I   V +     +    + E+       +               I     
Sbjct: 132 DAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDQGKAQLSEEFHLANILIATPDS 191

Query: 193 QNQGFVQKRIKD---AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +   +Q          +   +           +S  + +  G   +   + L P F   
Sbjct: 192 ASSDAIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMGWRKAAQLPPPFGDM 251

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-----EIALKAYLSAQNTPTKIEKHEAE 303
           L     ++ T P  T  G   + + +KR   G     +     ++  + +  + E+    
Sbjct: 252 LSAMPVDDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILIKPSEIRNEEETKR 311

Query: 304 YVKKLRSNAI 313
             +K+     
Sbjct: 312 LAEKIYDRIQ 321



 Score = 95.5 bits (235), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 16/149 (10%), Positives = 53/149 (35%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++N+   ++  +   +            + F+      +
Sbjct: 282 QGQAQMRDEVHVRHILIKPSEIRNEEETKRLAEKIYDRIQNGEDFAELAKSFSEDPGSAL 341

Query: 230 SIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAY 287
           + G   ++  + L P+F+  + +  Q   + P+ T  G   + +  +R     + A +  
Sbjct: 342 NGGDLNWVDPNSLVPEFRQVMNETPQGELSKPFKTAYGWHVLEVLGRRSTDATDQAREQQ 401

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                   K ++    +++++R  A +  
Sbjct: 402 ALNVLRNRKYDEELQTWLRQIRDEAYVEI 430


>gi|330955092|gb|EGH55352.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas syringae
           Cit 7]
          Length = 440

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 39/310 (12%), Positives = 98/310 (31%), Gaps = 17/310 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   ++    + +      +   ++ +VI    + +R+  ++               L
Sbjct: 12  LMLGALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAEAL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           +   +  LI+E L+ Q  E+SGI    + +N      A+   +S + F + L   G+  N
Sbjct: 72  QPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVDQFRAALAHDGLSYN 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIR---TVLFSIPD 189
             ++ +  + I   V +     +    + E+                      ++ +   
Sbjct: 132 DAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDLGKAQLSEEFHLANILIATPDS 191

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
                      + K   +   +           +S  + +  G   +   + L P F   
Sbjct: 192 ASSDAIQAAAAKAKAIYDQLKKGADFTRLAATSSSSENALEGGDMGWRKAAQLPPPFGDM 251

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-----EIALKAYLSAQNTPTKIEKHEAE 303
           L      + T P  T  G   + + +KR   G     +     ++  + +  + E     
Sbjct: 252 LSSMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILIKPSEIRNEAETKR 311

Query: 304 YVKKLRSNAI 313
             +K+     
Sbjct: 312 LAQKIYDRIQ 321



 Score = 97.4 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 17/149 (11%), Positives = 55/149 (36%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++N+   ++  +   +            + F+      +
Sbjct: 282 QGQAQMRDEVHVRHILIKPSEIRNEAETKRLAQKIYDRIQNGEDFAELAKSFSEDPGSAL 341

Query: 230 SIGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAY 287
           + G   ++  + L P+F+ ++ +  Q   + P+ TQ G   + +  +R     + A +  
Sbjct: 342 NGGDLNWVDPNSLVPEFRQVMSETPQGELSKPFQTQYGWHVLEVLGRRSTDATDQAREQQ 401

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                   K ++    +++++R  A +  
Sbjct: 402 ALNVLRNRKYDEELQTWLRQIRDEAYVEI 430


>gi|71899114|ref|ZP_00681278.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Xylella fastidiosa
           Ann-1]
 gi|71731108|gb|EAO33175.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Xylella fastidiosa
           Ann-1]
          Length = 463

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/324 (12%), Positives = 111/324 (34%), Gaps = 23/324 (7%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMS--SRIRTTINGEVITDGDISKRIALLKLQ 66
           ++ +  ++ +  + +    +P+ S +        RI   ++  V+   ++ + I  +K Q
Sbjct: 1   MTRYFSIVLSLLLAVSCVFLPVASARQQQHQPLDRIVAVVDDNVVLKSELDRAIHNVKSQ 60

Query: 67  K--------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
                     +  L++  ++ LI+  L+    + +GI    + +N      A N   S +
Sbjct: 61  YVGHEGQLPPDEVLQRQVLERLILIKLQVARAQTNGIRVSDDELNQAISSIAENNKTSVD 120

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREY 178
                L  +GI    F+Q +  +     + +     +    E E+       +  +  +Y
Sbjct: 121 GLRQKLVAEGISFPEFRQSVRDEITVHHLRQGFAQSRIVVSEGEVDTAL--AQANSGAQY 178

Query: 179 LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK--FASKIHDVSIGKAQY 236
            ++ +L S+PD     Q  + ++  +  +S +   +         ++   + +  G   +
Sbjct: 179 HLQHILVSLPDGATSEQIAIAQKKINGIKSVIDKGELAFSAAAVRYSDSPNALESGDLGW 238

Query: 237 LLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKRDLG--------GEIALKAY 287
               ++   F  +           P     G + + + +  D                 +
Sbjct: 239 RSLDEIPEAFAQMVQTMKPGQIVGPLRGTSGFQLLKLVEVHDSTAAAGPRQMATEYHARH 298

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSN 311
           +  + T  + E      +  LR+ 
Sbjct: 299 ILVRITEKQKEAQAKAKIDTLRAR 322



 Score = 85.1 bits (208), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 17/138 (12%), Positives = 43/138 (31%), Gaps = 3/138 (2%)

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLL 238
                  +   + Q +   + +I                  + +   ++ +  G   +  
Sbjct: 294 YHARHILVRITEKQKEAQAKAKIDTLRARIAGGADFQTVARESSEDANNSNQGGDLGWFP 353

Query: 239 ESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGE-IALKAYLSAQNTPTK 296
                  F N +K  +  N + P+ +  G   +     R         +A +       K
Sbjct: 354 SDAFGADFGNHVKALADGNVSEPFRSAAGWHIVQRLGTRQTDVTRENQRAQIRDTIGQRK 413

Query: 297 IEKHEAEYVKKLRSNAII 314
           +E+    ++++LRS A +
Sbjct: 414 LEESYERFLRELRSEAYV 431


>gi|77461354|ref|YP_350861.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas
           fluorescens Pf0-1]
 gi|121956432|sp|Q3K5T4|SURA_PSEPF RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|77385357|gb|ABA76870.1| putative chaperone [Pseudomonas fluorescens Pf0-1]
          Length = 426

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 43/306 (14%), Positives = 104/306 (33%), Gaps = 17/306 (5%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL--------QKINGELEKIA 76
              +   +  +     R+   ++ +V+    + +R+  ++             G L++  
Sbjct: 4   ALFLGTAANAAVQSIDRVVAIVDNDVVMQSQLDQRVHEVQQTIAKRGGGLPPPGVLDQQV 63

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           ++ LIVE L+ Q  E+SGI      +N      A+   ++ E F   L + G+     ++
Sbjct: 64  LERLIVENLQLQIGERSGIRITDEELNQAVGTIAQRNNMTPEQFRIALSRDGLSYEDARE 123

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQG 196
            +  + +   V +     +    E E+                +      IP  +  N  
Sbjct: 124 QIRREMVISRVRQRRVAERIQVSEQEVKNFLASDLGKMQLSEELHLANILIPTPESANSE 183

Query: 197 FV---QKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKK 252
            +    ++  +  +   +           ++  + +  G   +   + L P F + L   
Sbjct: 184 AIQSAARKAMEVYQQLKQGADFGQMAVANSASDNALEGGDMGWRKAAQLPPPFDRELSSM 243

Query: 253 SQNNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEYVKKLR 309
           +  + T P  T  G   + + +KR       +     ++  + +P + E    E  + L 
Sbjct: 244 ATGDITQPARTPGGFIILKLLEKRGGESQMRDEVHVRHILVKPSPVRDEAKTKELAQSLY 303

Query: 310 SNAIIH 315
           +   I 
Sbjct: 304 NR--IE 307



 Score = 92.0 bits (226), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 15/147 (10%), Positives = 52/147 (35%), Gaps = 3/147 (2%)

Query: 173 ITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSI 231
            +     +      +  + ++++   ++  +                +K++      ++ 
Sbjct: 270 ESQMRDEVHVRHILVKPSPVRDEAKTKELAQSLYNRIEAGEDFAELAKKYSEDPGSALNG 329

Query: 232 GKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLS 289
           G   ++  + L P+F+ ++ K  Q   + P+ TQ G   + +  +R        +     
Sbjct: 330 GDLNWIDPNALVPEFRAVMAKSPQGQLSKPFQTQYGWHVLEVLGRRATDSTEQAREQQAM 389

Query: 290 AQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                 K ++    +++++R  A +  
Sbjct: 390 TVLRNRKYDEELQTWLRQIRDEAYVEI 416


>gi|15837440|ref|NP_298128.1| peptidyl-prolyl cis-trans isomerase [Xylella fastidiosa 9a5c]
 gi|81788857|sp|Q9PF40|SURA_XYLFA RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|9105742|gb|AAF83648.1|AE003923_6 peptidyl-prolyl cis-trans isomerase [Xylella fastidiosa 9a5c]
          Length = 464

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/325 (12%), Positives = 112/325 (34%), Gaps = 24/325 (7%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMS--SRIRTTINGEVITDGDISKRIALLKLQ 66
           ++ +  ++ +  + +    +P+ S +        RI   ++  V+   ++ + I  +K Q
Sbjct: 1   MTRYFSIVLSLLLAVSCVFLPVASARQQQHQPLDRIVAVVDDNVVLKSELDRAIHNVKSQ 60

Query: 67  K--------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
                     +  L++  ++ LI+  L+    + +GI    + +N      A N   S +
Sbjct: 61  YVGHEGQLPPDEVLQRQVLERLILIKLQVARAQTNGIRVSDDELNQAISSIAENNKTSVD 120

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREY 178
                L  +GI    F+Q +  +     + +     +    E E+       +  +  +Y
Sbjct: 121 GLRQKLVAEGISFPEFRQSVRDEITVHHLRQGFAQSRIVVSEGEVDTAL--AQASSGAQY 178

Query: 179 LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK--FASKIHDVSIGKAQY 236
            ++ +L ++PD     Q  + ++  D  +S +   +         ++   + +  G   +
Sbjct: 179 HLQHILVAVPDGATSQQIAIAQKKIDGIKSVIDKGELAFSAAAVRYSDSPNALESGDLGW 238

Query: 237 LLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKRD---------LGGEIALKA 286
               ++   F  +           P     G + + + + RD                  
Sbjct: 239 RSLDEIPEAFAQMVQTMKPGQIVGPLRGTSGFQLLKLVEVRDSAAAAAGPRQMATEYHAR 298

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSN 311
           ++  + T  + E      +  LR+ 
Sbjct: 299 HILVRITEKQKEAEAKAKIDTLRAR 323



 Score = 84.7 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 18/156 (11%), Positives = 46/156 (29%), Gaps = 3/156 (1%)

Query: 162 EIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK 221
           E+  +                    +   + Q +   + +I                  +
Sbjct: 277 EVRDSAAAAAGPRQMATEYHARHILVRITEKQKEAEAKAKIDTLRARIAGGADFQTVARE 336

Query: 222 FASKIHDVS-IGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLG 279
            +   ++ +  G   +         F N +K  +  N + P+ +  G   +     R   
Sbjct: 337 SSEDANNSNQGGDLGWFPSDAFGADFGNHVKALADGNVSEPFRSAAGWHIVQRLGTRQTD 396

Query: 280 GE-IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
                 +A +       K+E+    ++++LRS A +
Sbjct: 397 VTRENQRAQIRDTIGQRKLEESYERFLRELRSEAYV 432


>gi|298370562|ref|ZP_06981877.1| SurA/PPIASE domain protein [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298281172|gb|EFI22662.1| SurA/PPIASE domain protein [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 304

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 35/315 (11%), Positives = 100/315 (31%), Gaps = 29/315 (9%)

Query: 15  LLTTYFVLIIFCIVPIVSYKS-WAMSSRIRTTINGEVITDGDISKRIALLKL------QK 67
           +     +L     + +  + +    S  I   ++ +VIT  ++++ +A  +       Q 
Sbjct: 1   MNFKPLILAAALGLTLNVHAADVKFSDGIAAVVDNDVITQREVAQAVAAARSRLPKGSQI 60

Query: 68  INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
            N EL +  + +L+ ++L  Q  ++  I      ++    Q+      + +         
Sbjct: 61  SNDELRQQVLSQLVNQSLIIQAGKRKKIQASEAEIDAVLAQNPTQAKKANKAVR------ 114

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNIT------VREYLIR 181
                   + +A   +   V +   M      + E+     + +               +
Sbjct: 115 --------RQIADSIVVEKVRQQAIMQNSRVSDAEVDRFLAQAQRQGITLPAGEPLRQYK 166

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESD 241
                +  +        +  I+                 +++      + G   +  +  
Sbjct: 167 AQHILLKADSDNAVSAAESSIRKIYAQARSGTDFSALARQYSQDTSAGNGGDLGWFSDGQ 226

Query: 242 LHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDL-GGEIALKAYLSAQNTPTKIEK 299
           +   F++ + K      + P  TQ G   I + + RD    E   +  +    +  K ++
Sbjct: 227 MVAPFEDAVHKLKPGQVSPPVRTQFGWHIIKLNEVRDAGTPEERQRNAVRQYISNQKAQQ 286

Query: 300 HEAEYVKKLRSNAII 314
                +++L S++ +
Sbjct: 287 ATTNLLQELHSSSYV 301


>gi|325576844|ref|ZP_08147459.1| peptidyl-prolyl cis-trans isomerase [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325161050|gb|EGC73168.1| peptidyl-prolyl cis-trans isomerase [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 310

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 56/315 (17%), Positives = 121/315 (38%), Gaps = 19/315 (6%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEK 74
           +  +    ++F ++ + ++       R+  T+NG  I    ++  +            ++
Sbjct: 1   MKKSMLKSLLFAMIGLFTFSQAQAEERVVATVNGTPILQSQVNAVM-------GKKGSQR 53

Query: 75  IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF 134
            A+ ++I + L ++ I++SG+  +   VN      A   GL+   F   LD QGI  N F
Sbjct: 54  AALDKIIDDMLTEKAIKESGVKVNQAEVNRIVEDIAAKNGLTYGQFLDALDYQGISLNAF 113

Query: 135 KQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNI----------TVREYLIRTVL 184
           KQ ++ Q +   V  +           ++ A  ++M +             +EY +R +L
Sbjct: 114 KQQISRQMLMAGVRNHAIQNSVDVTREQVEALGKQMLDEAKAKGTAQKVMGKEYEVRHIL 173

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQY-LLESDLH 243
             +       Q   +     +E    ++      L+     +   + G   Y   E+ + 
Sbjct: 174 LKLNPLLDDAQAKAELERIRSEIILGKMTFADAALKYSKDYLSGANGGSLGYAFPEAYVG 233

Query: 244 PQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKHEA 302
           P  + +    Q   + P+ ++ G   + +   RD              Q   +++++   
Sbjct: 234 PFAKMVETTPQGTVSAPFKSEFGWHILEVTGSRDGDKTEDAYRQKAYEQIVNSQLQEATK 293

Query: 303 EYVKKLRSNAIIHYY 317
           ++VK LR NA I Y+
Sbjct: 294 DWVKALRKNADIQYF 308


>gi|254522723|ref|ZP_05134778.1| chaperone SurA [Stenotrophomonas sp. SKA14]
 gi|219720314|gb|EED38839.1| chaperone SurA [Stenotrophomonas sp. SKA14]
          Length = 447

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 38/321 (11%), Positives = 101/321 (31%), Gaps = 22/321 (6%)

Query: 13  IKLLTTYFVLIIFCIVPIVS-----YKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK 67
           +       +  +  +  + +      +      RI   ++ +VI   ++ + IA +K Q 
Sbjct: 1   MTKRFPVLLASLLAVSSVSAPLQVLAQEAQPLDRIAAVVDEDVILQSELQRAIANIKAQY 60

Query: 68  --------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAED 119
                       L +  ++ L++  L+    + SGI      +N      A+  G + + 
Sbjct: 61  AGRENQLPPEDVLSRQVLERLVLVKLQVARAQSSGIRVGDQELNQAMNAIAQQNGSTLDA 120

Query: 120 FSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYL 179
               L   GI  N F+  +  +     + ++    +    E E+ A  ++   +  + +L
Sbjct: 121 LRQRLAHDGIDFNDFRASVRDEITVQRLRQSFAQSRISVSEGEVDAALKQQATVGNQYHL 180

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKIHDVSIGKAQYLL 238
              ++              QK+    +    +          +++   + +  G   +  
Sbjct: 181 AHILVALPDGANADQIATGQKKADGVKALLDKGELDFNAAAVRYSDSPNALEGGDLGWRS 240

Query: 239 ESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDL-------GGEIALKAYLSA 290
             ++   F  ++ K        P     G + + + D RD                ++  
Sbjct: 241 LDEIPQAFAQMMEKMKPGEVVGPIRGPSGFQLLKLVDVRDASATAGANTVTEYHGRHILV 300

Query: 291 QNTPTKIEKHEAEYVKKLRSN 311
           +    + +      +  LR+ 
Sbjct: 301 RVDDHQTDAAAKAKIDTLRAR 321



 Score = 84.7 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 22/156 (14%), Positives = 44/156 (28%), Gaps = 5/156 (3%)

Query: 162 EIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK 221
           ++          TV EY  R +L     +  Q     + +I                 ++
Sbjct: 277 DVRDASATAGANTVTEYHGRHILV--RVDDHQTDAAAKAKIDTLRARIAGGADFETVAKE 334

Query: 222 FASKI-HDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLG 279
            +         G   +       P F Q +        + P+ T  G   +     R   
Sbjct: 335 SSEDNNSKGQGGDLGWFPADAFGPAFGQQVSGLQDGGVSQPFRTDAGWHIVQRVATRQTD 394

Query: 280 GEIAL-KAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
                 +A +       K+E     ++++LR  A +
Sbjct: 395 VTNDNQRAQVRETIGRRKLEDEYNRFLQELRGEAYV 430


>gi|122070657|sp|Q48NT5|SURA_PSE14 RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
          Length = 428

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 42/306 (13%), Positives = 96/306 (31%), Gaps = 17/306 (5%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GELEKIA 76
             ++    + +      +   ++ +VI    + +R+  ++               L+   
Sbjct: 4   ALLLSGAVHAAVQPLESVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAEALQPQV 63

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           +  LI+E L+ Q  E+SGI    N +N      A+   +S E F + L   G+  N  ++
Sbjct: 64  LDRLILENLQLQMGERSGIRVSDNELNQAIGTIAQRNNMSVEQFRAALAHDGLSYNDARE 123

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQG 196
            +  + I   V +     +    + E+       +               I      +  
Sbjct: 124 QVRREMIISRVRQRRVAERIQVSQQEVKNFLASDQGKAQLSEEFHLANILIATPDSASSD 183

Query: 197 FVQKRIKD---AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKK 252
            +Q          +   +           +S  + +  G   +   + L P F   L   
Sbjct: 184 AIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMGWRKAAQLPPPFGDMLSAM 243

Query: 253 SQNNTTNPYVTQKGVEYIAICDKRDLGG-----EIALKAYLSAQNTPTKIEKHEAEYVKK 307
              + T P  T  G   + + +KR   G     +     ++  + +  + E+      +K
Sbjct: 244 PVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILIKPSEIRNEEETKRLAEK 303

Query: 308 LRSNAI 313
           +     
Sbjct: 304 IYDRIQ 309



 Score = 95.1 bits (234), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 16/149 (10%), Positives = 53/149 (35%), Gaps = 3/149 (2%)

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +        +      I  ++++N+   ++  +   +            + F+      +
Sbjct: 270 QGQAQMRDEVHVRHILIKPSEIRNEEETKRLAEKIYDRIQNGEDFAELAKSFSEDPGSAL 329

Query: 230 SIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAY 287
           + G   ++  + L P+F+  + +  Q   + P+ T  G   + +  +R     + A +  
Sbjct: 330 NGGDLNWVDPNSLVPEFRQVMNETPQGELSKPFKTAYGWHVLEVLGRRSTDATDQAREQQ 389

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                   K ++    +++++R  A +  
Sbjct: 390 ALNVLRNRKYDEELQTWLRQIRDEAYVEI 418


>gi|152984838|ref|YP_001346133.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           PA7]
 gi|150959996|gb|ABR82021.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           PA7]
          Length = 430

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/308 (13%), Positives = 109/308 (35%), Gaps = 15/308 (4%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL--------QKINGEL 72
           + +   ++   ++       R+   ++ +VI    + +R+  +                L
Sbjct: 12  LALGAALLCSFAHAEVVPLDRVVAIVDNDVIMQSQLDQRLREVHQTLLKRGAPLPPEHVL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            +  ++ LI+E +++Q  ++SGI      +N      A+  G+S E F + L + G+   
Sbjct: 72  TQQVLERLIIENIQQQIGDRSGIRISDEELNQAMATIAQRNGMSLEQFQAALTRDGLSYA 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             +  +  + +   V +     +    E E+                 R     IP  + 
Sbjct: 132 DARDQVRREMVISRVRQRRVAERIQVSEQEVKNFLASDMGKIQLSEEYRLANILIPVPEA 191

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
            +   +Q   + A+E   +L +  +        ++  + +  G+  +   + L   F ++
Sbjct: 192 ASSDVIQAAARQAQELYQQLKQGADFGQLAISRSAGDNALEGGEIGWRKAAQLPQPFDSM 251

Query: 250 LKK-SQNNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEYV 305
           +   +  + T P  T  G   + + +KR       +     ++  + +  + +    +  
Sbjct: 252 IGSLAVGDVTEPVRTPGGFIILKLEEKRGGSKMVRDEVHVRHILLKPSEIRSDAETEKLA 311

Query: 306 KKLRSNAI 313
           +KL     
Sbjct: 312 QKLYERIQ 319



 Score = 93.2 bits (229), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 15/139 (10%), Positives = 48/139 (34%), Gaps = 3/139 (2%)

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLE 239
                 +  +++++    +K  +   E            + F+      ++ G   ++  
Sbjct: 290 HVRHILLKPSEIRSDAETEKLAQKLYERIQSGEDFGELAKSFSEDPGSALNGGDLNWIDP 349

Query: 240 SDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKI 297
             L P+F+  +    Q   + P+ +Q G   + +  +R        +     +     K 
Sbjct: 350 EALVPEFRQVMNDTPQGELSKPFRSQFGWHILQVLGRRATDSSEKFREQQAVSVLRNRKY 409

Query: 298 EKHEAEYVKKLRSNAIIHY 316
           ++    +++++R  A +  
Sbjct: 410 DEELQAWLRQIRDEAYVEI 428


>gi|301061946|ref|ZP_07202675.1| SurA N-terminal domain protein [delta proteobacterium NaphS2]
 gi|300443963|gb|EFK07999.1| SurA N-terminal domain protein [delta proteobacterium NaphS2]
          Length = 316

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 48/311 (15%), Positives = 104/311 (33%), Gaps = 17/311 (5%)

Query: 23  IIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING----------EL 72
               I+   +      +S     +NG+VIT  ++ + +   K Q +             L
Sbjct: 2   FSLAILSWPASAEEKPASEKVAVVNGDVITRANLDRAMDFAKRQSMQQGKPLDEEQLAAL 61

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           +K  + +LI   L  Q  +K+G   D   V+  F Q  +    + E     +++  + + 
Sbjct: 62  KKETLDKLIGIELLYQASKKAGNKVDEKQVDEKFAQFKKRF-PNEEALQKTMEEWHVTEA 120

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             K  L    +    V  +F+ K    E E+ A          +   ++     I     
Sbjct: 121 DMKAELKKGMVTEAFVMKNFVDKTTIPEEEVKAYYDSHPQFFKQPEQVKASHILIKVKPD 180

Query: 193 QNQGFVQKRIKDAEESRLR---LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
             +    + +K  E+++ +           +  +        G   Y     +   F+++
Sbjct: 181 ATEAEKAEAMKKIEKAQDKLLEGEDFAEVAKTTSEGPSASKGGDLGYFGRGQMVKPFEDV 240

Query: 250 LKK-SQNNTTNPYVTQKGVEYIAICDKRDLG--GEIALKAYLSAQNTPTKIEKHEAEYVK 306
                    ++   TQ G   I + DK+         +K  +       +++K   +Y+ 
Sbjct: 241 AFSLEPGKVSDVVKTQFGYHLIKVVDKKPETTIPLETVKPRIEQFLKQQEVQKEIKKYID 300

Query: 307 KLRSNAIIHYY 317
            LR  A +  +
Sbjct: 301 NLRKGAKVEIF 311


>gi|39995126|ref|NP_951077.1| peptidyl-prolyl cis-trans isomerase domain-containing protein
           [Geobacter sulfurreducens PCA]
 gi|39981888|gb|AAR33350.1| PPIC-type PPIASE domain protein [Geobacter sulfurreducens PCA]
 gi|298504156|gb|ADI82879.1| peptidylprolyl cis-trans isomerase, PpiC-type, SurA family
           [Geobacter sulfurreducens KN400]
          Length = 321

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 53/318 (16%), Positives = 105/318 (33%), Gaps = 17/318 (5%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING---- 70
           ++     L +  ++ + S  S  + SRI   +N E++T   + K    L  +        
Sbjct: 1   MIKRLIPLSLAVVLTLPSLSSAEVVSRILAVVNDEIVTSYAVDKEKRALLKEAERQQPPP 60

Query: 71  ------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L+++A+  LI + L +Q+I +  I      V        R   LS E   + L
Sbjct: 61  DPKSLANLDEVALNRLIDKKLVEQKIRELDIRVGEEEVRQAIEDVKRQNKLSQEALVAAL 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
             QG+  + +K  +  Q     +V  +   K    E E+    +  K     E + R   
Sbjct: 121 ANQGLSFDQYKAQIKEQLERLRLVSQEVRSKIQVGEREMREYYEANKAKFGAEDIFRARN 180

Query: 185 FSIPDNKLQNQGFVQKRI---KDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLES 240
                +   +   V+K +                     +++       + G      + 
Sbjct: 181 IYFKLDDKMSAEQVKKVMTTAMTVLHEAQSGKDFAELARQYSDDPAAKGNGGDLGTFRKG 240

Query: 241 D-LHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDK--RDLGGEIALKAYLSAQNTPTKI 297
           D L    + L +      ++   T  G+  + + ++          +KA +       K 
Sbjct: 241 DILPEFEEQLTRMQPGEVSDLIYTATGLHIVKLEERSLGTPKPFEQVKAEVEDLVYRKKS 300

Query: 298 EKHEAEYVKKLRSNAIIH 315
           E    ++V  LR  A I 
Sbjct: 301 EDRFNQWVADLRKGAAIE 318


>gi|15595791|ref|NP_249285.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           PAO1]
 gi|9946466|gb|AAG03983.1|AE004495_7 peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           PAO1]
          Length = 430

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 42/308 (13%), Positives = 110/308 (35%), Gaps = 15/308 (4%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL--------QKINGEL 72
           + +   ++   ++       R+   ++ +VI    + +R+  +                L
Sbjct: 12  LALGAALLCSFAHAEVVPLDRVVAIVDNDVIMQSQLDQRLREVHQTLLKRGAPLPPEHVL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            +  ++ LI+E +++Q  ++SGI      +N      A+  G+S E F + L + G+   
Sbjct: 72  TQQVLERLIIENIQQQIGDRSGIRISDEELNQAMGTIAQRNGMSLEQFQTALTRDGLSYA 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             ++ +  + +   V +     +    E E+                 R     IP  + 
Sbjct: 132 DAREQVRREMVISRVRQRRVAERIQVSEQEVKNFLASDMGKIQLSEEYRLANILIPVPEA 191

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
            +   +Q   + A+E   +L +  +        ++  + +  G+  +   + L   F ++
Sbjct: 192 ASSDVIQAAARQAQELYQQLKQGADFGQLAISRSAGDNALEGGEIGWRKAAQLPQPFDSM 251

Query: 250 LKK-SQNNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEYV 305
           +   +  + T P  T  G   + + +KR       +     ++  + +  + E    +  
Sbjct: 252 IGSLAVGDVTEPVRTPGGFIILKLEEKRGGSKMVRDEVHVRHILLKPSEIRSEAETEKLA 311

Query: 306 KKLRSNAI 313
           +KL     
Sbjct: 312 QKLYERIQ 319



 Score = 92.8 bits (228), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 15/139 (10%), Positives = 49/139 (35%), Gaps = 3/139 (2%)

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLE 239
                 +  ++++++   +K  +   E            + F+      ++ G   ++  
Sbjct: 290 HVRHILLKPSEIRSEAETEKLAQKLYERIQSGEDFGELAKSFSEDPGSALNGGDLNWIDP 349

Query: 240 SDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKI 297
             L P+F+  +    Q   + P+ +Q G   + +  +R        +     +     K 
Sbjct: 350 EALVPEFRQVMNDTPQGELSKPFRSQFGWHILQVLGRRATDSSEKFREQQAVSVLRNRKY 409

Query: 298 EKHEAEYVKKLRSNAIIHY 316
           ++    +++++R  A +  
Sbjct: 410 DEELQAWLRQIRDEAYVEI 428


>gi|75675872|ref|YP_318293.1| hypothetical protein Nwi_1680 [Nitrobacter winogradskyi Nb-255]
 gi|74420742|gb|ABA04941.1| conserved unknown protein [Nitrobacter winogradskyi Nb-255]
          Length = 314

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 65/299 (21%), Positives = 125/299 (41%), Gaps = 4/299 (1%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQEL 80
           +L +F  +  VS  S   +  I   +NGE IT  DI +R  L+K+        +  + EL
Sbjct: 12  LLAVFAFLTFVSMNSPLHAQSIAVMVNGEPITTLDIEQRSRLIKISTHKSPSRQEVIDEL 71

Query: 81  IVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAI 140
           I E +K +E +K G+   S  ++  +       G+S E  +  L  QGI  +  K  L  
Sbjct: 72  IDEKVKVKEAKKYGVNPTSTDIDRAYANMGARMGMSPEQLTKSLGSQGIRPDTIKSRLKA 131

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVRE--YLIRTVLFSIPDNKLQNQGFV 198
             +W  +V+  F       + ++    +       +      +     +   +      V
Sbjct: 132 DLVWGSLVRGRFKESLLVSDRDVNEALKNSGEDQSKIEGVEYQMRPVVLIVPRGATASMV 191

Query: 199 QKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNT 257
           + R  +A   R R+      +      + + ++ +      +DL P  ++ L K +  + 
Sbjct: 192 EARRNEANALRERVQSCAEIIRTV-KVMRNATLRETITKTSTDLPPPLRDLLDKTAVGHL 250

Query: 258 TNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           T P +T++GVE +A+C K+    +   K  +  +    K EK    Y++++R +A+I Y
Sbjct: 251 TPPEMTRQGVEMVAVCGKKVTSVDTPKKKEIREKMFADKYEKRSKSYLERIRKSAMIEY 309


>gi|254243688|ref|ZP_04937010.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           2192]
 gi|126197066|gb|EAZ61129.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           2192]
          Length = 430

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 42/308 (13%), Positives = 111/308 (36%), Gaps = 15/308 (4%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL--------QKINGEL 72
           + +   ++   ++       R+   ++ +VI    + +R+  +                L
Sbjct: 12  LALGAALLCSFAHAEVVPLDRVVAIVDNDVIMQSQLDQRLREVHQTLLKRGAPLPPEHVL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            +  ++ LI+E +++Q  ++SGI      +N      A+  G+S E F + L + G+  +
Sbjct: 72  TQQVLERLIIENIQQQIGDRSGIRISDEELNQAMGTIAQRNGMSLEQFQAALTRDGLSYS 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             ++ +  + +   V +     +    E E+                 R     IP  + 
Sbjct: 132 DAREQVRREMVISRVRQRRVAERIQVSEQEVKNFLASDMGKIQLSEEYRLANILIPVPEA 191

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
            +   +Q   + A+E   +L +  +        ++  + +  G+  +   + L   F ++
Sbjct: 192 ASSDVIQAAARQAQELYQQLKQGADFGQLAISRSAGDNALEGGEIGWRKAAQLPQPFDSM 251

Query: 250 LKK-SQNNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEYV 305
           +   +  + T P  T  G   + + +KR       +     ++  + +  + E    +  
Sbjct: 252 IGSLAVGDVTEPVRTPGGFIILKLEEKRGGSKMVRDEVHVRHILLKPSEIRSEAETEKLA 311

Query: 306 KKLRSNAI 313
           +KL     
Sbjct: 312 QKLYERIQ 319



 Score = 92.4 bits (227), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 15/139 (10%), Positives = 49/139 (35%), Gaps = 3/139 (2%)

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLE 239
                 +  ++++++   +K  +   E            + F+      ++ G   ++  
Sbjct: 290 HVRHILLKPSEIRSEAETEKLAQKLYERIQSGEDFGELAKSFSEDPGSALNGGDLNWIDP 349

Query: 240 SDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKI 297
             L P+F+  +    Q   + P+ +Q G   + +  +R        +     +     K 
Sbjct: 350 EALVPEFRQVMNDTPQGELSKPFRSQFGWHILQVLGRRATDSSEKFREQQAVSVLRNRKY 409

Query: 298 EKHEAEYVKKLRSNAIIHY 316
           ++    +++++R  A +  
Sbjct: 410 DEELQAWLRQIRDEAYVEI 428


>gi|301155190|emb|CBW14654.1| unnamed protein product [Haemophilus parainfluenzae T3T1]
          Length = 310

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 56/315 (17%), Positives = 121/315 (38%), Gaps = 19/315 (6%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEK 74
           +  +    ++F ++ + ++       R+  T+NG  I    ++  +            ++
Sbjct: 1   MKKSMLKSLLFAMIGLFTFSQVQAEERVVATVNGTPILQSQVNAVM-------GKKGSQR 53

Query: 75  IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF 134
            A+ ++I + L ++ I++SG+  +   VN      A   GL+   F   LD QGI  N F
Sbjct: 54  AALDKIIDDMLTEKAIKESGVKVNQAEVNRIVEDIAAKNGLTYGQFLDALDYQGISLNAF 113

Query: 135 KQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNI----------TVREYLIRTVL 184
           KQ ++ Q +   V  +           ++ A  ++M +             +EY +R +L
Sbjct: 114 KQQISRQMLMAGVRNHAIQNSVDVTREQVDALGKQMLDEAKAKGTAQKVMGKEYEVRHIL 173

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQY-LLESDLH 243
             +       Q   +     +E    ++      L+     +   + G   Y   E+ + 
Sbjct: 174 LKLNPLLNDAQAKAELERIRSEIISGKMTFADAALKYSKDYLSGANGGSLGYAFPEAYVG 233

Query: 244 PQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKHEA 302
           P  + +    Q   + P+ ++ G   + +   RD              Q   +++++   
Sbjct: 234 PFAKMVETTPQGTISAPFKSEFGWHILEVTGTRDGDKTEDAYRQKAYEQIVNSQLQEATK 293

Query: 303 EYVKKLRSNAIIHYY 317
           ++VK LR NA I Y+
Sbjct: 294 DWVKALRKNADIQYF 308


>gi|116054322|ref|YP_788767.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218889335|ref|YP_002438199.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           LESB58]
 gi|254237192|ref|ZP_04930515.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           C3719]
 gi|296387100|ref|ZP_06876599.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           PAb1]
 gi|115589543|gb|ABJ15558.1| peptidyl-prolyl cis-trans isomerase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126169123|gb|EAZ54634.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           C3719]
 gi|218769558|emb|CAW25318.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           LESB58]
          Length = 430

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 42/308 (13%), Positives = 110/308 (35%), Gaps = 15/308 (4%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL--------QKINGEL 72
           + +   ++   ++       R+   ++ +VI    + +R+  +                L
Sbjct: 12  LALGAALLCSFAHAEVVPLDRVVAIVDNDVIMQSQLDQRLREVHQTLLKRGAPLPPEHVL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            +  ++ LI+E +++Q  ++SGI      +N      A+  G+S E F + L + G+   
Sbjct: 72  TQQVLERLIIENIQQQIGDRSGIRISDEELNQAMGTIAQRNGMSLEQFQAALTRDGLSYA 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             ++ +  + +   V +     +    E E+                 R     IP  + 
Sbjct: 132 DAREQVRREMVISRVRQRRVAERIQVSEQEVKNFLASDMGKIQLSEEYRLANILIPVPEA 191

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
            +   +Q   + A+E   +L +  +        ++  + +  G+  +   + L   F ++
Sbjct: 192 ASSDVIQAAARQAQELYQQLKQGADFGQLAISRSAGDNALEGGEIGWRKAAQLPQPFDSM 251

Query: 250 LKK-SQNNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEYV 305
           +   +  + T P  T  G   + + +KR       +     ++  + +  + E    +  
Sbjct: 252 IGSLAVGDVTEPVRTPGGFIILKLEEKRGGSKMVRDEVHVRHILLKPSEIRSEAETEKLA 311

Query: 306 KKLRSNAI 313
           +KL     
Sbjct: 312 QKLYERIQ 319



 Score = 92.4 bits (227), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 15/139 (10%), Positives = 49/139 (35%), Gaps = 3/139 (2%)

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLE 239
                 +  ++++++   +K  +   E            + F+      ++ G   ++  
Sbjct: 290 HVRHILLKPSEIRSEAETEKLAQKLYERIQSGEDFGELAKSFSEDPGSALNGGDLNWIDP 349

Query: 240 SDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKI 297
             L P+F+  +    Q   + P+ +Q G   + +  +R        +     +     K 
Sbjct: 350 EALVPEFRQVMNDTPQGELSKPFRSQFGWHILQVLGRRATDSSEKFREQQAVSVLRNRKY 409

Query: 298 EKHEAEYVKKLRSNAIIHY 316
           ++    +++++R  A +  
Sbjct: 410 DEELQAWLRQIRDEAYVEI 428


>gi|89094171|ref|ZP_01167114.1| peptidyl-prolyl cis-trans isomerase SurA [Oceanospirillum sp.
           MED92]
 gi|89081646|gb|EAR60875.1| peptidyl-prolyl cis-trans isomerase SurA [Oceanospirillum sp.
           MED92]
          Length = 430

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 51/314 (16%), Positives = 115/314 (36%), Gaps = 16/314 (5%)

Query: 14  KLLTTYFVLIIFCIVPIV-SYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           KL        +  ++P+  S+ +     RI   +N  +I   ++ +R ++ + Q  +   
Sbjct: 4   KLHKLISAAALSLLLPVSHSHAAEIPLDRIAAVVNEGIILQSELEQRTSITREQLQSRNT 63

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L K  +  LI+E+++KQ  E++G+    + +N      A   GLS + F   L
Sbjct: 64  RIPPEHILRKQVLNRLIIESIQKQMAEQNGVRVSDSQLNGAIANIAAQNGLSIDQFREAL 123

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
             +G   N  ++ +  + +   V +N    +    E E+          +          
Sbjct: 124 IAEGRDYNQAREQIRNEMLINSVQQNLVNRRIRVSEQELSNFLNSEDGKSQASAEFLLGH 183

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE---KFASKIHDVSIGKAQYLLESD 241
             I      +   +Q+    A+E   +L    +  E   +F++  + +  G   +   ++
Sbjct: 184 ILIATPSQASPEIIQQAESKAKEIFDKLNNGADFAETAVEFSNAPNALKGGDLGWRKANE 243

Query: 242 LHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQNTPTKI 297
           L     + + K S    + P  +  G   +   DKR       +  L +++  + T  + 
Sbjct: 244 LPEALSKAVRKLSPGEFSKPVRSPSGFHILLAKDKRGGAVQLIDQRLVSHILLKPTEIRT 303

Query: 298 EKHEAEYVKKLRSN 311
            +     + +L   
Sbjct: 304 NEQAKRQISQLYQR 317



 Score = 84.7 bits (207), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 16/138 (11%), Positives = 50/138 (36%), Gaps = 3/138 (2%)

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLES 240
                +   +++     +++I    +            ++F+         G   +    
Sbjct: 291 VSHILLKPTEIRTNEQAKRQISQLYQRIASGEDFAALAKEFSDDPASGSEGGSLGWTQNG 350

Query: 241 DLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKR-DLGGEIALKAYLSAQNTPTKIE 298
            + P+F+ ++  +     + P+ ++ G   + + D R +  GE   +    A     K  
Sbjct: 351 QMVPEFEQVMNSTAVGQVSEPFESRFGWHILTVLDTRTEDMGETMQENRARATIRKRKFN 410

Query: 299 KHEAEYVKKLRSNAIIHY 316
           +  + +++++RS A +  
Sbjct: 411 EELSNWLREIRSQAYVDI 428


>gi|315186551|gb|EFU20310.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Spirochaeta
           thermophila DSM 6578]
          Length = 336

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 47/289 (16%), Positives = 100/289 (34%), Gaps = 17/289 (5%)

Query: 45  TINGEVITDGDISKRIALLKLQKIN----------GELEKIAVQELIVETLKKQEIEKSG 94
            +NGE +   ++ + +     Q              +L +  +  LI   L  QE ++ G
Sbjct: 49  RVNGEEVPSKEVEREVQRYVAQYQQYGMEVSPEEEQKLREQVLDVLIGRLLLLQEAKRMG 108

Query: 95  ITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFML 154
           ++ D   V+    Q+   +G S E F + L + G  +  F++ L+   +   VV      
Sbjct: 109 LSVDQAQVDAQIEQYKLQSG-SEETFKNILAQAGYTEEEFREELSRAFLLQQVVDEKVTK 167

Query: 155 KYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRI---KDAEESRLR 211
                + E  A   +      +   IR     I      ++   +       + +E   +
Sbjct: 168 HLSVSDEEARAYYDENPEQFEQPEQIRARHILIRLAPDASKEEEEAAYAKIHEVQEKLNQ 227

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYI 270
                   + ++      + G   +  +  + P F+        N  ++   T+ G+  I
Sbjct: 228 GADFAELAKTYSEGPSAPNGGDLGFFGKGQMVPAFEEAAFALEVNQVSDVVRTEYGLHLI 287

Query: 271 AICDKRDLG--GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHYY 317
            + D+++ G      +K  L       K  +     V++L+  A I  Y
Sbjct: 288 QVTDRQEAGKASFEEVKDQLKEMLLQQKSSEAINALVEELKGKAEIEIY 336


>gi|148262225|ref|YP_001228931.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter
           uraniireducens Rf4]
 gi|146395725|gb|ABQ24358.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter
           uraniireducens Rf4]
          Length = 345

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 52/327 (15%), Positives = 108/327 (33%), Gaps = 18/327 (5%)

Query: 6   FTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL 65
           ++ +S  +       V+I   ++P+ +     + S I   +N ++IT  ++ +  AL+  
Sbjct: 19  YSWISQTMSTFVKTIVIIAIALLPLTA--RAELVSGIAAIVNDDIITTYEVDRDAALIGK 76

Query: 66  QKIN---------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLS 116
           +              L K A+  LI + L +Q+I++  I      V        +   L+
Sbjct: 77  EMEKRAPAEAADKAALRKTALSRLIDKKLIEQKIKELDIRVPEEEVRQSIEDVKKQNKLT 136

Query: 117 AEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVR 176
            E   + L  QG+  + +K  L  Q     ++  +   K    E E+       +     
Sbjct: 137 QEALVAALAAQGLSFDQYKAQLKEQLERLRLMSQEVRAKIQVGEREMREYYDANRAKYGE 196

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQ---KRIKDAEESRLRLPKDCNKLEKFASKIHD-VSIG 232
           E   R        +K   +  +        +  +            +K++         G
Sbjct: 197 EEFTRARQIYFKIDKKAAESEITRVTAAAANVLQEAKSGKDFAELAKKYSDDPAAAKDGG 256

Query: 233 KAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICD--KRDLGGEIALKAYLS 289
           +       D+ P+ +           ++   T  G+  I + +  K        +KA + 
Sbjct: 257 ELGTFKRGDMIPEIERALDTMKPGEISDLVRTPAGIHIIKLEERTKGKAKPFEEVKAEIE 316

Query: 290 AQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                 K E    ++V  LR  A I  
Sbjct: 317 DFLYKKKSEDRFNQWVNDLRKGAAIEI 343


>gi|190572865|ref|YP_001970710.1| putative survival protein SurA [Stenotrophomonas maltophilia K279a]
 gi|190010787|emb|CAQ44396.1| putative survival protein SurA precursor [Stenotrophomonas
           maltophilia K279a]
          Length = 447

 Score =  137 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/321 (11%), Positives = 101/321 (31%), Gaps = 22/321 (6%)

Query: 13  IKLLTTYFVLIIFCIVPIVS-----YKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK 67
           +       +  +  +  + +      +      RI   ++ +VI   ++ + IA +K Q 
Sbjct: 1   MTKRFPVLLASLLAVSSVSAPLQVLAQEAQPLDRIAAVVDEDVILQSELQRAIANIKAQY 60

Query: 68  --------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAED 119
                       L +  ++ L++  L+    + SGI      +N      A+  G + + 
Sbjct: 61  AGRENQLPPEDVLSRQVLERLVLVKLQVARAQGSGIRVSDQELNQAMNSIAQQNGSNLDA 120

Query: 120 FSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYL 179
               L   GI  N F+  +  +     + ++    +    E E+ A  ++   +  + +L
Sbjct: 121 LRQRLAHDGIDFNDFRASVRDEITVQRLRQSFAQSRISVSEGEVDAALKQQATVGNQYHL 180

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKIHDVSIGKAQYLL 238
              ++              QK+    +    +          +++   + +  G   +  
Sbjct: 181 AHILVALPDGANADQIATGQKKADGVKALLDKGELDFNAAAVRYSDSPNALEGGDLGWRS 240

Query: 239 ESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDL-------GGEIALKAYLSA 290
             ++   F  ++ K        P     G + + + + RD                ++  
Sbjct: 241 LDEIPQAFAQMMEKMKPGEVVGPIRGPSGFQLLKLVEVRDASATAGASTVTEYHGRHILV 300

Query: 291 QNTPTKIEKHEAEYVKKLRSN 311
           +    + +      +  LR+ 
Sbjct: 301 RVDDHQTDAAAKAKIDTLRAR 321



 Score = 84.7 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 44/156 (28%), Gaps = 5/156 (3%)

Query: 162 EIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK 221
           E+          TV EY  R +L     +  Q     + +I                 ++
Sbjct: 277 EVRDASATAGASTVTEYHGRHILV--RVDDHQTDAAAKAKIDTLRARIAGGADFETVAKE 334

Query: 222 FASKI-HDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLG 279
            +         G   +       P F Q +        + P+ T  G   +     R   
Sbjct: 335 SSEDNNSKGQGGDLGWFPADAFGPAFGQQVAAIQDGGVSQPFRTDAGWHILQRVATRQTD 394

Query: 280 GEIAL-KAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
                 +A +       K+E     ++++LR  A +
Sbjct: 395 VTNDNQRAQVRETIGRRKLEDEYNRFLQELRGEAYV 430


>gi|300114054|ref|YP_003760629.1| peptidylprolyl isomerase [Nitrosococcus watsonii C-113]
 gi|299539991|gb|ADJ28308.1| Peptidylprolyl isomerase [Nitrosococcus watsonii C-113]
          Length = 426

 Score =  137 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 40/312 (12%), Positives = 106/312 (33%), Gaps = 17/312 (5%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING----- 70
           +    V I+     + S+ + +   RI   +N +++ + ++ + +  ++ Q         
Sbjct: 1   MGKVLVAIVVLFWTMGSFATMS-LDRIVAVVNEDIVLESELEQMVRTVQDQLAAQGTSLP 59

Query: 71  ---ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
               LE+  ++ L++E L+ Q   ++GI     T+N    + A+N GL+   F + L++ 
Sbjct: 60  PGYVLERQVLERLVMEQLQLQLAARTGIQVGDETLNEALGRIAQNNGLTLSQFRNVLEQD 119

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI 187
           G    +F++ +  + I   + K +   +    + EI       K    ++         I
Sbjct: 120 GYDFPNFRENIRKELIISQLHKREVNDRVSVSKAEIDNFLATQKKHGNQDAQYHLAHILI 179

Query: 188 PDNKLQNQGFV---QKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
              +  +   V   + + +   +              ++     +  G   +     L  
Sbjct: 180 TVPEAASPEQVQGAKAKAEQVLQQLREGTDFQKVAVTYSDGQQALEGGDLGWRKVGQLPT 239

Query: 245 QF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEK 299
            F   + +      +    +  G   + + + R              ++  +      E+
Sbjct: 240 LFVDVVPQLQVGEISKLIRSPSGFHIVKLLEYRGEGGQQLVTQTQARHILLRADELASEQ 299

Query: 300 HEAEYVKKLRSN 311
                + +LR  
Sbjct: 300 EVQLRLSQLRQR 311



 Score = 99.0 bits (244), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 35/284 (12%), Positives = 87/284 (30%), Gaps = 18/284 (6%)

Query: 46  INGEV-ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           +N  V ++  +I   +A            + A   L    +   E         +     
Sbjct: 144 VNDRVSVSKAEIDNFLA-----TQKKHGNQDAQYHLAHILITVPEAASPEQVQGAKAKAE 198

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP 164
             +Q  R      +   ++ D Q   +     +  +  +    V     L+ G +   I 
Sbjct: 199 QVLQQLREGTDFQKVAVTYSDGQQALEGGDLGWRKVGQLPTLFVDVVPQLQVGEISKLIR 258

Query: 165 ANKQKMKNITVREY---------LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKD 215
           +         +              +     +  ++L ++  VQ R+    +  L     
Sbjct: 259 SPSGFHIVKLLEYRGEGGQQLVTQTQARHILLRADELASEQEVQLRLSQLRQRILSGDDF 318

Query: 216 CNKLEKFASK-IHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAIC 273
               +  +      +  G   ++    + P+F+  ++       + P+ TQ G   + + 
Sbjct: 319 SELAQAHSDDKASALKGGDLGWVSPGQMIPRFEEAMRSLEPGEISEPFKTQFGWHVVQVL 378

Query: 274 DKRDLGGEIA-LKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           D+R         +     +    K+E+    ++++LR  A + Y
Sbjct: 379 DRRQENVTEEFNRNRAKTEIHQRKVEEELENWLRQLRDEAYVEY 422


>gi|113461696|ref|YP_719765.1| peptidyl-prolyl cis-trans isomerase, PPIC-type [Haemophilus somnus
           129PT]
 gi|112823739|gb|ABI25828.1| peptidyl-prolyl cis-trans isomerase, PPIC-type [Haemophilus somnus
           129PT]
          Length = 314

 Score =  137 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 52/311 (16%), Positives = 112/311 (36%), Gaps = 16/311 (5%)

Query: 20  FVLIIFCIVPIVSYK-SWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQ 78
           F  ++F I+ ++S   +   + R+  T++G  I +  +     +L  +  N E  +IA+ 
Sbjct: 6   FKAVLFSIIGLLSITITAQAAERVVATVDGNPILESQVK---KVLGKRANNEENRQIALN 62

Query: 79  ELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYL 138
            +I + L ++ I++ GI      V+      A   GL+   F   LD QGI    ++Q +
Sbjct: 63  SIIDDLLVQKAIQELGIKVAPAHVDSVIENIAAQNGLTFGQFLDVLDYQGINYQAYRQQI 122

Query: 139 AIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVRE---------YLIRTVLFSIPD 189
           A Q +  +V              EI     K+     ++               +    +
Sbjct: 123 AYQILISEVRNQAIGSSVNVTREEIQDLGLKLFKQAKKQGKEKKVTAPEYNVRHILLKLN 182

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQY-LLESDLHPQFQ 247
             L +     K  +   +         +   K++         G   +   E+ +    +
Sbjct: 183 PLLNDAQAKAKLTQIRADILANKITFADAALKYSKDYLSGADGGSLGFMFPEAYVPEFAK 242

Query: 248 NLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-AYLSAQNTPTKIEKHEAEYVK 306
            +    +   + P+ T+ G   + + D R+              Q    ++++   +++K
Sbjct: 243 VIRASKKGVISTPFKTEFGWHILEVTDIRNADITREAYMQEAYQQIVNQQLQEASGDWIK 302

Query: 307 KLRSNAIIHYY 317
            LR  A I Y+
Sbjct: 303 ALRKRAHIQYF 313


>gi|152978410|ref|YP_001344039.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Actinobacillus
           succinogenes 130Z]
 gi|150840133|gb|ABR74104.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Actinobacillus
           succinogenes 130Z]
          Length = 317

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 46/312 (14%), Positives = 103/312 (33%), Gaps = 15/312 (4%)

Query: 17  TTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIA 76
                L    +  I S        ++  T+NGE I +  + + +     +       ++A
Sbjct: 6   LKAIALAAMGLFVISSGAQAVKVEQVVATVNGEPILESQLQRVM---GKRANTESNRRVA 62

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           V ++I + L ++ +++SG+  +   VN      A   GL+       LD QGI  + FK 
Sbjct: 63  VDKIIDDMLVQKAVKESGVKVNPAQVNQIVHNIADQNGLTYGQLLDALDYQGISLSQFKA 122

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVR---------EYLIRTVLFSI 187
            ++ Q +  +V              ++    +KM                      +   
Sbjct: 123 NISNQILMAEVRNRSIGKGVDVSREQVEELSRKMLQQAKAGGNPKAITATQYKARHILLK 182

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQY-LLESDLHPQ 245
               L +     +  +   + +          + ++       + G   +   E+ +   
Sbjct: 183 LTPLLNDAQAKAQLTQIRADIQSGKTTFAEAAKNYSKDYLSGANGGDLGFAFPENYVPEF 242

Query: 246 FQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKHEAEY 304
            + +    Q   + P+ T+ G   + + D R                    ++ ++  ++
Sbjct: 243 AKMMTTAKQGVISAPFKTEFGWHILEVTDTRQGDITDVAYRQKAYETLVNEQLREYSKDW 302

Query: 305 VKKLRSNAIIHY 316
           VK LR +A I Y
Sbjct: 303 VKALRKHAEIKY 314


>gi|253995959|ref|YP_003048023.1| SurA domain-containing protein [Methylotenera mobilis JLW8]
 gi|253982638|gb|ACT47496.1| SurA domain protein [Methylotenera mobilis JLW8]
          Length = 434

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 50/319 (15%), Positives = 108/319 (33%), Gaps = 18/319 (5%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI 68
           L +F K+  + F+ + F  +  ++        RI   ++  VIT+ ++  RI  L  Q  
Sbjct: 2   LRNFSKI--SLFIALSFSQLNCLAAADVTKMDRIVAIVDQSVITEQELESRIVSLSAQLK 59

Query: 69  NG--------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
                      L K  ++ LI + L+ Q   ++GI  D   ++    + A    ++  +F
Sbjct: 60  KQGTELPEASILRKQILERLISDALQLQYAAQTGIKVDDMQLDKTIERIAEQNKMTVREF 119

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180
              L++ GI    F+  +  +     + + +   +    E EI        +    +   
Sbjct: 120 YDALNQDGISVRKFRSDIRNEITIARLREREVESRVNVSESEIDNYLTTQASTNQNQDEY 179

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE---KFASKIHDVSIGKAQYL 237
                 I   +      VQK     +E    L    +  +    F+   + +  G   + 
Sbjct: 180 EISHILIRVPEDAATEDVQKAKTKVDEIFAALASGTSFAKVSASFSDAPNALEGGNIGWK 239

Query: 238 LESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQN 292
             + +   F   L    +   +    +  G   + + DKR     L  E     ++  + 
Sbjct: 240 QGAQMPALFLDALKAMQKGEVSAALRSPNGFHILKLTDKRGGSSPLIIEQTHARHILIKL 299

Query: 293 TPTKIEKHEAEYVKKLRSN 311
           +    EK     +  ++  
Sbjct: 300 SEVMSEKDAKTKMDGIKER 318



 Score = 93.2 bits (229), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 18/140 (12%), Positives = 52/140 (37%), Gaps = 2/140 (1%)

Query: 178 YLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYL 237
                    I  +++ ++   + ++   +E      K      +F+      + G   ++
Sbjct: 288 EQTHARHILIKLSEVMSEKDAKTKMDGIKERLDNGEKFEVLARQFSEDGTASNGGDLGWV 347

Query: 238 LESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPT 295
              D  PQF+  +     N  + P ++  G   I + +++     + A +     +    
Sbjct: 348 NPGDTVPQFEKAMNSLQPNEISAPVLSPFGWHVIQVLERKKQDMSKEAARLKARQEIRAR 407

Query: 296 KIEKHEAEYVKKLRSNAIIH 315
           K ++   +++++LR  A + 
Sbjct: 408 KADEAYQDWIRELRDRAFVE 427


>gi|88810558|ref|ZP_01125815.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Nitrococcus mobilis
           Nb-231]
 gi|88792188|gb|EAR23298.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Nitrococcus mobilis
           Nb-231]
          Length = 430

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 42/320 (13%), Positives = 105/320 (32%), Gaps = 18/320 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYK---SWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN 69
           +K      ++ +  +V I +     +  +  RI   +N  V+   ++ + + +++ Q   
Sbjct: 1   MKTRVRSLIIFLALVVFIEAQTPLLAAQVLDRIVAVVNDSVVLQSELKEELIIVRQQLQR 60

Query: 70  G--------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFS 121
                     L+   +++LI++ L+     ++GI+ D  T++    + A    ++   F 
Sbjct: 61  QDMQLPDPRNLQHQVLEQLILKKLQLDAASRTGISVDDATLDAAVRRVAEQNQMTLSQFR 120

Query: 122 SFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIR 181
             L  + IG   F+  L  Q I   +       +      EI     + +     EY + 
Sbjct: 121 DALAAEAIGWEDFRDKLRDQIIISRLRHQVMQSRINVTPQEIAQFVAQQRGGQSAEYHLG 180

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEE-SRLRLPKDCNKLEKFASKIHDVSIGKAQYLLES 240
            +L ++PD          +   +       +          ++     +  G   +  + 
Sbjct: 181 HILVALPDAASPQTIAQARDKAERIHRQLEQEASFETLAASYSDSQTALQGGDLGWRKQG 240

Query: 241 DLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKI-- 297
           +L     + +        T    +  G     +  +R+    I  + +       T    
Sbjct: 241 ELPTLIAELISGLPVGKVTPVLRSPSGFHIFKLLARREGERHIITQTHARHILIETNAVV 300

Query: 298 -EKHEAEYVKKLRSNAIIHY 316
            ++     ++ LR    I  
Sbjct: 301 SDRDARRRLESLRKR--IEN 318



 Score = 86.7 bits (212), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 15/139 (10%), Positives = 47/139 (33%), Gaps = 3/139 (2%)

Query: 179 LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFAS-KIHDVSIGKAQYL 237
                   I  N + +    ++R++   +            +  +         G   ++
Sbjct: 286 QTHARHILIETNAVVSDRDARRRLESLRKRIENGDSFAALAKAHSDDSTSAFQGGDLGWV 345

Query: 238 LESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIA-LKAYLSAQNTPT 295
               +   F+ ++     +  + P+ T+ G   + + ++R      A  +   + Q    
Sbjct: 346 DPGRMVATFEQVMDSLQPDEISQPFHTRYGWHIVQVLNRRKQDTTEAYRREQAAQQIQNR 405

Query: 296 KIEKHEAEYVKKLRSNAII 314
           K++     ++++LR  A +
Sbjct: 406 KLQDETQLWLRQLREEAYV 424


>gi|170718609|ref|YP_001783810.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Haemophilus somnus
           2336]
 gi|168826738|gb|ACA32109.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Haemophilus somnus
           2336]
          Length = 321

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 53/318 (16%), Positives = 115/318 (36%), Gaps = 17/318 (5%)

Query: 14  KLLTTY-FVLIIFCIVPIVSYK-SWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE 71
           K +  + F  ++F I+ ++S   +   + R+  T++G  I +  +     +L  +  N E
Sbjct: 6   KKMKVFNFKAVLFSIIGLLSITITAQAAERVVATVDGNPILESQVK---KVLGKRANNEE 62

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
             +IA+  +I + L ++ I++ GI      V+      A   GL+   F   LD QGI  
Sbjct: 63  NRQIALNSIIDDLLVQKAIQELGIKVAPAHVDSVIENIAAQNGLTFGQFLDVLDYQGINY 122

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVRE---------YLIRT 182
             ++Q +A Q +  +V              EI     K+     ++              
Sbjct: 123 QAYRQQIAYQILISEVRNQAIGSSVNVTREEIQDLGLKLFKQAKKQGKEKKVTAPEYNVR 182

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQY-LLES 240
            +    +  L +     K  +   +         +   K++         G   +   E+
Sbjct: 183 HILLKLNPLLNDAQAKAKLTQIRADILANKITFADAALKYSKDYLSGADGGSLGFMFPEA 242

Query: 241 DLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-AYLSAQNTPTKIEK 299
            +    + +    +   + P+ T+ G   + + D R+              Q    ++++
Sbjct: 243 YVPEFAKVIRTSKKGVISTPFKTEFGWHILEVTDIRNADITREAYMQEAYQQIVNQQLQE 302

Query: 300 HEAEYVKKLRSNAIIHYY 317
              +++K LR  A I Y+
Sbjct: 303 ASGDWIKALRKRAHIQYF 320


>gi|260773615|ref|ZP_05882531.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio metschnikovii CIP
           69.14]
 gi|260612754|gb|EEX37957.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio metschnikovii CIP
           69.14]
          Length = 431

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 41/313 (13%), Positives = 107/313 (34%), Gaps = 12/313 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +KL T     +   +             R+   +N  VI   DI   +  ++      + 
Sbjct: 1   MKLWTLALYTLTSLVSIATVQAQPVELDRVAVIVNSGVILQSDIDSALLTVRANAKTNQQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LIV+TL++QE ++ G+  D NT+N    + A N   + E     +
Sbjct: 61  TLPPENILREQIIEKLIVDTLQQQEADRIGVRIDDNTLNDAITEIAHNNQQTPEQLRLSI 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            +QG+    F++ +  +    +        +   +  E+    + +   T      +   
Sbjct: 121 AEQGLTYPEFREQIRKEIAASEARNALVRRRINIIPAEVDTLAELLAQETSATVQYKISH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +  N  Q++  V+ +         +          ++     +  G   ++ + ++  
Sbjct: 181 IQLRFNDGQDKSEVEAQANKLVAELNQGADFSTMAITYSKGPRALQGGDWGWMRKEEMPT 240

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F +    +++ +   P+ +  G   + I D +    +        ++  + T    ++ 
Sbjct: 241 IFADQIKMQNKGSIIGPFRSGVGFHILKIDDIKGLETVAVTEVNARHILIKPTIILSDEG 300

Query: 301 EAEYVKKLRSNAI 313
               +  L     
Sbjct: 301 AKNQLNDLVRRIN 313



 Score = 78.6 bits (191), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 18/140 (12%), Positives = 49/140 (35%), Gaps = 3/140 (2%)

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLL 238
               +   P   L ++G   +                   ++++         G+  Y  
Sbjct: 284 NARHILIKPTIILSDEGAKNQLNDLVRRINAGEASFAELAQQYSQDPGSAAQNGELGYQT 343

Query: 239 ESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTK 296
                P+F++ ++       + P+ T  G   + + D+R++   + A+K          K
Sbjct: 344 PELYVPEFKHQIETLPVGTISEPFKTVHGWHIVEVLDRREVDRTDAAMKNRAYRILFNRK 403

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
             +  + ++++LR+ A +  
Sbjct: 404 FNEEASTWLQELRAGAFVEI 423


>gi|121997812|ref|YP_001002599.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Halorhodospira
           halophila SL1]
 gi|121589217|gb|ABM61797.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Halorhodospira
           halophila SL1]
          Length = 427

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 40/313 (12%), Positives = 101/313 (32%), Gaps = 14/313 (4%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ-------- 66
           +    F+     +  + +  +     RI    + EV+   ++ + I  ++ Q        
Sbjct: 1   MKIRAFLCAATLLAGLPTLAASETLDRIVAVADQEVVLASELDQEIEQIRAQFFQRGQQP 60

Query: 67  KINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDK 126
               +L +  ++ L+++ L+    + +GI  D  T++    + A    ++       L +
Sbjct: 61  PPADQLREQVLERLVMQRLQMGHAQGAGIQVDDATLDAAMQRIAAQNNMTLAQLRDALAQ 120

Query: 127 QGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
           +G+    F++ L  Q     + +     +      EI    +        EY +  +   
Sbjct: 121 EGMDMASFREDLREQITVERLQQAVVQQEVEVSPQEIEEAVEAAAAQDNMEYRVAHIRIG 180

Query: 187 IPDNKLQN--QGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
            P+    +  +   ++  +  E++           E F+        GK  + L   L  
Sbjct: 181 TPEGASSDDLRAAGERAGQIREQAVDGESDFATLAETFSDAATASEGGKIGWRLPGQLPS 240

Query: 245 QFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLG---GEIALKAYLSAQNTPTKIEKH 300
            F +++        + P     G   + + D+R       E     ++  +      E  
Sbjct: 241 AFADVVDGLEPGEISEPVQAADGFHIVKLIDRRSEDAQIVEETRARHILLRPGDGVEEDD 300

Query: 301 EAEYVKKLRSNAI 313
             + +   R    
Sbjct: 301 VRQRLDSFRERID 313



 Score = 98.6 bits (243), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 20/148 (13%), Positives = 50/148 (33%), Gaps = 3/148 (2%)

Query: 172 NITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-S 230
                    R     +       +  V++R+    E             +++ +     S
Sbjct: 275 EDAQIVEETRARHILLRPGDGVEEDDVRQRLDSFRERIDEGESFEFLARQYSEEPGAEAS 334

Query: 231 IGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-L 288
            G   +     L   FQ  + +      + P+ T+ G   + + D+R+       +   +
Sbjct: 335 GGDIGWTRSGQLVASFQERMDELEVGEVSEPFRTEYGWHIVRVEDRRERDVTDDRRRERI 394

Query: 289 SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           + Q    K ++   +++++LR  A + Y
Sbjct: 395 AQQIHERKSQEALEQWLRQLREEAYVDY 422


>gi|262198047|ref|YP_003269256.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Haliangium ochraceum
           DSM 14365]
 gi|262081394|gb|ACY17363.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Haliangium ochraceum
           DSM 14365]
          Length = 349

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 43/293 (14%), Positives = 103/293 (35%), Gaps = 18/293 (6%)

Query: 40  SRIRTTINGEVITDGDISKRIALLKL-----------QKINGELEKIAVQELIVETLKKQ 88
            R+   +N  VI   ++  R+A L              +   +L    + E+I E L  Q
Sbjct: 53  DRVAAVVNDSVILTSELDARLAPLTAGLANINDERERARRGEQLRSQQLDEMISEELVVQ 112

Query: 89  EIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVV 148
           E  KS +  D   V+    +  +  GL     ++ L +QG     +++ +  Q +    +
Sbjct: 113 EARKSKLNVDDKEVSAALAEIKQQNGLDDTQLAAALAQQGYSMQAYRKEVERQLLHRRAI 172

Query: 149 KNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKD---A 205
                 +    + ++      M   +     +R     +      +   + +        
Sbjct: 173 NMLVRPRVTVTDEDVRVRYDTMSRRSAAVSKVRLKHALLSLPPNPSNELLAEAKSKAAAI 232

Query: 206 EESRLRLPKDCNKLEKFASKIH-DVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVT 263
            E+        ++  +++  I+   S G   ++    +  +++ +     +     P   
Sbjct: 233 VEAVRGGASFDDQARQYSDDINTRDSGGDLGWIERGSIATEWEVIVFSMEEGEVRGPVSG 292

Query: 264 QKGVEYIAICD--KRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
             G+    + +  K DL    A+K  L ++    +++K    ++++LR  A I
Sbjct: 293 PGGLHVFYVEELAKSDLEEFDAVKEQLQSEIYREEMDKEITAWLQELRDKAFI 345


>gi|94499974|ref|ZP_01306509.1| Parvulin-like peptidyl-prolyl isomerase [Oceanobacter sp. RED65]
 gi|94427832|gb|EAT12807.1| Parvulin-like peptidyl-prolyl isomerase [Oceanobacter sp. RED65]
          Length = 436

 Score =  136 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 53/323 (16%), Positives = 120/323 (37%), Gaps = 14/323 (4%)

Query: 2   TSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIA 61
            +K  +  +  I+ +T   +L IF  V +           I   ++  +I + ++ +RI 
Sbjct: 3   MTKDKSMTTSIIQQITKTALLGIFA-VSLPLQAQIQTIDSIAAVVDDGIIMESELEQRID 61

Query: 62  LLKLQKI------NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGL 115
            +K Q        +  L+   ++ LI+E L+ Q  E+SG+      +N   +  A+  GL
Sbjct: 62  TIKRQSQGMRLPPDDILQDQVLERLIIENLQLQMAERSGMRISDEQLNQTIINIAKQNGL 121

Query: 116 SAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITV 175
           +  +F   L+K G+     ++ +  + I  +V +     K    E ++      ++  + 
Sbjct: 122 TLREFKKALEKDGVSYAQAREQIRRERIISEVQRYRVGSKINISEQDVDNFLNSVRGKSA 181

Query: 176 REYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIG 232
                R     I      ++  +++    AE+   +L    +        +   + +  G
Sbjct: 182 TAEEYRLGHILIQVPSQASRAQLKRAQNKAEDIVKKLRNGADFQQMAISQSEGRNALKGG 241

Query: 233 KAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYL 288
              +  E++L   F +++    +   +NP  +  G   I I DKR             ++
Sbjct: 242 DLGWRKEAELPTLFADIVPDLKKGQVSNPIRSASGYHIIKISDKRGGDTQMVRQTKARHI 301

Query: 289 SAQNTPTKIEKHEAEYVKKLRSN 311
             Q    +  +   + +  L   
Sbjct: 302 LIQENEIRNSQQAKKLINDLYKK 324



 Score = 89.0 bits (218), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 20/146 (13%), Positives = 56/146 (38%), Gaps = 3/146 (2%)

Query: 173 ITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSI 231
            T      +     I +N+++N    +K I D  +            ++++      +S 
Sbjct: 289 DTQMVRQTKARHILIQENEIRNSQQAKKLINDLYKKLKNGADFDELAKEYSDDPGSKLSG 348

Query: 232 GKAQYLLESDLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLS 289
           G   ++ + D+ P F+  +    +   + P+ ++ G   + + D R     E   +    
Sbjct: 349 GDLGWVNQGDMVPAFEQTMNATKKGQISEPFKSRFGWHVLQVTDYRQKDVGEEIQRNQAR 408

Query: 290 AQNTPTKIEKHEAEYVKKLRSNAIIH 315
                 + E+    +++++R++A + 
Sbjct: 409 QLLYSRRFEEELPIWLRQIRADAYVE 434


>gi|86148121|ref|ZP_01066421.1| parvulin-like peptidyl-prolyl isomerase [Vibrio sp. MED222]
 gi|218708410|ref|YP_002416031.1| putative parvulin-like peptidyl-prolyl isomerase [Vibrio splendidus
           LGP32]
 gi|85834108|gb|EAQ52266.1| parvulin-like peptidyl-prolyl isomerase [Vibrio sp. MED222]
 gi|218321429|emb|CAV17381.1| putative Parvulin-like peptidyl-prolyl isomerase [Vibrio splendidus
           LGP32]
          Length = 431

 Score =  136 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 38/311 (12%), Positives = 108/311 (34%), Gaps = 12/311 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--- 69
           + L     + I        SY +      ++  +N  VI   DI   +  L+        
Sbjct: 1   MTLWKRTLIAIAAACTLSTSYAAPVELDSVKVIVNEGVILQSDIDTSMKTLRANAKKSGQ 60

Query: 70  -----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++T++ QE E+ G+  D   ++      A++   + +  ++ +
Sbjct: 61  TLPSQDVLNEQVLEKLIIDTIQTQEAERIGVRIDDARLDQAIEGIAKDNNQTVQQLTASV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            ++G+  N F++ +  +    +        +   L  E+      +   T      +   
Sbjct: 121 AEEGLSYNAFREQVRKEIAASEARNALVRRRINILPAEVDNLADILAQETNATVQYKIGH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +  N  Q +  ++ +  D  E              ++     +  G   ++ + ++  
Sbjct: 181 IQLRFNDDQTKEELEAQATDLVEELNNGKDFSTMAYTYSKGPKALQGGDWGWMRKEEMPT 240

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F +    +++ +   P+ +  G   + I D +    +        ++  + T    +  
Sbjct: 241 IFADQIKMQNKGSIIGPFRSGVGFHILKIEDVKGLETVAVTEVNARHILIKPTVILSDDG 300

Query: 301 EAEYVKKLRSN 311
             E ++++   
Sbjct: 301 AKEQLEEITRR 311



 Score = 80.5 bits (196), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 33/276 (11%), Positives = 89/276 (32%), Gaps = 14/276 (5%)

Query: 44  TTING-EVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTV 102
             ++    I   + +  +            +    +EL  +     E   +G  F +   
Sbjct: 157 AEVDNLADILAQETNATVQYKIGHIQLRFNDDQTKEELEAQATDLVEELNNGKDFSTMAY 216

Query: 103 NYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEME 162
            Y     A   G    D+     ++       +  +  +       ++        +E  
Sbjct: 217 TYSKGPKALQGG----DWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIEDV 272

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
                  +  +  R  LI+  +    D   +    + +R+   E          +  +++
Sbjct: 273 KGLETVAVTEVNARHILIKPTVILSDDGAKEQLEEITRRVNAGEA------SFGDLAQQY 326

Query: 223 ASKI-HDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLG- 279
           +      V  G+  Y       P+F++ ++   +   + P+ T  G   + + D+R++  
Sbjct: 327 SQDPGSAVQDGELGYQTPDLYVPEFKHQVETLPEGKISAPFKTVHGWHIVEVLDRREVDR 386

Query: 280 GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            + ALK          K  +    +++++R++A + 
Sbjct: 387 TDSALKNKAYQILFNRKFNEEVGAWLQEVRASAFVE 422


>gi|194364448|ref|YP_002027058.1| SurA domain [Stenotrophomonas maltophilia R551-3]
 gi|194347252|gb|ACF50375.1| SurA domain [Stenotrophomonas maltophilia R551-3]
          Length = 447

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 37/321 (11%), Positives = 101/321 (31%), Gaps = 22/321 (6%)

Query: 13  IKLLTTYFVLIIFCIVPIVS-----YKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK 67
           +       +  +  +  + +      +      RI   ++ +VI   ++ + IA +K Q 
Sbjct: 1   MTKRFPVLLASLLAVSSVSAPLQVLAQEAQPLDRIAAVVDEDVILQSELQRAIANIKAQY 60

Query: 68  --------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAED 119
                       L +  ++ L++  L+    + SGI      +N      A+  G + + 
Sbjct: 61  VGRENQLPPEDVLSRQVLERLVLVKLQVARAQGSGIRVGDQELNQAMNAIAQQNGSTLDA 120

Query: 120 FSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYL 179
               L   GI  N F+  +  +     + ++    +    E E+ A  ++   +  + +L
Sbjct: 121 LRQRLAHDGIDFNDFRASVRDEITVQRLRQSFAQSRISVSEGEVDAALKQQATVGNQYHL 180

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKIHDVSIGKAQYLL 238
              ++              QK+    +    +          +++   + +  G   +  
Sbjct: 181 AHILIAVPDGANADQIATGQKKADGVKALLDKGELDFNAAAVRYSDSPNALEGGDLGWRS 240

Query: 239 ESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDL-------GGEIALKAYLSA 290
             ++   F  ++ K        P     G + + + + RD                ++  
Sbjct: 241 LDEIPQAFAQMMEKMKAGEVVGPIRGPSGFQLLKLVEVRDASAAAGANTVTEYHGRHILV 300

Query: 291 QNTPTKIEKHEAEYVKKLRSN 311
           +    + +      +  LR+ 
Sbjct: 301 RVDDHQTDAAAKAKIDTLRAR 321



 Score = 85.5 bits (209), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 24/155 (15%), Positives = 41/155 (26%), Gaps = 3/155 (1%)

Query: 162 EIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK 221
           E+          TV EY  R +L    D+   +     K                   E 
Sbjct: 277 EVRDASAAAGANTVTEYHGRHIL-VRVDDHQTDAAAKAKIDTLRARIAGGADFQTVAKES 335

Query: 222 FASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG 280
                     G   +       P F Q +        + P+ T  G   +     R    
Sbjct: 336 SEDSNSKGQGGDLGWFPADAFGPAFGQQVAGIQDGGVSQPFRTDAGWHILQRVATRQTDV 395

Query: 281 EIAL-KAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
                +A +       K+E     ++++LR  A +
Sbjct: 396 TNDNQRAQVRETIGRRKLEDEYNRFLQELRGEAYV 430


>gi|319639633|ref|ZP_07994380.1| peptidyl-prolyl cis-trans isomerase [Neisseria mucosa C102]
 gi|317399204|gb|EFV79878.1| peptidyl-prolyl cis-trans isomerase [Neisseria mucosa C102]
          Length = 329

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 36/284 (12%), Positives = 85/284 (29%), Gaps = 17/284 (5%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKL------QKINGELEKIAVQELIVETLKKQEIEK 92
           S  I   ++ EVIT   + + +A  +       Q    EL +  + ++I ++L  Q  ++
Sbjct: 52  SDGIAAVVDNEVITHRQVEQAVAQARQTMPKGTQMDANELRQQVLAQMINQSLILQAGKR 111

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
             I    + +      +      SA       D          + +  Q+I      +  
Sbjct: 112 RNIQATDSEIEAVIAHNPNIKNPSAAVRQDIADS------IIVEKVRQQAIMQ---NSRV 162

Query: 153 MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRL 212
                   +E    +                   I  +        +  I+         
Sbjct: 163 SDSEVARYIEQAKQQGITLPEADPVRQYHAQHILIKADNDNAAVGAESTIRKIYSQARSG 222

Query: 213 PKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIA 271
                   +++      + G   +  +  +   F+  + K      + P  TQ G   I 
Sbjct: 223 ADFGGLARQYSQDSSAGNGGDLGWFADGMMVAPFEEAVHKLKPGQISAPVRTQFGWHIIK 282

Query: 272 ICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
           + D R+    E   +  +    +  K ++     +++L S++ +
Sbjct: 283 LNDVREAGTPEERQQNAVRQYLSQQKAQQATTNLLRELHSSSYV 326


>gi|122070665|sp|Q9I5U3|SURA_PSEAE RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
          Length = 417

 Score =  135 bits (340), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 42/304 (13%), Positives = 108/304 (35%), Gaps = 15/304 (4%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL--------QKINGELEKIA 76
             ++   ++       R+   ++ +VI    + +R+  +                L +  
Sbjct: 3   AALLCSFAHAEVVPLDRVVAIVDNDVIMQSQLDQRLREVHQTLLKRGAPLPPEHVLTQQV 62

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           ++ LI+E +++Q  ++SGI      +N      A+  G+S E F + L + G+     ++
Sbjct: 63  LERLIIENIQQQIGDRSGIRISDEELNQAMGTIAQRNGMSLEQFQTALTRDGLSYADARE 122

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQG 196
            +  + +   V +     +    E E+                 R     IP  +  +  
Sbjct: 123 QVRREMVISRVRQRRVAERIQVSEQEVKNFLASDMGKIQLSEEYRLANILIPVPEAASSD 182

Query: 197 FVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK- 252
            +Q   + A+E   +L +  +        ++  + +  G+  +   + L   F +++   
Sbjct: 183 VIQAAARQAQELYQQLKQGADFGQLAISRSAGDNALEGGEIGWRKAAQLPQPFDSMIGSL 242

Query: 253 SQNNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEYVKKLR 309
           +  + T P  T  G   + + +KR       +     ++  + +  + E    +  +KL 
Sbjct: 243 AVGDVTEPVRTPGGFIILKLEEKRGGSKMVRDEVHVRHILLKPSEIRSEAETEKLAQKLY 302

Query: 310 SNAI 313
               
Sbjct: 303 ERIQ 306



 Score = 92.0 bits (226), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 15/139 (10%), Positives = 49/139 (35%), Gaps = 3/139 (2%)

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLE 239
                 +  ++++++   +K  +   E            + F+      ++ G   ++  
Sbjct: 277 HVRHILLKPSEIRSEAETEKLAQKLYERIQSGEDFGELAKSFSEDPGSALNGGDLNWIDP 336

Query: 240 SDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKI 297
             L P+F+  +    Q   + P+ +Q G   + +  +R        +     +     K 
Sbjct: 337 EALVPEFRQVMNDTPQGELSKPFRSQFGWHILQVLGRRATDSSEKFREQQAVSVLRNRKY 396

Query: 298 EKHEAEYVKKLRSNAIIHY 316
           ++    +++++R  A +  
Sbjct: 397 DEELQAWLRQIRDEAYVEI 415


>gi|299133711|ref|ZP_07026905.1| SurA domain protein [Afipia sp. 1NLS2]
 gi|298591547|gb|EFI51748.1| SurA domain protein [Afipia sp. 1NLS2]
          Length = 314

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 59/283 (20%), Positives = 111/283 (39%), Gaps = 1/283 (0%)

Query: 35  SWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSG 94
             A +  +   +NGE IT  DI +R  L+ L        +  + +LI + LK +E +K G
Sbjct: 29  PSARAQAVVVMVNGEPITTYDIEQRAKLIALTTHKSAPRQEVINQLIDDRLKIKEAKKFG 88

Query: 95  ITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFML 154
           I    + ++  +    +  G+SA+  S  L  QG+     K  ++  + W  +V+  +  
Sbjct: 89  INMTPSEIDSSYAAMGQRMGMSADQLSKVLMAQGVRPETMKLRMSADTAWGALVRGRYKQ 148

Query: 155 KYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
                E ++ A      +    E     +   +      +   V ++ K   E      +
Sbjct: 149 SLMVSEHDVRAASGGDSSPQDTESYEYHLRPVVIFVPRGSSSAVVEQRKKEAEIIRDRVQ 208

Query: 215 DCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAIC 273
            C +       +   +I        +DL    + LL K+   + T P VT++G+E + +C
Sbjct: 209 SCAEAATTFKSLRQGTIRDTIIKTSADLPANLRELLDKTPVGHMTPPEVTRQGIEMVVLC 268

Query: 274 DKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           D++    +   K     +    K E     Y+  LR  A+I Y
Sbjct: 269 DRKVTSADTPAKRAARDKLFAQKYEAKSKSYLDDLRKAAMIEY 311


>gi|269960923|ref|ZP_06175293.1| survival protein SurA [Vibrio harveyi 1DA3]
 gi|269834363|gb|EEZ88452.1| survival protein SurA [Vibrio harveyi 1DA3]
          Length = 427

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 38/311 (12%), Positives = 114/311 (36%), Gaps = 16/311 (5%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE---- 71
           +  +  L+   ++      +     ++   +N  VI   DI+  +  L+           
Sbjct: 1   MKIWKSLLFTTLLSCGVTAAPVELDKVAVIVNDGVILQSDINTAMKTLQANARQSGKSLP 60

Query: 72  ----LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
               L+   V++LI++TL+ QE E+ G+  D N +N    + ARN   S E  ++ +  +
Sbjct: 61  SASVLKDQVVEKLIIDTLQGQEAERIGVRIDDNRLNQAIAEIARNNNQSVEQLAASVQAE 120

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI 187
           G+    F++ +  +    +        +   L  E+ +   ++   T      +     +
Sbjct: 121 GLSYPEFREQIRKEIAASEARNALVRRRINILPAEVDSLADQLATETNATVQYKIGHIQL 180

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
             +  +++  V+       +              ++     +  G   ++ + ++   F 
Sbjct: 181 RFSDDKDKSEVEAEANALVKKLKDGADFSEMAYTYSKGPKALQGGDWGWMRKEEMPTIFA 240

Query: 248 NL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQ----NTPTKIEK 299
           +    +++ +   P+ +  G   + + D +    +        ++  +     +    +K
Sbjct: 241 DQIKMQNKGSIIGPFRSGIGFHILKVEDVKGLETVAVTEVNARHILIKPTVILSDEGAQK 300

Query: 300 HEAEYVKKLRS 310
              E+++++++
Sbjct: 301 ELNEFIRRIKA 311



 Score = 80.1 bits (195), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 17/142 (11%), Positives = 47/142 (33%), Gaps = 4/142 (2%)

Query: 178 YLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQY 236
              R +L              +   +     +           +++         G+  Y
Sbjct: 280 VNARHILIKPTVILSDEGAQKE-LNEFIRRIKAGEATFAQLATQYSQDPGSAAQNGELGY 338

Query: 237 LLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTP 294
                  P+F++ ++     + + P+ T  G   + + D+R +   + A+K         
Sbjct: 339 QTPDLYVPEFKHQVETLPVGSISEPFKTVHGWHIVEVLDRRQVDRTDSAMKNKAYRILFN 398

Query: 295 TKIEKHEAEYVKKLRSNAIIHY 316
            K  +    ++++LR++A +  
Sbjct: 399 RKFNEEAGAWMQELRASAFVEI 420


>gi|28897112|ref|NP_796717.1| survival protein SurA [Vibrio parahaemolyticus RIMD 2210633]
 gi|153838965|ref|ZP_01991632.1| chaperone SurA [Vibrio parahaemolyticus AQ3810]
 gi|260361686|ref|ZP_05774713.1| chaperone protein SurA [Vibrio parahaemolyticus K5030]
 gi|260896920|ref|ZP_05905416.1| chaperone protein SurA [Vibrio parahaemolyticus Peru-466]
 gi|260903392|ref|ZP_05911787.1| chaperone protein SurA [Vibrio parahaemolyticus AQ4037]
 gi|81728608|sp|Q87ST4|SURA_VIBPA RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|28805321|dbj|BAC58601.1| survival protein SurA [Vibrio parahaemolyticus RIMD 2210633]
 gi|149747553|gb|EDM58485.1| chaperone SurA [Vibrio parahaemolyticus AQ3810]
 gi|308088746|gb|EFO38441.1| chaperone protein SurA [Vibrio parahaemolyticus Peru-466]
 gi|308109029|gb|EFO46569.1| chaperone protein SurA [Vibrio parahaemolyticus AQ4037]
 gi|308115514|gb|EFO53054.1| chaperone protein SurA [Vibrio parahaemolyticus K5030]
 gi|328471910|gb|EGF42787.1| survival protein SurA [Vibrio parahaemolyticus 10329]
          Length = 427

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 38/310 (12%), Positives = 113/310 (36%), Gaps = 12/310 (3%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING----- 70
           +  +  ++   ++   +  +     ++   +N  VI   DI+  +  L+           
Sbjct: 1   MKIWKSILFTTLLSCGAVAAPVELDKVAVIVNDGVILQSDINTAMKTLQANARQSGKSLP 60

Query: 71  ---ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
               L++  V++LI++TL+ QE ++ G+  D N +N    + ARN   S E+ ++ +  +
Sbjct: 61  SASVLKEQVVEKLIIDTLQGQEADRIGVRIDDNRLNQAIAEIARNNNQSVEELAASVQAE 120

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI 187
           G+    F++ +  +    +        +   L  E+ +   ++   T      +     +
Sbjct: 121 GLSYPEFREQIRKEIAASEARNALVRRRINILPAEVDSLADQLAKETNATVQYKIGHIQL 180

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
                Q++  V+ + K   +              ++     +  G   ++ + ++   F 
Sbjct: 181 RFTDGQDKSEVEAQAKALVKKLNDGADFTEMAYTYSKGPKALQGGDWGWMRKEEMPTIFA 240

Query: 248 NL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKHEAE 303
           +    +++ +   P+ +  G   + I D +    +        ++  + T    ++   +
Sbjct: 241 DQIKMQNKGSIIGPFRSGVGFHILKIEDVKGLETVAVTEVNARHILIKPTVILSDEGAKK 300

Query: 304 YVKKLRSNAI 313
            + +      
Sbjct: 301 QLNEFVRRIK 310



 Score = 80.5 bits (196), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/270 (10%), Positives = 77/270 (28%), Gaps = 4/270 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++      L  +       KI   +L     + +   ++        +N       
Sbjct: 151 ILPAEVDSLADQLAKETNATVQYKIGHIQLRFTDGQDKSEVEAQAKALVKKLNDGADFTE 210

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +        +   I   +   
Sbjct: 211 MAYTYSKGPKALQGGDWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIEDVK 270

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK-LEKFASKI-HD 228
              TV    +      I    + +    +K++ +             +   +++      
Sbjct: 271 GLETVAVTEVNARHILIKPTVILSDEGAKKQLNEFVRRIKAGEATFAQLASQYSQDPGSA 330

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ ++     + + P+ T  G   + + D+R +   + A+K 
Sbjct: 331 AQDGELGYQTPDLYVPEFKHQVETLPVGSISEPFKTVHGWHIVEVLDRRQVDRTDSAMKN 390

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                    K  +    ++++LR++A +  
Sbjct: 391 KAYRILFNRKFNEEAGAWMQELRASAFVEI 420


>gi|77165200|ref|YP_343725.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Nitrosococcus oceani
           ATCC 19707]
 gi|254434050|ref|ZP_05047558.1| SurA N-terminal domain family [Nitrosococcus oceani AFC27]
 gi|122070652|sp|Q3JAF1|SURA_NITOC RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|76883514|gb|ABA58195.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Nitrosococcus oceani
           ATCC 19707]
 gi|207090383|gb|EDZ67654.1| SurA N-terminal domain family [Nitrosococcus oceani AFC27]
          Length = 426

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 46/309 (14%), Positives = 108/309 (34%), Gaps = 17/309 (5%)

Query: 19  YFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING-------- 70
             V I     PI S+ +     RI   +N +++ + ++ + +  ++ Q            
Sbjct: 4   VLVTIFVLFWPIGSFAAI-NLDRIVAVVNEDIVLESELEQMVRTVQDQLAAQGTSLPPGY 62

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
            LE+  ++ L++E L+ Q   ++GI     T+N    + A++ GL+   F + L++ G  
Sbjct: 63  VLERQVLERLVMEQLQLQLAARTGIQVGDETLNEALGRIAQDNGLTLSQFRNVLEQDGYD 122

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
              F++ +  + I   + K +   +    + EI       K    ++         I   
Sbjct: 123 FPAFRENIRKELIISQLHKREVNDRVSVSKAEIDNFLTNQKKRGNQDAQYHLAHILITVP 182

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQF- 246
           +  +   VQ     AE+   +L +  +       ++     +  G   +     L   F 
Sbjct: 183 EAASPEQVQAAKAKAEQVLQQLREGADFQKVAVTYSDGQQALEGGDLGWRKMGQLPTLFV 242

Query: 247 QNLLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKHEA 302
             + +    + +    +  G   + + D R              ++  +      E+   
Sbjct: 243 DVVPQLQAGDISKLIRSPSGFHIVKLLDYRGEGQQQLVTQTQARHILLRADELASEREVQ 302

Query: 303 EYVKKLRSN 311
             + +LR  
Sbjct: 303 LRLSQLRQR 311



 Score = 98.6 bits (243), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 34/280 (12%), Positives = 85/280 (30%), Gaps = 10/280 (3%)

Query: 46  INGEV-ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           +N  V ++  +I   +   K +        +A   LI         +       +  V  
Sbjct: 144 VNDRVSVSKAEIDNFLTNQKKRGNQDAQYHLA-HILITVPEAASPEQVQAAKAKAEQVLQ 202

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQS---IWPDVVKNDFMLKYGNLE- 160
              + A    ++          +G      K          + P +   D      +   
Sbjct: 203 QLREGADFQKVAVTYSDGQQALEGGDLGWRKMGQLPTLFVDVVPQLQAGDISKLIRSPSG 262

Query: 161 -MEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKL 219
              +     + +         +     +  ++L ++  VQ R+    +  L         
Sbjct: 263 FHIVKLLDYRGEGQQQLVTQTQARHILLRADELASEREVQLRLSQLRQRILSGDDFSELA 322

Query: 220 EKFASK-IHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRD 277
           +  +      +  G   ++    + P+F+  ++       + P+ TQ G   + + D+R 
Sbjct: 323 QAHSDDKASALKGGDLGWVSPGQMIPRFEEAMRSLEPGEISEPFKTQFGWHVVQVLDRRQ 382

Query: 278 LG-GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
               E   +     +    K+E+    ++++LR  A + Y
Sbjct: 383 ENMTEEFNRNRAKMEIRQRKVEEELENWLRQLRDEAYVEY 422


>gi|320157503|ref|YP_004189882.1| survival protein SurA (Peptidyl-prolyl cis-trans isomerase SurA)
           [Vibrio vulnificus MO6-24/O]
 gi|319932815|gb|ADV87679.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase SurA) [Vibrio vulnificus MO6-24/O]
          Length = 432

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 40/312 (12%), Positives = 115/312 (36%), Gaps = 16/312 (5%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN----- 69
            +  +  L++  +V   +  +     ++   +N  VI   DI      L+          
Sbjct: 4   KMNIWKTLLLGMLVTGSAVSAPVELDKVAVIVNDGVILQSDIDTATKTLRANAKKSGQAL 63

Query: 70  ---GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDK 126
                L +  V +LI++TL+ QE ++ G+  D   +N    + ARN   + ++ S+ +  
Sbjct: 64  PDADVLNEQIVDKLIIDTLQTQEADRIGVRIDDTRLNQAIEEIARNNNQTIDELSAAIAS 123

Query: 127 QGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
           +G+    F++ +  +    +        +   L  E+    + +   T      R     
Sbjct: 124 EGVSYAEFREQIRKEMAASEARNALVRRRINILPAEVDNLAELLSKETNASVEYRIGHIQ 183

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           +     Q++  ++ + K+  E   +          ++     +  G   ++ + ++   F
Sbjct: 184 LRFTDGQDKSALEAQAKELVEKLKQGADFSTMAYTYSKGPKALQGGDWGWMRKEEMPTIF 243

Query: 247 QNL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQ----NTPTKIE 298
            +    +++ +   P+ +  G   + I D +    +        ++  +     +    +
Sbjct: 244 ADQIKMQNKGSIIGPFRSGVGFHILKIEDVKGLETVAVTEVNARHILLKPTVILSDEGAQ 303

Query: 299 KHEAEYVKKLRS 310
           +   E+++++R+
Sbjct: 304 RELNEFIRRIRA 315



 Score = 78.9 bits (192), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 27/270 (10%), Positives = 75/270 (27%), Gaps = 4/270 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     LL  +       +I   +L     + +   ++        +        
Sbjct: 155 ILPAEVDNLAELLSKETNASVEYRIGHIQLRFTDGQDKSALEAQAKELVEKLKQGADFST 214

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +        +   I   +   
Sbjct: 215 MAYTYSKGPKALQGGDWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIEDVK 274

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDC-NKLEKFASKI-HD 228
              TV    +      +    + +    Q+ + +                ++++      
Sbjct: 275 GLETVAVTEVNARHILLKPTVILSDEGAQRELNEFIRRIRAGEATFGELAQQYSQDPGSA 334

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ ++       + P+ T  G   + + D+R++   + A+K 
Sbjct: 335 AQDGELGYQTPDLYVPEFKHQVETLPVGTISEPFKTVHGWHIVEVLDRREVDRTDSAMKN 394

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                    K  +    ++++LR+ A +  
Sbjct: 395 KAYRILFNRKFNEEVGAWMQELRAGAFVEI 424


>gi|153820172|ref|ZP_01972839.1| survival protein SurA [Vibrio cholerae NCTC 8457]
 gi|126509282|gb|EAZ71876.1| survival protein SurA [Vibrio cholerae NCTC 8457]
          Length = 393

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 35/313 (11%), Positives = 108/313 (34%), Gaps = 12/313 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +KL     + ++  +    ++        +   +N  VI   D+   +  +K      + 
Sbjct: 1   MKLWKPTLISVLSALTLFNAHAEPKQLDSVAVIVNSGVILQSDVDSALKTIKANAKQNKQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++TL++QE ++ G+  D N +N    + A+N   + E   + +
Sbjct: 61  PLPQETVLREQVLEKLIIDTLQQQEADRIGVKIDDNRLNEAIKEIAKNNQQTQEQLIASV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            ++G+    F++ +  +    D        +   L  E+    + +   T      +   
Sbjct: 121 AQEGLTYPEFREQVRKEMAASDARNALVRRRINILPAEVDTLAELLAQETDATVQYKISH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +  +  Q++   +                      ++     +  G   ++ + ++  
Sbjct: 181 IQLRVDDGQDKSTAETLANKLVNDLRNGADFAQMAYAYSKGPKALQGGDWGWMRKEEMPT 240

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F +    +++ +   P+ +  G   + I D +    +        ++  + T    ++ 
Sbjct: 241 IFADQIKMQNKGSIIGPFRSGVGFHILKIDDVKGLETVAVTEVNARHILIKPTIILSDEG 300

Query: 301 EAEYVKKLRSNAI 313
             + + +      
Sbjct: 301 AQKQLNEFVQRIK 313



 Score = 57.4 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/232 (11%), Positives = 65/232 (28%), Gaps = 3/232 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     LL  +       KI+  +L V+  + +   ++      N +        
Sbjct: 154 ILPAEVDTLAELLAQETDATVQYKISHIQLRVDDGQDKSTAETLANKLVNDLRNGADFAQ 213

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +        +   I       
Sbjct: 214 MAYAYSKGPKALQGGDWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIDDVK 273

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKI-HD 228
              TV    +      I    + +    QK++ +  +             ++++      
Sbjct: 274 GLETVAVTEVNARHILIKPTIILSDEGAQKQLNEFVQRIKNGEVTFAELAQQYSQDPGSA 333

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG 279
              G+  Y       P+F++ ++       + P+ T  G   + + D+R++ 
Sbjct: 334 AQKGELGYQTPDLYVPEFKHQIETLPVGQISEPFKTVHGWHIVEVLDRREVD 385


>gi|326423746|ref|NP_759646.2| survival protein SurA [Vibrio vulnificus CMCP6]
 gi|121956501|sp|Q8DED4|SURA_VIBVU RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|319999108|gb|AAO09173.2| Survival protein surA precursor (Peptidyl-prolyl cis-trans
           isomerase surA) [Vibrio vulnificus CMCP6]
          Length = 428

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 40/311 (12%), Positives = 115/311 (36%), Gaps = 16/311 (5%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN------ 69
           +  +  L++  +V   +  +     ++   +N  VI   DI      L+           
Sbjct: 1   MNIWKTLLLGMLVTGSAVSAPVELDKVAVIVNDGVILQSDIDTATKTLRANAKKSGQALP 60

Query: 70  --GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
               L +  V +LI++TL+ QE ++ G+  D   +N    + ARN   + ++ S+ +  +
Sbjct: 61  DADVLNEQIVDKLIIDTLQTQEADRIGVRIDDTRLNQAIEEIARNNNQTIDELSAAIASE 120

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI 187
           G+    F++ +  +    +        +   L  E+    + +   T      R     +
Sbjct: 121 GVSYAEFREQIRKEMAASEARNALVRRRINILPAEVDNLAELLSKETNASVEYRIGHIQL 180

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
                Q++  ++ + K+  E   +          ++     +  G   ++ + ++   F 
Sbjct: 181 RFTDGQDKSALEAQAKELVEKLKQGADFSTMAYTYSKGPKALQGGDWGWMRKEEMPTIFA 240

Query: 248 NL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQ----NTPTKIEK 299
           +    +++ +   P+ +  G   + I D +    +        ++  +     +    ++
Sbjct: 241 DQIKMQNKGSIIGPFRSGVGFHILKIEDVKGLETVAVTEVNARHILLKPTVILSDEGAQR 300

Query: 300 HEAEYVKKLRS 310
              E+++++R+
Sbjct: 301 ELNEFIRRIRA 311



 Score = 79.3 bits (193), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 27/270 (10%), Positives = 75/270 (27%), Gaps = 4/270 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     LL  +       +I   +L     + +   ++        +        
Sbjct: 151 ILPAEVDNLAELLSKETNASVEYRIGHIQLRFTDGQDKSALEAQAKELVEKLKQGADFST 210

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +        +   I   +   
Sbjct: 211 MAYTYSKGPKALQGGDWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIEDVK 270

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDC-NKLEKFASKI-HD 228
              TV    +      +    + +    Q+ + +                ++++      
Sbjct: 271 GLETVAVTEVNARHILLKPTVILSDEGAQRELNEFIRRIRAGEATFGELAQQYSQDPGSA 330

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ ++       + P+ T  G   + + D+R++   + A+K 
Sbjct: 331 AQDGELGYQTPDLYVPEFKHQVETLPVGTISEPFKTVHGWHIVEVLDRREVDRTDSAMKN 390

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                    K  +    ++++LR+ A +  
Sbjct: 391 KAYRILFNRKFNEEVGAWMQELRAGAFVEI 420


>gi|163802667|ref|ZP_02196558.1| 4-hydroxythreonine-4-phosphate dehydrogenase [Vibrio sp. AND4]
 gi|159173555|gb|EDP58375.1| 4-hydroxythreonine-4-phosphate dehydrogenase [Vibrio sp. AND4]
          Length = 427

 Score =  135 bits (339), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 40/310 (12%), Positives = 111/310 (35%), Gaps = 12/310 (3%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE---- 71
           +  +  LI+  ++      + A   ++   +N  VI   DI   +  L+           
Sbjct: 1   MKIWKSLIVTTLLSCGVTAAPAELDKVAVIVNDGVILQSDIDTAMKTLQANARQSGKSLP 60

Query: 72  ----LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
               L++  V++LI++TL+ QE ++ G+  D N +N    + ARN   S E  ++ +  +
Sbjct: 61  SAGVLKEQVVEKLIIDTLQGQEAKRIGVRIDDNRLNQAIAEIARNNNQSVEQLAASVQME 120

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI 187
           G+  + F++ +  +    +        +   L  E+ +   ++   T      +     +
Sbjct: 121 GLNYSEFREQIRKEIAASEARNALVRRRINILPAEVDSLTDQLAQETNATVQYKIGHIQL 180

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
             +  +++  V+       +              ++     +  G   ++ + ++   F 
Sbjct: 181 RFSDDKDKSEVEAEANALVKKLKAGADFSEMAYTYSKGPKALQGGDWGWMRKEEMPTIFA 240

Query: 248 NL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKHEAE 303
           +    +++ N   P+ +  G   + I D +    +        ++  + T    +    +
Sbjct: 241 DQIKMQNKGNIIGPFRSGIGFHILKIEDVKGLETVAVTEVNARHILIKPTVILSDDGAKK 300

Query: 304 YVKKLRSNAI 313
            + +      
Sbjct: 301 ELNEFIRRIK 310



 Score = 78.6 bits (191), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 17/140 (12%), Positives = 50/140 (35%), Gaps = 3/140 (2%)

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLL 238
               +   P   L + G  ++  +     +           +++         G+  +  
Sbjct: 281 NARHILIKPTVILSDDGAKKELNEFIRRIKAGEASFGQLATQYSQDPGSAAQNGELGFQT 340

Query: 239 ESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTK 296
                P+F++ ++     + + P+ T  G   + + D+R +   + A+K          K
Sbjct: 341 PDLYVPEFKHQVETLPVGSISEPFKTVHGWHIVEVLDRRQVDRTDSAIKNKAYRILFNRK 400

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
             +    ++++LR++A +  
Sbjct: 401 FNEEAGAWMQELRASAFVEI 420


>gi|121956507|sp|Q7MP84|SURA_VIBVY RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
          Length = 428

 Score =  135 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 40/311 (12%), Positives = 115/311 (36%), Gaps = 16/311 (5%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN------ 69
           +  +  L++  +V   +  +     ++   +N  VI   DI      L+           
Sbjct: 1   MNIWKTLLLGMLVTGSAVSAPVELDKVAVIVNDGVILQSDIDTATKTLRANAKKSGQALP 60

Query: 70  --GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
               L +  V +LI++TL+ QE ++ G+  D   +N    + ARN   + ++ S+ +  +
Sbjct: 61  DADVLNEQIVDKLIIDTLQTQEADRIGVRIDDTRLNQAIEEIARNNNQTIDELSAAIASE 120

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI 187
           G+    F++ +  +    +        +   L  E+    + +   T      R     +
Sbjct: 121 GVSYEEFREQIRKEMAASEARNALVRRRINILPAEVDNLAELLSKETNASVEYRIGHIQL 180

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
                Q++  ++ + K+  E   +          ++     +  G   ++ + ++   F 
Sbjct: 181 RFTDGQDKSALEAQAKELVEKLKQGADFSTMAYTYSKGPKALQGGDWGWMRKEEMPTIFA 240

Query: 248 NL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQ----NTPTKIEK 299
           +    +++ +   P+ +  G   + I D +    +        ++  +     +    ++
Sbjct: 241 DQIKMQNKGSIIGPFRSGVGFHILKIEDVKGLETVAVTEVNARHILLKPTVILSDEGAQR 300

Query: 300 HEAEYVKKLRS 310
              E+++++R+
Sbjct: 301 ELNEFIRRIRA 311



 Score = 78.9 bits (192), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 27/270 (10%), Positives = 75/270 (27%), Gaps = 4/270 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     LL  +       +I   +L     + +   ++        +        
Sbjct: 151 ILPAEVDNLAELLSKETNASVEYRIGHIQLRFTDGQDKSALEAQAKELVEKLKQGADFST 210

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +        +   I   +   
Sbjct: 211 MAYTYSKGPKALQGGDWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIEDVK 270

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDC-NKLEKFASKI-HD 228
              TV    +      +    + +    Q+ + +                ++++      
Sbjct: 271 GLETVAVTEVNARHILLKPTVILSDEGAQRELNEFIRRIRAGEATFGELAQQYSQDPGSA 330

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ ++       + P+ T  G   + + D+R++   + A+K 
Sbjct: 331 AQDGELGYQTPDLYVPEFKHQVETLPVGTISEPFKTVHGWHIVEVLDRREVDRTDSAMKN 390

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                    K  +    ++++LR+ A +  
Sbjct: 391 KAYRILFNRKFNEEVGAWMQELRAGAFVEI 420


>gi|260878025|ref|ZP_05890380.1| chaperone protein SurA [Vibrio parahaemolyticus AN-5034]
 gi|308089886|gb|EFO39581.1| chaperone protein SurA [Vibrio parahaemolyticus AN-5034]
          Length = 427

 Score =  135 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/310 (12%), Positives = 112/310 (36%), Gaps = 12/310 (3%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING----- 70
           +  +  ++   ++   +  +     ++   +N  VI   DI+  +  L+           
Sbjct: 1   MKIWKSILFTTLLSCGAVAAPVELDKVAVIVNDGVILQSDINTAMKTLQANARQSGKSLP 60

Query: 71  ---ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
               L++  V++LI++TL+ QE ++ G+  D N +N    + ARN   S E+ ++ +  +
Sbjct: 61  SASVLKEQVVEKLIIDTLQGQEADRIGVRIDDNRLNQAIAEIARNNNQSVEELAASVQAE 120

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI 187
           G+    F++ +  +    +        +   L  E+ +   ++   T      +     +
Sbjct: 121 GLSYPEFREQIRKEIAASEARNALVRRRINILPAEVDSLADQLAKETNATVQYKIGHIQL 180

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
                Q++  V+ + K   +              ++     +  G   ++ + ++   F 
Sbjct: 181 RFTDGQDKSEVEAQAKALVKKLNDGADFTEMAYTYSKGPKALQGGDWGWMRKEEMPTIFA 240

Query: 248 NL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKHEAE 303
           +    +++ +   P+ +  G   + I D +    +        ++  + T    ++    
Sbjct: 241 DQIKMQNKGSIIGPFRSGVGFHILKIEDVKGLETVAVTEVNARHILIKPTVILSDEGAKN 300

Query: 304 YVKKLRSNAI 313
            + +      
Sbjct: 301 QLNEFVRRIK 310



 Score = 79.7 bits (194), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 18/140 (12%), Positives = 50/140 (35%), Gaps = 3/140 (2%)

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLL 238
               +   P   L ++G   +  +     +           +++         G+  Y  
Sbjct: 281 NARHILIKPTVILSDEGAKNQLNEFVRRIKAGEATFAQLASQYSQDPGSAAQDGELGYQT 340

Query: 239 ESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTK 296
                P+F++ ++     + + P+ T  G   + + D+R +   + A+K          K
Sbjct: 341 PDLYVPEFKHQVETLPVGSISEPFKTVHGWHIVEVLDRRQVDRTDSAMKNKAYRILFNRK 400

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
             +    ++++LR++A +  
Sbjct: 401 FNEEAGAWMQELRASAFVEI 420


>gi|253698853|ref|YP_003020042.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter sp. M21]
 gi|251773703|gb|ACT16284.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter sp. M21]
          Length = 317

 Score =  135 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 42/295 (14%), Positives = 92/295 (31%), Gaps = 13/295 (4%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN------GELEKIAVQELIVETLKK 87
            +    S I   +N E+IT  ++ K    ++ +           L   A+  L+   L +
Sbjct: 21  STAKPVSGIAAIVNDEIITTLELDKEYLQIQKEADKVPASDKSGLRGAALNRLVERKLIE 80

Query: 88  QEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDV 147
           Q+I +  I      V        +   L+ E+    L  QG+    ++  L  Q     +
Sbjct: 81  QKIRELNINVSDEEVRLAIEDVKKQNNLTQENLEQALATQGMTFAQYRIQLKEQLERLRL 140

Query: 148 VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQ---NQGFVQKRIKD 204
           +  +   K    E E+    Q          +          +K          + R  +
Sbjct: 141 MSQEVRSKVQVGEREMREYYQANIAAYGGSEVFSARHIFFKVDKKGGAGELSKAEARANE 200

Query: 205 AEESRLRLPKDCNKLEKFASKIHD-VSIGKAQYLLESDL-HPQFQNLLKKSQNNTTNPYV 262
                          ++++         G      ++D+       +        ++   
Sbjct: 201 VLAKARAGEDFAALAKQYSDDPAAAKDGGDLGTFKKADMLPEIGDTVAAMQPGEVSSVVR 260

Query: 263 TQKGVEYIAICDKRD--LGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           +  G+  I +  K+         +K  +       K ++  A++VK+LR++A I 
Sbjct: 261 SPSGLHIIKLEGKKQDAGRPFEEVKDSIEDTLYKKKSDERFAQWVKELRASAAIE 315


>gi|220935878|ref|YP_002514777.1| SurA domain protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997188|gb|ACL73790.1| SurA domain protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 443

 Score =  135 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 50/315 (15%), Positives = 103/315 (32%), Gaps = 18/315 (5%)

Query: 15  LLTTYFVLIIFCIVPIVSYKS---WAMSSRIRTTINGEVITDGDISKRIALLKLQK---- 67
            L +   L +    P+         A    I   +  +VI   ++  R+  ++ Q     
Sbjct: 9   FLLSAMALTLALAWPLQGLAQRADDAPLDHIVALVEDDVIMHSELQNRLDTVRQQILSRG 68

Query: 68  ----INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSF 123
                +  L    ++ LI+E L+ Q+  ++GI  D  T+N    + AR   +S  +F   
Sbjct: 69  GRLPPDDVLIPQVLERLIIERLQLQQATRAGIRIDDITLNQTMERIARENSMSLPEFRDR 128

Query: 124 LDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTV 183
           L   GI    F++ +  +     + +     +    E EI            R+   R  
Sbjct: 129 LVADGIDFQVFREQIRDEMTIGQLRRRQVENRIQVSEQEIDDLIASESGAIDRDVEYRLS 188

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLR---LPKDCNKLEKFASKIHDVSIGKAQYLLES 240
              +P  +  N   +Q   + AE  R R              ++    +  G   +   +
Sbjct: 189 HILVPLPEGANAADIQAARERAEAIRKRAVAGENFSELALSESAGQQALEGGDLGWRAAA 248

Query: 241 DLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRD---LGGEIALKAYLSAQNTPTK 296
            +   F   +    +   +    +  G   I + ++R             ++  Q T   
Sbjct: 249 QVPTLFARNVVLMREGEVSELIRSPSGFHLIKLQERRGGERAQITQTHARHILIQPTAIL 308

Query: 297 IEKHEAEYVKKLRSN 311
            ++   E +  LR+ 
Sbjct: 309 SQEDARERIAGLRNR 323



 Score = 75.5 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 36/282 (12%), Positives = 87/282 (30%), Gaps = 17/282 (6%)

Query: 46  INGEV-ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           +   + +++ +I   IA       +G +++     L    +   E   +     +     
Sbjct: 157 VENRIQVSEQEIDDLIA-----SESGAIDRDVEYRLSHILVPLPEGANAADIQAARERAE 211

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP 164
              + A      +E   S    Q   +     + A   +     +N  +++ G +   I 
Sbjct: 212 AIRKRAVAGENFSELALSESAGQQALEGGDLGWRAAAQVPTLFARNVVLMREGEVSELIR 271

Query: 165 ANKQKMKNITVREY--------LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDC 216
           +                             I    + +Q   ++RI       L      
Sbjct: 272 SPSGFHLIKLQERRGGERAQITQTHARHILIQPTAILSQEDARERIAGLRNRILMGNDFA 331

Query: 217 NKLEKFASK-IHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICD 274
           +     +      +  G   +    DL PQF+ ++   + N  + P+++  G   + + D
Sbjct: 332 DLARAHSDDRGSAMRGGDLGWTDPGDLVPQFEEVMNALAPNTLSEPFLSPFGWHIVEVLD 391

Query: 275 KRD-LGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           +R        ++A         K E+    ++++LR  A + 
Sbjct: 392 RRTYDSSRQLMRAQAREIIRERKREEETELWLRRLRDEAYVE 433


>gi|254229741|ref|ZP_04923149.1| ppic-type ppiase domain protein [Vibrio sp. Ex25]
 gi|262392437|ref|YP_003284291.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio sp. Ex25]
 gi|151937708|gb|EDN56558.1| ppic-type ppiase domain protein [Vibrio sp. Ex25]
 gi|262336031|gb|ACY49826.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio sp. Ex25]
          Length = 427

 Score =  135 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 37/310 (11%), Positives = 112/310 (36%), Gaps = 12/310 (3%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE---- 71
           +  +  ++   ++   +  +     ++   +N  VI   DI   +  L+           
Sbjct: 1   MKIWKSILFTTLLSCGAVAAPVEIDKVAVIVNDGVILQSDIETAMKTLQANARQSGKSLP 60

Query: 72  ----LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
               L++  V++LI++TL+ QE ++ G+  D N +N    + ARN   S E  ++ ++ +
Sbjct: 61  SASVLKEQVVEKLIIDTLQGQEADRIGVRIDDNRLNQAIAEIARNNEQSVEQLAASVESE 120

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI 187
           G+    F++ +  +    +        +   L  E+ +  +++   T      +     +
Sbjct: 121 GLSYPEFREQIRKEIAASEARNALVRRRINILPAEVDSLAEQLSQETNATVQYKIGHIQL 180

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
             +  + +  V+   K   +              ++     +  G   ++ + ++   F 
Sbjct: 181 RFSDDKEKSAVEAEAKALAKKLNEGADFTEMAYTYSKGPKALQGGDWGWMRKEEMPTIFA 240

Query: 248 NL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKHEAE 303
           +    +++ +   P+ +  G   + I D +    +        ++  + T    ++   +
Sbjct: 241 DQIKMQNKGSIIGPFRSGVGFHILKIEDVKGLETVAVTEVNARHILIKPTVILSDEGAKK 300

Query: 304 YVKKLRSNAI 313
            + +      
Sbjct: 301 QLNEFVRRIK 310



 Score = 78.9 bits (192), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 30/270 (11%), Positives = 79/270 (29%), Gaps = 4/270 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++      L  +       KI   +L     K++   ++     +  +N       
Sbjct: 151 ILPAEVDSLAEQLSQETNATVQYKIGHIQLRFSDDKEKSAVEAEAKALAKKLNEGADFTE 210

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +        +   I   +   
Sbjct: 211 MAYTYSKGPKALQGGDWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIEDVK 270

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK-LEKFASKI-HD 228
              TV    +      I    + +    +K++ +             +   +++      
Sbjct: 271 GLETVAVTEVNARHILIKPTVILSDEGAKKQLNEFVRRIKAGEATFAQLATQYSQDPGSA 330

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ ++     + + P+ T  G   + + D+R +   + A+K 
Sbjct: 331 AQDGELGYQTPDLYVPEFKHQVETLPVGSISEPFKTVHGWHIVEVLDRRQVDRTDSAMKN 390

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                    K  +    ++++LR++A +  
Sbjct: 391 KAYRILFNRKFNEEAGAWMQELRASAFVEI 420


>gi|116748015|ref|YP_844702.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Syntrophobacter
           fumaroxidans MPOB]
 gi|116697079|gb|ABK16267.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Syntrophobacter
           fumaroxidans MPOB]
          Length = 353

 Score =  135 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/291 (13%), Positives = 92/291 (31%), Gaps = 17/291 (5%)

Query: 43  RTTINGEVITDGDISKRIALLKLQK----------INGELEKIAVQELIVETLKKQEIEK 92
              +NG VIT  +        + Q              E++K  +  L+   + KQ+  K
Sbjct: 61  VAVVNGTVITRAEYESETKRFERQMAMSGQAPDGAQVAEMKKKVLDGLVGREVLKQQAAK 120

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
            G+  D   V+       +      E   +  +   + +   K           ++    
Sbjct: 121 LGVKVDPAEVDKEIATLKQRFPNEDEFKKALKNLN-LTEESLKAQFTQDLGIRKMIDEQV 179

Query: 153 MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNK---LQNQGFVQKRIKDAEESR 209
             K      E          +     ++R     I  +      ++   ++RI  A++  
Sbjct: 180 ASKITITPEETKKFYDGNPELFKTPEMVRASHVLIKVDPKAGDADKAKAKERITAAQKKV 239

Query: 210 LRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVE 268
                     ++ +        G   +     +   F+         + ++   TQ G  
Sbjct: 240 QAGEDFAKVAKEVSECPSAAKGGDLDFFQRGQMVGPFEQAAFALKVGSVSDIVETQFGYH 299

Query: 269 YIAICDKRDLGG--EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHYY 317
            I + DK++ G      +K  ++      ++ +  A+Y+++L++ A I  +
Sbjct: 300 VIKVTDKKEAGVMKYDEIKDRIAQHLKQDRVNQQLAKYIEELKAQAKIEIF 350


>gi|254447632|ref|ZP_05061098.1| chaperone SurA [gamma proteobacterium HTCC5015]
 gi|198262975|gb|EDY87254.1| chaperone SurA [gamma proteobacterium HTCC5015]
          Length = 442

 Score =  135 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 32/313 (10%), Positives = 106/313 (33%), Gaps = 14/313 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI---- 68
           +  +    +++ F     ++     + +RI   ++ ++I + ++   ++ +K +      
Sbjct: 1   MMTMIARLLILFFLFATPLAQAEPQVLARIAAVVDTDIILEQEMLDELSRVKARIQASGQ 60

Query: 69  ----NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
               +  L++  ++ LIV+ ++ Q  ++ GI  D   +N    + A   G+S   F + +
Sbjct: 61  TPPPDEILKRQVLEHLIVKEVQMQAADRVGINVDDTFLNEQLQRIASENGMSLAQFKAKI 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
           + +G+    +++ L  +     + +     +    E E+     +    +         +
Sbjct: 121 ESEGMDYVEYREMLREEMKIQQLRQRTVYDRVVVSEQEVDDYLAQNPVGSESVEYQLGHI 180

Query: 185 FSIPDNKL--QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDL 242
                     +     +K   +  E   +  +        +     +  G   +L +  +
Sbjct: 181 LVGTPEAATPEQVDTARKEADNLYEQIKQGARFSQLALSHSDGQRALDGGDLGWLPQGRV 240

Query: 243 HPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLG---GEIALKAYLSAQNTPTKIE 298
              F + +    +   + P  +  G   + +   R       +     ++         +
Sbjct: 241 PSLFLEAIESLQKGQVSRPIRSPSGFHLVQLKGVRGDERRVIQQVRARHILLTPNAVLSD 300

Query: 299 KHEAEYVKKLRSN 311
           +   + + +LR  
Sbjct: 301 EQARQKIAELRRR 313



 Score = 83.6 bits (204), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 14/126 (11%), Positives = 41/126 (32%), Gaps = 2/126 (1%)

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK 252
            ++   QK  +                +  +        G   +    +  P F+ +++ 
Sbjct: 299 SDEQARQKIAELRRRIVEADESFAELAKAHSIDGSAAQGGDLGWAAPREYVPAFRQVVET 358

Query: 253 SQ-NNTTNPYVTQKGVEYIAICDKRD-LGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRS 310
              N  + P+ +  G   + + ++R     +   +     +    K  + E  ++++LR 
Sbjct: 359 LPLNTLSEPFRSDFGWHIVEVLERRQYDETDEYRRGMARQELRKMKASEEEELWLRRLRD 418

Query: 311 NAIIHY 316
              + Y
Sbjct: 419 QTYVEY 424


>gi|156973131|ref|YP_001444038.1| hypothetical protein VIBHAR_00810 [Vibrio harveyi ATCC BAA-1116]
 gi|156524725|gb|ABU69811.1| hypothetical protein VIBHAR_00810 [Vibrio harveyi ATCC BAA-1116]
          Length = 427

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/310 (12%), Positives = 108/310 (34%), Gaps = 12/310 (3%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING----- 70
           +  +  L+   ++      +     ++   +N  VI   DI   +  L+           
Sbjct: 1   MKIWKSLLFTALLSCGVTAAPVELDKVAVIVNDGVILQSDIDTAMKTLQANARQSGKSLP 60

Query: 71  ---ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
               L+   V++LI++TL+ QE E+ G+  D N +N    + ARN   S E  ++ +  +
Sbjct: 61  SASVLKDQVVEKLIIDTLQGQEAERIGVRIDDNRLNQAIAEIARNNNQSVEQLAASVQAE 120

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI 187
           G+  + F++ +  +    +        +   L  E+ +   ++   T      +     +
Sbjct: 121 GLSYSEFREQIRKEIAASEARNALVRRRINILPAEVDSLADQLAKETNATVQYKIGHIQL 180

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
             +  +++  V+       +              ++     +  G   ++ + ++   F 
Sbjct: 181 RFSDDKDKSEVEAEANALVKKLKDGADFSEMAYTYSKGPKALQGGDWGWMRKEEMPTIFA 240

Query: 248 NL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKHEAE 303
           +    +++ +   P+ +  G   + I D +    +        ++  + T    +    +
Sbjct: 241 DQIKMQNKGSIIGPFRSGIGFHILKIEDVKGLETVAVTEVNARHILIKPTVILSDDGAKK 300

Query: 304 YVKKLRSNAI 313
            + +      
Sbjct: 301 ELNEFIRRIK 310



 Score = 78.6 bits (191), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 18/140 (12%), Positives = 50/140 (35%), Gaps = 3/140 (2%)

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLL 238
               +   P   L + G  ++  +     +           +++         G+  Y  
Sbjct: 281 NARHILIKPTVILSDDGAKKELNEFIRRIKAGEATFGQLATQYSQDPGSAAQNGELGYQT 340

Query: 239 ESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTK 296
                P+F++ ++     + + P+ T  G   + + D+R +   + A+K          K
Sbjct: 341 PDLYVPEFKHQVETLPVGSISAPFKTVHGWHIVEVLDRRQVDRTDSAMKNKAYRILFNRK 400

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
             +    ++++LR++A +  
Sbjct: 401 FNEEAGAWMQELRASAFVEI 420


>gi|91790684|ref|YP_551636.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Polaromonas sp.
           JS666]
 gi|122070654|sp|Q121Q4|SURA_POLSJ RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|91699909|gb|ABE46738.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Polaromonas sp.
           JS666]
          Length = 473

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 44/292 (15%), Positives = 97/292 (33%), Gaps = 18/292 (6%)

Query: 38  MSSRIRTTINGEVITDGDI--------SKRIALLKLQKINGELEKIAVQELIVETLKKQE 89
            +  I   +N E IT+ ++         + I          EL    ++ LI +  + Q 
Sbjct: 66  QADFIVAVVNSEPITNSEVRTKLVRTEQQIIQQGSPLPPRRELVPQVLERLISDKAQLQL 125

Query: 90  IEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVK 149
              +G+  D N V       AR   +S ++    L   GI  + F+  L  + +   + +
Sbjct: 126 ARSAGMRVDDNAVEAAVQTVARQNQISVDELRRRLKADGIAYSQFESDLRDELLVSRLRQ 185

Query: 150 NDFMLKYGNLEMEIPANKQKMK---NITVREYLIRTVLFSIPDNKLQ-NQGFVQKRIKDA 205
            +  L+    E +I    ++ +    ++     +  +L ++P+N        +Q + +  
Sbjct: 186 REVDLRVTVTEQDIDQFLREQEGGTELSSLALNLAQILVAVPENATPGQVAALQAKAQQV 245

Query: 206 EESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQ 264
            +             +F+      + G           P F ++           P  + 
Sbjct: 246 MDKARGGADFAALANEFSDSPTRGTGGLMGLREADRYPPLFVESTKSLKVGGLAGPIRSG 305

Query: 265 KGVEYIAICDKRDLG-----GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
            G   + + +KR  G            ++  + +P + E    E +  LR  
Sbjct: 306 AGFHILKVIEKRQAGMPGSVITQTHARHILLRLSPKQGETAATEKLAALRKR 357



 Score = 96.3 bits (237), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 39/279 (13%), Positives = 83/279 (29%), Gaps = 17/279 (6%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           +T+ DI +    L+ Q+   EL  +A+  L    +   E    G            +  A
Sbjct: 194 VTEQDIDQ---FLREQEGGTELSSLALN-LAQILVAVPENATPGQVAALQAKAQQVMDKA 249

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND-----------FMLKYGNL 159
           R     A   + F D    G              P  V++                 G  
Sbjct: 250 RGGADFAALANEFSDSPTRGTGGLMGLREADRYPPLFVESTKSLKVGGLAGPIRSGAGFH 309

Query: 160 EMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKL 219
            +++   +Q     +V        +      K       +K     +             
Sbjct: 310 ILKVIEKRQAGMPGSVITQTHARHILLRLSPKQGETAATEKLAALRKRILAGQADFAALA 369

Query: 220 EKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDL 278
            + +        G   +       P+F+ ++   + N  ++P V++ GV  I + ++R+ 
Sbjct: 370 RENSEDASAKQGGDLGWANPGMFVPEFEKVMNGLAPNQISDPLVSRFGVHLIQVLERREA 429

Query: 279 GGEIALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                 +  +        K E+    + +++R  A + Y
Sbjct: 430 QMSQRDQREMARNVLRGKKQEEAYVLWAQEVRGRAYVEY 468


>gi|68249060|ref|YP_248172.1| survival protein SurA-like protein [Haemophilus influenzae
           86-028NP]
 gi|68057259|gb|AAX87512.1| survival protein SurA homolog [Haemophilus influenzae 86-028NP]
          Length = 313

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 55/318 (17%), Positives = 110/318 (34%), Gaps = 20/318 (6%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAM-SSRIRTTINGEVITDGDISKRIALLKLQKINGE 71
           +K+        +   +  V++ S A    R+  T++G  I +  +       +       
Sbjct: 1   MKMKKFILKSFLLATLGCVAFTSMAQAEERVVATVDGIPILESQV-------RANMGKKG 53

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
             + A+ ++I + L ++ I++SG+  D   ++      A   GL+   F   LD QGI  
Sbjct: 54  DRQSALDKIIDDLLVQKAIQESGVKIDPREIDRVVEDTAARNGLTYGQFLDALDYQGISL 113

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEI---------PANKQKMKNITVREYLIRT 182
           N F+Q +A Q +   V              E+          A  Q        +     
Sbjct: 114 NTFRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLDEAKSQGTAQKVTGKEYEVR 173

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQY-LLES 240
            +    +  L +    ++  K   +         +   K++       + G   Y   E+
Sbjct: 174 HILLKLNPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPET 233

Query: 241 DLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEK 299
                 Q ++K  Q   + P+ T+ G   + +   RD              +   T+++ 
Sbjct: 234 YAPQFAQTVMKSKQGVISAPFKTEFGWHILEVTGVRDGDLTAEAYTQKAYERLVNTQLQD 293

Query: 300 HEAEYVKKLRSNAIIHYY 317
              ++VK LR  A I Y+
Sbjct: 294 ATNDWVKALRKRANIQYF 311


>gi|261380640|ref|ZP_05985213.1| putative cis-trans isomerase [Neisseria subflava NJ9703]
 gi|284796620|gb|EFC51967.1| putative cis-trans isomerase [Neisseria subflava NJ9703]
          Length = 329

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 36/284 (12%), Positives = 86/284 (30%), Gaps = 17/284 (5%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKL------QKINGELEKIAVQELIVETLKKQEIEK 92
           S  I   ++ EVIT   +++ +A  +       Q    EL +  + ++I ++L  Q  ++
Sbjct: 52  SDGIAAVVDNEVITHRQVAQAVAQARQTMPKGTQMDANELRQQVLAQMINQSLILQAGKR 111

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
             I    + +      +      SA       D          + +  Q+I      +  
Sbjct: 112 RNIQATDSEIEAVIAHNPNIKNPSAAVRQDIADS------IIVEKVRQQAIMQ---NSRV 162

Query: 153 MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRL 212
                   +E    +                   I  +        +  I+         
Sbjct: 163 SDSEVARYIEQAKQQGITLPEADPVRQYHAQHILIKADNDNAAVGAESTIRKIYSQARSG 222

Query: 213 PKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIA 271
                   +++      + G   +  +  +   F+  + K      + P  TQ G   I 
Sbjct: 223 ADFGGLARQYSQDGSAGNGGDLGWFADGMMVAPFEEAVHKLKPGQISAPVRTQFGWHIIK 282

Query: 272 ICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
           + D R+    E   +  +    +  K ++     +++L S++ +
Sbjct: 283 LNDVREAGTPEERQQNAVRQYLSQQKAQQATTNLLRELHSSSYV 326


>gi|90020386|ref|YP_526213.1| L-ribulokinase [Saccharophagus degradans 2-40]
 gi|121956457|sp|Q21MS8|SURA_SACD2 RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|89949986|gb|ABD80001.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Saccharophagus
           degradans 2-40]
          Length = 430

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/315 (13%), Positives = 100/315 (31%), Gaps = 15/315 (4%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE 71
            IK     F  I F      +        R+   ++   IT  ++  R+  ++++     
Sbjct: 3   IIKTTIATFTAIAFTGAASFTSAEVVPLDRVVAVVDNRAITQTELDSRVQDVQVRSQAAG 62

Query: 72  LE--------KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSF 123
           +         K  + +LI ETL+ +  ++ G+      VN       +N  ++ + F   
Sbjct: 63  MRLPEADILNKQIIDQLISETLQLEMADRYGVQVSDQEVNASIGNIIQNAQMTEQQFVQQ 122

Query: 124 LDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTV 183
           L  +G+  N F+  +  Q     + +     +    E E+    +               
Sbjct: 123 LASEGVSINEFRASIRRQLTMRSITEGLVSRRIRISEQEVDNFLKSADAQFWVSPDYHLG 182

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE---KFASKIHDVSIGKAQYLLES 240
              +      +   + +  + A     +L    N  E     ++    +  G   +   +
Sbjct: 183 HILVALPSSPSSEAIVEAEEKANALYEKLKAGANFAEVAIAESNGPSALQGGDLGWRKSA 242

Query: 241 DLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTK 296
           +L   F + L   +  + T P  +Q G   I + + R             ++  + +   
Sbjct: 243 ELPTLFAELLPSLNNGDVTKPTRSQAGFHIIKLYESRGGQKQIVNQTRARHILVKTSEIL 302

Query: 297 IEKHEAEYVKKLRSN 311
            +      +K +R  
Sbjct: 303 NDAKAEAKLKDIRQQ 317



 Score = 91.7 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 18/147 (12%), Positives = 49/147 (33%), Gaps = 3/147 (2%)

Query: 173 ITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSI 231
                   R     +  +++ N    + ++KD  +  L         +  +  I   +S 
Sbjct: 282 QKQIVNQTRARHILVKTSEILNDAKAEAKLKDIRQQILDGADFAELAKTHSEDIGSRMSG 341

Query: 232 GKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIAL-KAYLS 289
           G   +       P F+  + +  +   + P+ ++ G   + + ++R+        +    
Sbjct: 342 GDLGWATPGTFVPAFEKTMAETKEGEISQPFKSRFGWHIMKVEERREEDMTQEALRQKAR 401

Query: 290 AQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                 + E     ++++LR  A I  
Sbjct: 402 NMIMSRRFEDETQIWLQELRDEAFIDI 428


>gi|84393693|ref|ZP_00992443.1| parvulin-like peptidyl-prolyl isomerase [Vibrio splendidus 12B01]
 gi|84375692|gb|EAP92589.1| parvulin-like peptidyl-prolyl isomerase [Vibrio splendidus 12B01]
          Length = 431

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/311 (12%), Positives = 110/311 (35%), Gaps = 12/311 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--- 69
           + L     + I       VSY +      ++  +N  VI   DI   +  L+        
Sbjct: 1   MTLWKRTLIAIAAACTVSVSYAAPVELDSVKVIVNEGVILQSDIDASMKTLRANAKKSGQ 60

Query: 70  -----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++T++ QE E+ G+  D   ++      A++   + E  ++ +
Sbjct: 61  TLPSQDVLNEQVLEKLIIDTIQTQEAERIGVRIDDARLDQAIEGIAKDNNQTVEQLTASV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            ++G+  N F++ +  +    +        +   L  E+      +   T      +   
Sbjct: 121 AEEGLSYNAFREQVRKEIAASEARNALVRRRINILPAEVDNLADILAQETNATVQYKIGH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +  N  Q +  ++ + K+  E              ++     +  G   ++ + ++  
Sbjct: 181 IQLRFNDDQTKEELEAQAKEVVEELNSGKDFSTMAYTYSKGPKALQGGDWGWMRKEEMPT 240

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F +    +++ +   P+ +  G   + I D +    +        ++  + T    +  
Sbjct: 241 IFADQIKMQNKGSIIGPFRSGVGFHILKIEDVKGLETVAVTEVNARHILIKPTVILSDYG 300

Query: 301 EAEYVKKLRSN 311
             E ++++   
Sbjct: 301 AKEQLEEITRR 311



 Score = 79.7 bits (194), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 33/276 (11%), Positives = 88/276 (31%), Gaps = 14/276 (5%)

Query: 44  TTING-EVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTV 102
             ++    I   + +  +            +    +EL  +  +  E   SG  F +   
Sbjct: 157 AEVDNLADILAQETNATVQYKIGHIQLRFNDDQTKEELEAQAKEVVEELNSGKDFSTMAY 216

Query: 103 NYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEME 162
            Y     A   G    D+     ++       +  +  +       ++        +E  
Sbjct: 217 TYSKGPKALQGG----DWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIEDV 272

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
                  +  +  R  LI+  +        +    + +R+   E             +++
Sbjct: 273 KGLETVAVTEVNARHILIKPTVILSDYGAKEQLEEITRRVNAGEA------SFGELAQQY 326

Query: 223 ASKI-HDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLG- 279
           +      V  G+  Y       P+F++ ++   +   + P+ T  G   + + D+R++  
Sbjct: 327 SQDPGSAVQDGELGYQTPDLYVPEFKHQVETLPEGKISAPFKTVHGWHIVEVLDRREVDR 386

Query: 280 GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            + ALK          K  +    +++++R++A + 
Sbjct: 387 TDSALKNKAYQILFNRKFNEEAGAWLQEVRASAFVE 422


>gi|148977503|ref|ZP_01814092.1| parvulin-like peptidyl-prolyl isomerase [Vibrionales bacterium
           SWAT-3]
 gi|145963298|gb|EDK28564.1| parvulin-like peptidyl-prolyl isomerase [Vibrionales bacterium
           SWAT-3]
          Length = 431

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/311 (12%), Positives = 109/311 (35%), Gaps = 12/311 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--- 69
           + L     + I        S+        +R  +N  VI   DI   +  L+        
Sbjct: 1   MTLWKRTLIAIAAACTVSTSFADPVELDSVRVIVNEGVILQSDIDTSMKTLRANAKKSGQ 60

Query: 70  -----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L++  +++LI++T++ QE E+ G+  D   ++      A++   + E  ++ +
Sbjct: 61  TLPSQDVLDEQVLEKLIIDTIQTQEAERIGVRIDDARLDQAIEGIAKDNNQTVEQLTASV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            ++G+  N F++ +  +    +        +   L  E+      +   T      +   
Sbjct: 121 AEEGLSYNAFREQVRKEIAASEARNALVRRRINILPAEVDNLADILAQETNATVQYKIGH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +  N  Q +  ++ + K+  E              ++     +  G   ++ + ++  
Sbjct: 181 IQLRFNDDQTKEELEAQAKELVEELNSGKDFSTMAYTYSKGPKALQGGDWGWMRKEEMPT 240

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F +    +++ +   P+ +  G   + I D +    +        ++  + T    +  
Sbjct: 241 IFADQIKMQNKGSIIGPFRSGVGFHILKIEDVKGLETVAVTEVNARHILIKPTVILSDDG 300

Query: 301 EAEYVKKLRSN 311
             E ++++   
Sbjct: 301 AKEQLEEITRR 311



 Score = 80.9 bits (197), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/276 (10%), Positives = 87/276 (31%), Gaps = 14/276 (5%)

Query: 44  TTING-EVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTV 102
             ++    I   + +  +            +    +EL  +  +  E   SG  F +   
Sbjct: 157 AEVDNLADILAQETNATVQYKIGHIQLRFNDDQTKEELEAQAKELVEELNSGKDFSTMAY 216

Query: 103 NYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEME 162
            Y     A   G    D+     ++       +  +  +       ++        +E  
Sbjct: 217 TYSKGPKALQGG----DWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIE-- 270

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
                 +   +T        +  ++  +    +  +++  +                +++
Sbjct: 271 -DVKGLETVAVTEVNARHILIKPTVILSDDGAKEQLEEITRRVNAGEASFGDM---AQQY 326

Query: 223 ASKI-HDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLG- 279
           +      V  G+  Y       P+F++ ++   +   + P+ T  G   + + D+R++  
Sbjct: 327 SQDPGSAVQDGELGYQTPDLYVPEFKHQVETLPEGKISAPFKTVHGWHIVEVLDRREVDR 386

Query: 280 GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            + ALK          K  +    +++++R++A + 
Sbjct: 387 TDSALKNKAYQILFNRKFNEEAGAWLQEVRASAFVE 422


>gi|37678664|ref|NP_933273.1| parvulin-like peptidyl-prolyl isomerase [Vibrio vulnificus YJ016]
 gi|37197404|dbj|BAC93244.1| parvulin-like peptidyl-prolyl isomerase [Vibrio vulnificus YJ016]
          Length = 443

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/312 (12%), Positives = 115/312 (36%), Gaps = 16/312 (5%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN----- 69
            +  +  L++  +V   +  +     ++   +N  VI   DI      L+          
Sbjct: 15  KMNIWKTLLLGMLVTGSAVSAPVELDKVAVIVNDGVILQSDIDTATKTLRANAKKSGQAL 74

Query: 70  ---GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDK 126
                L +  V +LI++TL+ QE ++ G+  D   +N    + ARN   + ++ S+ +  
Sbjct: 75  PDADVLNEQIVDKLIIDTLQTQEADRIGVRIDDTRLNQAIEEIARNNNQTIDELSAAIAS 134

Query: 127 QGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
           +G+    F++ +  +    +        +   L  E+    + +   T      R     
Sbjct: 135 EGVSYEEFREQIRKEMAASEARNALVRRRINILPAEVDNLAELLSKETNASVEYRIGHIQ 194

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           +     Q++  ++ + K+  E   +          ++     +  G   ++ + ++   F
Sbjct: 195 LRFTDGQDKSALEAQAKELVEKLKQGADFSTMAYTYSKGPKALQGGDWGWMRKEEMPTIF 254

Query: 247 QNL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQ----NTPTKIE 298
            +    +++ +   P+ +  G   + I D +    +        ++  +     +    +
Sbjct: 255 ADQIKMQNKGSIIGPFRSGVGFHILKIEDVKGLETVAVTEVNARHILLKPTVILSDEGAQ 314

Query: 299 KHEAEYVKKLRS 310
           +   E+++++R+
Sbjct: 315 RELNEFIRRIRA 326



 Score = 78.2 bits (190), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/270 (10%), Positives = 75/270 (27%), Gaps = 4/270 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     LL  +       +I   +L     + +   ++        +        
Sbjct: 166 ILPAEVDNLAELLSKETNASVEYRIGHIQLRFTDGQDKSALEAQAKELVEKLKQGADFST 225

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +        +   I   +   
Sbjct: 226 MAYTYSKGPKALQGGDWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIEDVK 285

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDC-NKLEKFASKI-HD 228
              TV    +      +    + +    Q+ + +                ++++      
Sbjct: 286 GLETVAVTEVNARHILLKPTVILSDEGAQRELNEFIRRIRAGEATFGELAQQYSQDPGSA 345

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ ++       + P+ T  G   + + D+R++   + A+K 
Sbjct: 346 AQDGELGYQTPDLYVPEFKHQVETLPVGTISEPFKTVHGWHIVEVLDRREVDRTDSAMKN 405

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                    K  +    ++++LR+ A +  
Sbjct: 406 KAYRILFNRKFNEEVGAWMQELRAGAFVEI 435


>gi|77917707|ref|YP_355522.1| parvulin-like peptidyl-prolyl isomerase [Pelobacter carbinolicus
           DSM 2380]
 gi|77543790|gb|ABA87352.1| parvulin-like peptidyl-prolyl isomerase [Pelobacter carbinolicus
           DSM 2380]
          Length = 316

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 54/313 (17%), Positives = 105/313 (33%), Gaps = 14/313 (4%)

Query: 17  TTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK--------- 67
             Y +L I  ++   S  S    SRI   +N ++IT   + + I  +   +         
Sbjct: 1   MKYLILSIALLMLATSPLSAETISRIAAIVNQDIITTAQLDREIDKMLSAEAQETGITPV 60

Query: 68  INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
              EL    + +LI +TL  Q IEK G+      V            ++ E     L  Q
Sbjct: 61  QREELRHKMLDKLIEDTLLNQRIEKLGLHVSDEAVEQAINDVQAQNNITREQLKQALVAQ 120

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI 187
           GI  + +++ L  Q +   ++  +   K      E+    +   +    +  +R    + 
Sbjct: 121 GINFDDYRERLRQQLLNFQLIGREIQSKVEVTNTEMRDYYRSHLDDYRNDPYLRLSRITF 180

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF--ASKIHDVSIGKAQYLLESDLHPQ 245
                     +      A ++  +L +  + LE     +    V  G    + E  L   
Sbjct: 181 RLPPGNTPADIAAMRAKAADALQQLRRGKDFLEVLMQNAATSGVDGGDMGKITEGSLSES 240

Query: 246 F-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRD--LGGEIALKAYLSAQNTPTKIEKHEA 302
           F + +   S    +    T +G   + + ++          +K  +S +    K      
Sbjct: 241 FNRAISGLSVGQVSEIIETPEGFHLLRLDERNPGDTQTFETVKEQISRKLMEDKRAAALT 300

Query: 303 EYVKKLRSNAIIH 315
           E+ + LR  A I 
Sbjct: 301 EWTENLRKEADIE 313


>gi|71909270|ref|YP_286857.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Dechloromonas
           aromatica RCB]
 gi|122070644|sp|Q479U4|SURA_DECAR RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|71848891|gb|AAZ48387.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Dechloromonas
           aromatica RCB]
          Length = 438

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/324 (13%), Positives = 107/324 (33%), Gaps = 19/324 (5%)

Query: 6   FTSLSDFIK-LLTTYFVLIIFCIVPIVSYKS-WAMSSRIRTTINGEVITDGDISKRIALL 63
             +++ +I+ L+     L      P+ +       + RI   +  +VIT  ++  R+   
Sbjct: 1   MKTMNPYIRHLILLICCLGGMLAQPLSAAPQDPVEADRIVAVVGSDVITYFELRTRLTAA 60

Query: 64  KLQKING--------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGL 115
             Q             LE+  ++ LI+E  + Q   ++G+  D   ++    + A    +
Sbjct: 61  LKQLQKQGTPLPPQDVLERQMLERLIMERAQLQYGRETGMKIDDTQLDLAIGRIAAGNKM 120

Query: 116 SAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITV 175
           +   F + L+K G+    F++ +  + +   + + +   K    E EI            
Sbjct: 121 TVPQFRAALEKDGVQYAQFREEIRNEMVTVRLREREVDSKLVISEGEIDNYLANQTATGS 180

Query: 176 REYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKL---EKFASKIHDVSIG 232
            E      +             +QK  +  E++  R     N       F+     +  G
Sbjct: 181 EEEYQLAHILLRAPE-SATPEQLQKLRQRGEQALKRARAGENFAQLTAAFSDAPDALQGG 239

Query: 233 KAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAY 287
              +   + L   + +   +      ++   +  G   + +  KR        +     +
Sbjct: 240 DLGWRPLARLPALYAEAGSRLQSGEVSDLLRSSAGFHIVKLVSKRGGSAPASVQQTHARH 299

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSN 311
           +  +++    E      ++ +R  
Sbjct: 300 ILIRSSEVLSEAEATRKLEAVRER 323



 Score = 95.1 bits (234), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 14/140 (10%), Positives = 49/140 (35%), Gaps = 2/140 (1%)

Query: 179 LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLL 238
                   I  +++ ++    ++++   E          +   ++        G+  +L 
Sbjct: 294 QTHARHILIRSSEVLSEAEATRKLEAVRERIANGVDFAEQARLYSQDGSAAKGGELGWLN 353

Query: 239 ESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL-SAQNTPTK 296
             D  P+F+  +     N  +    +  G+  I + ++R+       +  +        K
Sbjct: 354 PGDTVPEFERAMDALKINEVSQVVQSPFGMHLIQVLERRERDVSAERQRAVARQALRERK 413

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
           +++   +++++LR    +  
Sbjct: 414 LDEAYQDWLRQLRDRTYVEN 433


>gi|291612516|ref|YP_003522673.1| SurA domain protein [Sideroxydans lithotrophicus ES-1]
 gi|291582628|gb|ADE10286.1| SurA domain protein [Sideroxydans lithotrophicus ES-1]
          Length = 433

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/317 (13%), Positives = 111/317 (35%), Gaps = 17/317 (5%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE-- 71
           K+   + ++         S K      RI   +N +VIT  ++  R+A +       +  
Sbjct: 5   KIFALFLIVFATVASAAESQKQATSLDRIDVIVNDDVITHRELENRVASVTKMLQRQKTA 64

Query: 72  ------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSA-EDFSSFL 124
                 LE+  ++ +I E L  Q  ++SG+  D   ++   ++ A+         F + L
Sbjct: 65  LPEKSILERQVLERMITEMLLAQYAKESGLRIDDGQLDKTILRIAQQNKFPDVAAFRAKL 124

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            + G   N F++ +  + I   + + +   K    E +I        +   +   ++   
Sbjct: 125 TRDGTDYNEFREEIRNEIIAVRLREREVDSKLVISENDIDNYLNNQAHQEGKGEELQLSH 184

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK---FASKIHDVSIGKAQYLLESD 241
             +   +      +Q     AE++  +L       +    ++     +  G+  +     
Sbjct: 185 ILVVVPEQATADKIQSYRDRAEQALAKLRAGAPFAQVAAGYSDAQDALKGGELGWRPADR 244

Query: 242 LHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTK 296
           L P F + L K    + ++   +  G   I + D+R     +        ++  + +   
Sbjct: 245 LPPLFAEALQKMKPGDLSDVLRSPSGFHIIKLLDRRSNDAPVVITQTHARHILIKTSELV 304

Query: 297 IEKHEAEYVKKLRSNAI 313
            +      +++++    
Sbjct: 305 TDSEAKSRLQEIKQRID 321



 Score =  102 bits (254), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 33/291 (11%), Positives = 90/291 (30%), Gaps = 15/291 (5%)

Query: 40  SRIRTT------INGE-VITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEK 92
           + I         ++ + VI++ DI   +     Q+  GE  +++   L+V   +    + 
Sbjct: 140 NEIIAVRLREREVDSKLVISENDIDNYLNNQAHQEGKGEELQLS-HILVVVPEQATADKI 198

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
                 +          A    ++A    +    +G                  + K   
Sbjct: 199 QSYRDRAEQALAKLRAGAPFAQVAAGYSDAQDALKGGELGWRPADRLPPLFAEALQKMKP 258

Query: 153 ML-----KYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEE 207
                  +  +    I    ++  +  V           I  ++L      + R+++ ++
Sbjct: 259 GDLSDVLRSPSGFHIIKLLDRRSNDAPVVITQTHARHILIKTSELVTDSEAKSRLQEIKQ 318

Query: 208 SRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKG 266
              +      +   ++        G   +L   +  P+F++ +        +    T  G
Sbjct: 319 RIDKGASFAEQARLYSEDGSAPQGGDLGWLSPGETVPEFESAMNALKVGQVSGLVQTGFG 378

Query: 267 VEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
              I + ++R+    +  K           K ++   +++++LR  A + Y
Sbjct: 379 WHLIQVLERRNTDVSVEQKRQRARNAIRTVKSDEAFQDWLRQLRDRAFVEY 429


>gi|39936127|ref|NP_948403.1| hypothetical protein RPA3064 [Rhodopseudomonas palustris CGA009]
 gi|192291845|ref|YP_001992450.1| SurA domain [Rhodopseudomonas palustris TIE-1]
 gi|39649981|emb|CAE28505.1| conserved unknown protein [Rhodopseudomonas palustris CGA009]
 gi|192285594|gb|ACF01975.1| SurA domain [Rhodopseudomonas palustris TIE-1]
          Length = 308

 Score =  134 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 58/285 (20%), Positives = 118/285 (41%), Gaps = 2/285 (0%)

Query: 33  YKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEK 92
             +   +  +   +NGE IT+ DI +R  L ++     +  +  +++LI E +K +E +K
Sbjct: 24  GTTQGQAQSVVVMVNGEPITNFDIDQRSKLNRMS-HKADSRQQVLEDLIDEKVKIKEAKK 82

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
            G+    + ++  F   A    +S    ++ L  QGI  +  K  +  + +W  +V+  F
Sbjct: 83  YGVNPSDSDIDSSFSTMASRMRMSTAQMTNMLAAQGIRPDTLKSRIRAEMVWASLVRGRF 142

Query: 153 MLKYGNLEMEIPAN-KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
                  E E+ A  K       V  +  +     +  ++      +  R K+AE+ R R
Sbjct: 143 KDSLQVSEREVQAQLKGGDDTKAVESFEYQLRPVVMIVSRGSVSESLDARRKEAEQLRGR 202

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIA 271
           +         F +  +    G              + L K    + T P VT++G+E +A
Sbjct: 203 ISSCAEADRVFKAMPNAAIRGIVIKTSADLPPALREILDKTPVGHLTPPEVTKQGIEMVA 262

Query: 272 ICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           +C+++    +   K  +  +    K +    EY++++R  A+I Y
Sbjct: 263 LCERKQSTADTPRKREIREKLFGEKFQAKSKEYLQEVRKAAMIEY 307


>gi|225076364|ref|ZP_03719563.1| hypothetical protein NEIFLAOT_01408 [Neisseria flavescens
           NRL30031/H210]
 gi|224952307|gb|EEG33516.1| hypothetical protein NEIFLAOT_01408 [Neisseria flavescens
           NRL30031/H210]
          Length = 329

 Score =  134 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/284 (12%), Positives = 86/284 (30%), Gaps = 17/284 (5%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKL------QKINGELEKIAVQELIVETLKKQEIEK 92
           S  I   ++ EVIT   +++ +A  +       Q    EL +  + ++I ++L  Q  ++
Sbjct: 52  SDGIAAVVDNEVITHRQVAQAVAQARQTMPKGTQMDANELRQQVLAQMINQSLILQAGKR 111

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
             I    + +      +      SA       D          + +  Q+I      +  
Sbjct: 112 RNIQATDSEIEAVIAHNPNIKNPSAAVRQDIADS------IIVEKVRQQAIMQ---NSRV 162

Query: 153 MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRL 212
                   +E    +                   I  +        +  I+         
Sbjct: 163 SDSEVARYIEQAKQQGVTLPEADPVRQYHAQHILIKADNDNAAVGAESTIRKIYTQARSG 222

Query: 213 PKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIA 271
                   +++      + G   +  +  +   F+  + K      + P  TQ G   I 
Sbjct: 223 ADFGGLARQYSQDSSAGNGGDLGWFADGMMVAPFEEAVHKLKPGQISAPVRTQFGWHIIK 282

Query: 272 ICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
           + D R+    E   +  +    +  K ++     +++L S++ +
Sbjct: 283 LNDVREAGTPEERQQNAVRQYLSQQKAQQATTNLLRELHSSSYV 326


>gi|153834210|ref|ZP_01986877.1| chaperone SurA [Vibrio harveyi HY01]
 gi|148869398|gb|EDL68404.1| chaperone SurA [Vibrio harveyi HY01]
          Length = 427

 Score =  134 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 38/310 (12%), Positives = 108/310 (34%), Gaps = 12/310 (3%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING----- 70
           +  +  L+   ++      +     ++   +N  VI   DI   +  L+           
Sbjct: 1   MKIWKSLLFTTLLSCGVTAAPVELDKVAVIVNDGVILQSDIDTAMKTLQANARQSGKSLP 60

Query: 71  ---ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
               L+   V++LI++TL+ QE E+ G+  D N +N    + ARN   S E  ++ +  +
Sbjct: 61  SASVLKDQVVEKLIIDTLQGQEAERIGVRIDDNRLNQAIAEIARNNNQSVEQLAASVQAE 120

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI 187
           G+  + F++ +  +    +        +   L  E+ +   ++   T      +     +
Sbjct: 121 GLSYSEFREQIRKEIAASEARNALVRRRINILPAEVDSLADQLAKETNATVQYKIGHIQL 180

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
             +  +++  V+       +              ++     +  G   ++ + ++   F 
Sbjct: 181 RFSDDKDKSEVEAEANALVQKLKDGADFSEMAYTYSKGPKALQGGDWGWMRKEEMPTIFA 240

Query: 248 NL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKHEAE 303
           +    +++ +   P+ +  G   + I D +    +        ++  + T    +    +
Sbjct: 241 DQIKMQNKGSIIGPFRSGIGFHILKIEDVKGLETVAVTEVNARHILIKPTVILSDDGAKK 300

Query: 304 YVKKLRSNAI 313
            + +      
Sbjct: 301 ELNEFIRRIK 310



 Score = 78.6 bits (191), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 18/140 (12%), Positives = 50/140 (35%), Gaps = 3/140 (2%)

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLL 238
               +   P   L + G  ++  +     +           +++         G+  Y  
Sbjct: 281 NARHILIKPTVILSDDGAKKELNEFIRRIKAGEATFGQLATQYSQDPGSAAQNGELGYQT 340

Query: 239 ESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTK 296
                P+F++ ++     + + P+ T  G   + + D+R +   + A+K          K
Sbjct: 341 PDLYVPEFKHQVETLPVGSISAPFKTVHGWHIVEVLDRRQVDRTDSAMKNKAYRILFNRK 400

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
             +    ++++LR++A +  
Sbjct: 401 FNEEAGAWMQELRASAFVEI 420


>gi|330505263|ref|YP_004382132.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas
           mendocina NK-01]
 gi|328919549|gb|AEB60380.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas
           mendocina NK-01]
          Length = 432

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 36/287 (12%), Positives = 96/287 (33%), Gaps = 15/287 (5%)

Query: 40  SRIRTTINGEVITDGDISKRIALLK--------LQKINGELEKIAVQELIVETLKKQEIE 91
            R+   ++ +V+    +  R+  ++               L +  ++ LI+E ++ Q  +
Sbjct: 33  DRVVAIVDNDVVMQSQLDARLREVQQTIDKRGGALPPEHVLSQQVLERLIIENIQLQIGD 92

Query: 92  KSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
           +SGI      +N      A+  G+S E F   L + G+     +  +  + I   V +  
Sbjct: 93  RSGIRITDEELNQAMGTIAQRNGMSLEQFRDALARDGLSYADARDQVRREMIISRVRQRR 152

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIR---TVLFSIPDNKLQNQGFVQKRIKDAEES 208
              +    + E+                 R    ++               ++ ++  + 
Sbjct: 153 VAERIQVTDQEVQNFLASDLGKMQLSEEFRLANILIPVSEGASSSEIQAADRQAQELYQQ 212

Query: 209 RLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGV 267
             +           ++  + +  G+  +     L P F +++ + +    T P  T  G 
Sbjct: 213 LQQGADFGQLAVSRSASENALEGGEMGWRKAGQLPPPFDSMISQLNPGEATEPVRTPGGF 272

Query: 268 EYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
             + + +KR       +     ++  + +  + E+     V++L   
Sbjct: 273 IILKLIEKRGGDTQVRDEVHVRHILIKPSEIRSEEETRRLVERLYQR 319



 Score = 89.3 bits (219), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 12/138 (8%), Positives = 52/138 (37%), Gaps = 3/138 (2%)

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLE 239
                 I  ++++++   ++ ++   +  +         + F+      ++ G   ++  
Sbjct: 292 HVRHILIKPSEIRSEEETRRLVERLYQRIVDGEDFAELAKSFSEDPGSALNGGDLNWIDP 351

Query: 240 SDLHPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKI 297
           + L P+F+ ++  +     + P+ +  G   + +  +R        +    +      K 
Sbjct: 352 NALVPEFREVMNNTASGELSKPFKSPYGWHVLQVMGRRATDSSAQFREQQAANLLRNRKY 411

Query: 298 EKHEAEYVKKLRSNAIIH 315
           ++    +++++R  A + 
Sbjct: 412 DEELQAWLRQIRDEAYVE 429


>gi|39997524|ref|NP_953475.1| peptidyl-prolyl cis-trans isomerase domain-containing protein
           [Geobacter sulfurreducens PCA]
 gi|39984415|gb|AAR35802.1| PPIC-type PPIASE domain protein [Geobacter sulfurreducens PCA]
          Length = 351

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 44/289 (15%), Positives = 91/289 (31%), Gaps = 16/289 (5%)

Query: 42  IRTTINGEVITDGDISKRIALLKLQKI---------NGELEKIAVQELIVETLKKQEIEK 92
           +   +NG  IT  ++ +   +L  Q             ++E+ AV +LI + L  Q   K
Sbjct: 61  VVVKVNGVAITRAEVDRAKKVLMSQNRMTQPVTPDIAQKVEEAAVSQLIAKELLYQAGRK 120

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
             I      +     Q         E   +      + +   + +     +  ++++ D 
Sbjct: 121 QEIKDLDKQIQERVSQSKARFPSQEEYLKTL-KSMDMTEKDVETFAREDLVINNLIEKDV 179

Query: 153 MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR- 211
           + K    + E         +   R+  ++     I      +    +K  + AE    + 
Sbjct: 180 VAKTTVSDEEAKKFYNDNIDKFKRDETVKASHILIKVEPNASADDKKKAKEKAEAILKQV 239

Query: 212 --LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLK-KSQNNTTNPYVTQKGVE 268
                     +K +        G   +  +  + P F+           ++   TQ G  
Sbjct: 240 KGGADFAEVAKKESGCPSAPQGGDLGFFGKGQMVPPFEKAAFAMKPGEVSDVVETQFGYH 299

Query: 269 YIAICDKRDLGG--EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            I + DKR          K  +       K+++   EYV+ L+  A I 
Sbjct: 300 IIKLTDKRPAETVKFEETKDRIVQFLKQQKVQEGINEYVENLKKAAKIE 348


>gi|229512625|ref|ZP_04402094.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholerae TMA 21]
 gi|229350302|gb|EEO15253.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholerae TMA 21]
          Length = 431

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 35/313 (11%), Positives = 108/313 (34%), Gaps = 12/313 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +KL     + ++  +    ++        +   +N  VI   D+   +  +K      + 
Sbjct: 1   MKLWKPTLISVLSALTLFNAHAEPKQLDSVAVIVNSGVILQSDVDSALKTIKANAKQNKQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++TL++QE ++ G+  D N +N    + A+N   + E   + +
Sbjct: 61  PLPQETVLREQVLEKLIIDTLQQQEADRIGVKIDDNRLNEAIKEIAKNNQQTQEQLIASV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            ++G+    F++ +  +    D        +   L  E+    + +   T      +   
Sbjct: 121 AQEGLTYPEFREQVRKEMAASDARNALVRRRINILPAEVDTLAELLTQETDATVQYKISH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +  +  Q++   +                      ++     +  G   ++ + ++  
Sbjct: 181 IQLRVDDGQDKSAAETLANKLVNDLRNGADFAQMAYAYSKGPKALQGGDWGWMRKEEMPT 240

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F +    +++ +   P+ +  G   + I D +    +        ++  + T    ++ 
Sbjct: 241 IFADQIKMQNKGSIIGPFRSGVGFHILKIDDVKGLETVAVTEVNARHILIKPTIILSDEG 300

Query: 301 EAEYVKKLRSNAI 313
             + + +      
Sbjct: 301 AQKQLNEFVQRIK 313



 Score = 82.8 bits (202), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 33/269 (12%), Positives = 82/269 (30%), Gaps = 4/269 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     LL  +       KI+  +L V+  + +   ++      N +        
Sbjct: 154 ILPAEVDTLAELLTQETDATVQYKISHIQLRVDDGQDKSAAETLANKLVNDLRNGADFAQ 213

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +        +   I       
Sbjct: 214 MAYAYSKGPKALQGGDWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIDDVK 273

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKI-HD 228
              TV    +      I    + +    QK++ +  +             ++++      
Sbjct: 274 GLETVAVTEVNARHILIKPTIILSDEGAQKQLNEFVQRIKNGEVTFAELAQQYSQDPGSA 333

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ ++       + P+ T  G   + + D+R++   + ALK 
Sbjct: 334 AQKGELGYQTPDLYVPEFKHQIETLPVGQISEPFKTVHGWHIVEVLDRREVDRTDSALKN 393

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
                    K  +  + ++++LR++A + 
Sbjct: 394 KAYRILFNRKFNEEASAWLQELRASAFVE 422


>gi|241759093|ref|ZP_04757204.1| peptidyl-prolyl cis-trans isomerase [Neisseria flavescens SK114]
 gi|241320695|gb|EER56948.1| peptidyl-prolyl cis-trans isomerase [Neisseria flavescens SK114]
          Length = 329

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 36/284 (12%), Positives = 86/284 (30%), Gaps = 17/284 (5%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKL------QKINGELEKIAVQELIVETLKKQEIEK 92
           S  I   ++ EVIT   +++ +A  +       Q    EL +  + ++I ++L  Q  ++
Sbjct: 52  SDGIAAVVDNEVITHRQVAQAVAQARQTMPKGTQMDANELRQQVLAQMINQSLILQAGKR 111

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
             I    + +      +      SA       D          + +  Q+I      +  
Sbjct: 112 RNIQATDSEIEAVIAHNPNIKNPSAAVRQDIADS------IIVEKVRQQAIMQ---NSRV 162

Query: 153 MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRL 212
                   +E    +                   I  +        +  I+         
Sbjct: 163 SDSEVARYIEQAKQQGVTLPEADPVRQYHAQHILIKADNDNAAVGAESTIRKIYSQARSG 222

Query: 213 PKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIA 271
                   +++      + G   +  +  +   F+  + K      + P  TQ G   I 
Sbjct: 223 ADFGGLARQYSQDSSAGNGGDLGWFADGMMVAPFEEAVHKLKPGQISAPVRTQFGWHIIK 282

Query: 272 ICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
           + D R+    E   +  +    +  K ++     +++L S++ +
Sbjct: 283 LNDVREAGTPEERQQNAVRQYLSQQKAQQATTNLLRELHSSSYV 326


>gi|118579840|ref|YP_901090.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pelobacter
           propionicus DSM 2379]
 gi|118502550|gb|ABK99032.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pelobacter
           propionicus DSM 2379]
          Length = 352

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 42/298 (14%), Positives = 92/298 (30%), Gaps = 15/298 (5%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL--------EKIAVQELIVETL 85
            S      +   +NG+ +   ++ +    L   + N ++        +K+A+ +L    L
Sbjct: 54  ASAQQQKDVVARVNGKPVYARELERVKKALLAGRPNQQIPSEHQKEFDKMALNQLTSAEL 113

Query: 86  KKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWP 145
             Q  EK         V     Q       + E   +     G+ ++  ++Y    ++  
Sbjct: 114 LYQAGEKLDTKDIDKQVEAKMSQGKARFATTEEFQKAI-AGLGMNESDLREYTRRDAVIA 172

Query: 146 DVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDA 205
           + V+  F  K    + E      + ++   +   +R     I  +   +    +K  + A
Sbjct: 173 NFVQQTFASKVTVSDEESRKFYDENQDKFKQSESVRASHILIGVDPKADPEIRKKAREKA 232

Query: 206 EESRLR---LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPY 261
           E+ R              + ++       G   +     + P F+       Q   ++  
Sbjct: 233 EKLRKELAGGADFATLARENSTCPSSQQGGDLGFFPRGQMVPPFEQAAFSLKQGEVSDVV 292

Query: 262 VTQKGVEYIAICDKR--DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHYY 317
            TQ G   I     +  +       KA +       K+      Y+   R  + I  Y
Sbjct: 293 ETQFGYHIIKQMGHKNAETVSYADAKARIVDYLKNQKVNSAITAYLDDARKTSKIETY 350


>gi|91227110|ref|ZP_01261594.1| survival protein SurA [Vibrio alginolyticus 12G01]
 gi|269964662|ref|ZP_06178900.1| survival protein SurA [Vibrio alginolyticus 40B]
 gi|91188762|gb|EAS75049.1| survival protein SurA [Vibrio alginolyticus 12G01]
 gi|269830561|gb|EEZ84782.1| survival protein SurA [Vibrio alginolyticus 40B]
          Length = 427

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 36/310 (11%), Positives = 112/310 (36%), Gaps = 12/310 (3%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE---- 71
           +  +  ++   ++   +  +     ++   +N  V+   DI   +  L+           
Sbjct: 1   MKIWKSILFTTLLSCGAVAAPVEIDKVAVIVNDGVVLQSDIETAMKTLQANARQSGKSLP 60

Query: 72  ----LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
               L++  V++LI++TL+ QE ++ G+  D N +N    + ARN   S E  ++ ++ +
Sbjct: 61  STSVLKEQVVEKLIIDTLQGQEADRIGVRIDDNRLNQAIAEIARNNEQSVEQLAASVESE 120

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI 187
           G+    F++ +  +    +        +   L  E+ +  +++   T      +     +
Sbjct: 121 GLSYPEFREQIRKEIAASEARNALVRRRINILPAEVDSLAEQLSQETNATVQYKIGHIQL 180

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
             +  + +  V+   K   +              ++     +  G   ++ + ++   F 
Sbjct: 181 RFSDDKEKSAVEAEAKALAKKLNEGADFTEMAYTYSKGPKALQGGDWGWMRKEEMPTIFA 240

Query: 248 NL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKHEAE 303
           +    +++ +   P+ +  G   + I D +    +        ++  + T    ++   +
Sbjct: 241 DQIKMQNKGSIIGPFRSGVGFHILKIEDVKGLETVAVTEVNARHILIKPTVILSDEGAKK 300

Query: 304 YVKKLRSNAI 313
            + +      
Sbjct: 301 QLNEFVRRIK 310



 Score = 79.3 bits (193), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 30/270 (11%), Positives = 79/270 (29%), Gaps = 4/270 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++      L  +       KI   +L     K++   ++     +  +N       
Sbjct: 151 ILPAEVDSLAEQLSQETNATVQYKIGHIQLRFSDDKEKSAVEAEAKALAKKLNEGADFTE 210

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +        +   I   +   
Sbjct: 211 MAYTYSKGPKALQGGDWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIEDVK 270

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK-LEKFASKI-HD 228
              TV    +      I    + +    +K++ +             +   +++      
Sbjct: 271 GLETVAVTEVNARHILIKPTVILSDEGAKKQLNEFVRRIKAGEATFAQLATQYSQDPGSA 330

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ ++     + + P+ T  G   + + D+R +   + A+K 
Sbjct: 331 AQDGELGYQTPDLYVPEFKHQVETLPVGSISEPFKTVHGWHIVEVLDRRQVDRTDSAMKN 390

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                    K  +    ++++LR++A +  
Sbjct: 391 KAYRILFNRKFNEEAGAWMQELRASAFVEI 420


>gi|298506467|gb|ADI85190.1| peptidylprolyl cis-trans isomerase, PpiC-type [Geobacter
           sulfurreducens KN400]
          Length = 351

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 43/289 (14%), Positives = 91/289 (31%), Gaps = 16/289 (5%)

Query: 42  IRTTINGEVITDGDISKRIALLKLQKI---------NGELEKIAVQELIVETLKKQEIEK 92
           +   +NG  IT  ++ +   +L  Q             ++E+ AV +LI + L  Q   K
Sbjct: 61  VVVKVNGVAITRAEVDRAKKVLMSQNRMTQPMTPDIAQKVEEAAVSQLIAKELLYQAGRK 120

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
             I      V     Q         E   +      + +   + +     +  ++++ + 
Sbjct: 121 QEIKDLDKQVQERVSQSKARFPSQEEYLKTL-KSMDMTEKDVETFAREDLVINNLIEKEV 179

Query: 153 MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR- 211
           + K    + +         +   R+  ++     I      +    +K  + AE    + 
Sbjct: 180 VAKTTVSDEDAKKFYNDNIDKFKRDETVKASHILIKVEPNASADDKKKAKEKAEAILKQV 239

Query: 212 --LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLK-KSQNNTTNPYVTQKGVE 268
                     +K +        G   +  +  + P F+           ++   TQ G  
Sbjct: 240 KGGADFAEVAKKESGCPSAPQGGDLGFFGKGQMVPPFEKAAFAMKPGEVSDVVETQFGYH 299

Query: 269 YIAICDKRDLGG--EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            I + DKR          K  +       K+++   EYV+ L+  A I 
Sbjct: 300 IIKLTDKRPAETVKFEETKDRIVQFLKQQKVQEGINEYVENLKKAAKIE 348


>gi|153803547|ref|ZP_01958133.1| survival protein SurA [Vibrio cholerae MZO-3]
 gi|297580585|ref|ZP_06942511.1| survival protein SurA [Vibrio cholerae RC385]
 gi|124120914|gb|EAY39657.1| survival protein SurA [Vibrio cholerae MZO-3]
 gi|297535001|gb|EFH73836.1| survival protein SurA [Vibrio cholerae RC385]
          Length = 431

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 35/313 (11%), Positives = 108/313 (34%), Gaps = 12/313 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +KL     + ++  +    ++        +   +N  VI   D+   +  +K      + 
Sbjct: 1   MKLWKPTLISVLSALTLFNAHAEPKQLDSVAVIVNSGVILQSDVDSALKTIKANAKQNKQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++TL++QE ++ G+  D N +N    + A+N   + E   + +
Sbjct: 61  PLPQETVLREQVLEKLIIDTLQQQEADRIGVKIDDNRLNEAIKEIAKNNQQTQEQLIASV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            ++G+    F++ +  +    D        +   L  E+    + +   T      +   
Sbjct: 121 AQEGLTYPEFREQVRKEMAASDARNALVRRRINILPAEVDTLAELLAQETDATVQYKISH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +  +  Q++   +                      ++     +  G   ++ + ++  
Sbjct: 181 IQLRVDDGQDKSAAETLANKLVNDLRNGADFAQMAYAYSKGPKALQGGDWGWMRKEEMPT 240

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F +    +++ +   P+ +  G   + I D +    +        ++  + T    ++ 
Sbjct: 241 IFADQIKMQNKGSIIGPFRSGVGFHILKIDDVKGLETVAVTEVNARHILIKPTIILSDEG 300

Query: 301 EAEYVKKLRSNAI 313
             + + +      
Sbjct: 301 AQKQLNEFVQRIK 313



 Score = 82.8 bits (202), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 33/269 (12%), Positives = 82/269 (30%), Gaps = 4/269 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     LL  +       KI+  +L V+  + +   ++      N +        
Sbjct: 154 ILPAEVDTLAELLAQETDATVQYKISHIQLRVDDGQDKSAAETLANKLVNDLRNGADFAQ 213

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +        +   I       
Sbjct: 214 MAYAYSKGPKALQGGDWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIDDVK 273

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKI-HD 228
              TV    +      I    + +    QK++ +  +             ++++      
Sbjct: 274 GLETVAVTEVNARHILIKPTIILSDEGAQKQLNEFVQRIKNGEVTFAELAQQYSQDPGSA 333

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ ++       + P+ T  G   + + D+R++   + ALK 
Sbjct: 334 AQKGELGYQTPDLYVPEFKHQIETLPVGQISEPFKTVHGWHIVEVLDRREVDRTDSALKN 393

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
                    K  +  + ++++LR++A + 
Sbjct: 394 KAYRILFNRKFNEEASAWLQELRASAFVE 422


>gi|148255225|ref|YP_001239810.1| hypothetical protein BBta_3828 [Bradyrhizobium sp. BTAi1]
 gi|146407398|gb|ABQ35904.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 312

 Score =  133 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 52/311 (16%), Positives = 118/311 (37%), Gaps = 3/311 (0%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI 68
           ++           +    ++   +    A +  I   +NG+ ITD DI +R+ L  L   
Sbjct: 1   MTIAFSSRLRALAICSLAVLASGAGLIPAQAQSIVVMVNGDPITDYDIEQRMKLNFLSTR 60

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
             +  +  + ELI + +K +E +K G+   ++ V+  F        L+AE  +  L+ QG
Sbjct: 61  KQQSRQEVINELIDDKVKIKEGKKFGVEPTASDVDQSFAGMGSRMRLNAEQLTKSLESQG 120

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLK--YGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
           +     K  +  + +W  +V+  +  +    + ++          +    +     +   
Sbjct: 121 VRPETLKARIKAEIVWTSLVRGRYKERLLVSDKDVAAAVAAAGGDSDQQGQAFEYKMQPI 180

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           +      +   V +      E+     + C           +  I +      +D+ P  
Sbjct: 181 VLIVSNSSNQAVMEARHKEAEALRARVQTCADANNVFKTTANAVIKEIVVKTSADIPPNL 240

Query: 247 QNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYV 305
           + LL  +   + T P  T++G++ +A+C +     +   K  +  +    K E     Y+
Sbjct: 241 RKLLDDTPIGHLTPPEATKQGIQMVALCARTPTTVDTPKKRQIREEMYTKKYEATSKAYL 300

Query: 306 KKLRSNAIIHY 316
           +++R  A+I Y
Sbjct: 301 QEVRKAAMIEY 311


>gi|323495831|ref|ZP_08100899.1| putative parvulin-like peptidyl-prolyl isomerase [Vibrio
           sinaloensis DSM 21326]
 gi|323319047|gb|EGA71990.1| putative parvulin-like peptidyl-prolyl isomerase [Vibrio
           sinaloensis DSM 21326]
          Length = 431

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 42/313 (13%), Positives = 111/313 (35%), Gaps = 12/313 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--- 69
           +K      + ++      ++        +I   +NG VI + DI   I  LK        
Sbjct: 1   MKFWKQSLLAVLAASQFGLASAQPVALDKINVIVNGGVILESDIDTSIKTLKANAKKSGQ 60

Query: 70  -----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +   ++LI++TL++QE E+ GI  D N +N    + A+N   + E  S  +
Sbjct: 61  GLPTADVLRQQVTEKLIIDTLQQQEAERIGIRIDDNRLNEAIEEIAKNNNQTIEQLSDSI 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
             +G+  + F++ +  +    +        +   L  E+      +   T      +   
Sbjct: 121 AAEGLEYSEFREQVRKEIAATEARNALVRRRINILPAEVDNLANILAQETNATVQYKIGH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +  N   +   ++++ K+                 ++     +  G   ++ + ++  
Sbjct: 181 IQLRVNDGDDASAIEQQAKEIVAKLNNGSDFATMAYTYSKGPKALQGGDWGWMRKEEMPT 240

Query: 245 QFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F + +  +++ +   P+ +  G   + I D +    +        ++  + T    +  
Sbjct: 241 IFADQVGVQNKGSIIGPFRSGVGFHILKIEDVKGLETVAVTEVNARHILIRPTVILSDDG 300

Query: 301 EAEYVKKLRSNAI 313
             + + ++ +   
Sbjct: 301 VQKELNEIIARIQ 313



 Score = 78.6 bits (191), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/269 (11%), Positives = 75/269 (27%), Gaps = 4/269 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     +L  +       KI   +L V         +         +N       
Sbjct: 154 ILPAEVDNLANILAQETNATVQYKIGHIQLRVNDGDDASAIEQQAKEIVAKLNNGSDFAT 213

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    +      +        +   I   +   
Sbjct: 214 MAYTYSKGPKALQGGDWGWMRKEEMPTIFADQVGVQNKGSIIGPFRSGVGFHILKIEDVK 273

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDC-NKLEKFASKI-HD 228
              TV    +      I    + +   VQK + +                 +++      
Sbjct: 274 GLETVAVTEVNARHILIRPTVILSDDGVQKELNEIIARIQSGEATFGELARQYSQDPGSA 333

Query: 229 VSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ +    +   + P+ T  G   + + D+R +   + A+K 
Sbjct: 334 AQNGELGYQTSDLYVPEFKHQVDTLPEGKISQPFKTVHGWHIVEVLDRRQVDRTDSAMKN 393

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
                    K  +  + ++++LR++A + 
Sbjct: 394 KAYRILFNRKFNEEASAWLQELRASAFVE 422


>gi|197116616|ref|YP_002137043.1| PpiC-type peptidylprolyl cis-trans isomerase [Geobacter
           bemidjiensis Bem]
 gi|197085976|gb|ACH37247.1| peptidylprolyl cis-trans isomerase, PpiC-type, SurA family
           [Geobacter bemidjiensis Bem]
          Length = 317

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 43/295 (14%), Positives = 90/295 (30%), Gaps = 13/295 (4%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN------GELEKIAVQELIVETLKK 87
            +    S I   +N E+IT  ++ K    ++             L   A+  L+   L +
Sbjct: 21  STAKQVSGIAAIVNDEIITTQELDKEYLQIQKDADKVPGSDKSGLRGAALNRLVERKLIE 80

Query: 88  QEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDV 147
           Q+I +  I      V        +   L+ E+    L  QG+    ++  L  Q     +
Sbjct: 81  QKIRELNINVSDEEVRLAIEDVKKQNNLTQENLEQALVTQGLTLAQYRTQLKEQMERLRL 140

Query: 148 VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQ---NQGFVQKRIKD 204
           +  +   K    E E+    Q          +          +K          + R  +
Sbjct: 141 MSQEVRSKVQVGEREMREYYQANIAAYGGSEVYSARHIFFKVDKKGGAGELSKAETRANE 200

Query: 205 AEESRLRLPKDCNKLEKFASKIHD-VSIGKAQYLLESDL-HPQFQNLLKKSQNNTTNPYV 262
                          +K++         G      ++D+       +        ++   
Sbjct: 201 VLAKARAGEDFAALAKKYSDDPAAAKDGGDLGTFKKADMLPEIGDTVSAMKPGEVSSIVR 260

Query: 263 TQKGVEYIAICDKRD--LGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           +  G+  I +  K+         +K  +       K ++  A++VK+LR+ A I 
Sbjct: 261 SPAGLHIIKLEGKKQDAGRPFEQVKDSIEDTLYKKKSDERFAQWVKELRAGAAIE 315


>gi|312797257|ref|YP_004030179.1| peptidyl-prolyl cis-trans isomerase [Burkholderia rhizoxinica HKI
           454]
 gi|312169032|emb|CBW76035.1| Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) [Burkholderia
           rhizoxinica HKI 454]
          Length = 512

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 39/309 (12%), Positives = 110/309 (35%), Gaps = 24/309 (7%)

Query: 29  PIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--------ELEKIAVQEL 80
            ++S+++     RI   +N +VIT  ++  R+ L+  +            +L+   + ++
Sbjct: 92  ALLSHQAGQEVDRIVAVVNNDVITRRELDLRMGLITRRLQQQGAPLPSPDQLQLQVLNQM 151

Query: 81  IVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAI 140
           ++E ++ Q  ++ GI  D  T+ +   + A+   +S + + + L+ +G+  + F      
Sbjct: 152 VLERIQLQRAKEDGIVVDDATLQHTLARLAQANNMSLDMYRARLEAEGVPWSVFSADARN 211

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPAN----KQKMKNITVREYLIRTVLFSIPDNKLQNQG 196
           + +   + + +   +    + E+       +  M+ +         ++ +  +       
Sbjct: 212 ELLLSKLREKEVDSRITVSDAEVANYIASQRGPMQRVQQDLRFEHILIKAALNAPQTEIE 271

Query: 197 FVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNN 256
             +++  +  +  L         +  +        G   +   S L         + +  
Sbjct: 272 AARQKASELLKRALASENFARLAKDNSQAPDASKGGDLGFRSTSALPEAMTQAASQLRPG 331

Query: 257 TTNP--YVTQKGVEYIAICDKRDLGGE--------IALKAYLSAQNTPTKIEKHEAEYVK 306
             NP    T +G E + + D+R   G              ++  +    + E    + + 
Sbjct: 332 QVNPEVLRTPEGFEIVRLVDRRVSSGMGSEAPRLVQTHARHILIRIGEGQPEPAARQKLV 391

Query: 307 KLRSNAIIH 315
           +LR    I 
Sbjct: 392 ELREQ--IE 398



 Score =  114 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 31/284 (10%), Positives = 87/284 (30%), Gaps = 22/284 (7%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQ---ELIV------ETLKKQEIEKSGITFDSNT 101
           IT  D ++    +  Q+   +  +  ++    LI       +T  +   +K+        
Sbjct: 227 ITVSD-AEVANYIASQRGPMQRVQQDLRFEHILIKAALNAPQTEIEAARQKASELLKRAL 285

Query: 102 VNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEM 161
            +  F + A++   + +                +           +       +      
Sbjct: 286 ASENFARLAKDNSQAPDASKGGDLGFRSTSALPEAMTQ---AASQLRPGQVNPEVLRTPE 342

Query: 162 EIPANKQKMKNITVRE-------YLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
                +   + ++                   I   + Q +   ++++ +  E       
Sbjct: 343 GFEIVRLVDRRVSSGMGSEAPRLVQTHARHILIRIGEGQPEPAARQKLVELREQIEAGGD 402

Query: 215 DCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAIC 273
             N    ++        G   ++   +  P+F+  +        + P  T+ G   I + 
Sbjct: 403 FANFAHTYSQDGSASQGGDLGWISPGETVPEFERAMNNLKDGEISQPIRTEYGYHLIQVM 462

Query: 274 DKRDLGGEIALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            +R+  G +A +  +        K E+  A+++++LR +A + Y
Sbjct: 463 GRREAQGSVAQQQEIARQAIGQRKAEQAYADWLRQLRDSAYVQY 506


>gi|86357089|ref|YP_468981.1| peptidyl-prolyl cis-trans isomerase protein [Rhizobium etli CFN 42]
 gi|86281191|gb|ABC90254.1| probable peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           etli CFN 42]
          Length = 314

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 81/311 (26%), Positives = 151/311 (48%), Gaps = 11/311 (3%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           K +T +       ++  ++  + A +S ++  +NG  IT GD++KR A L+LQ    +  
Sbjct: 6   KAITAFLAGAAIALLTGLAGPALA-ASGVQAVVNGTAITSGDVAKRQAFLRLQHTKADA- 63

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           K A ++LI ETLK+QE+ +  ++     V+  F + +    LS E  S  LD+ G+G +H
Sbjct: 64  KTATEQLIDETLKRQEVARVHMSVSQQDVDASFARFSAGNKLSVEQMSQILDRAGVGVDH 123

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQ 193
           FK ++A+Q  WP VV   +         ++ +   +                     + +
Sbjct: 124 FKGFIAVQMSWPRVVNARYGSTSRLSNYDLVSRMMQNNKQKPVTTEYMLQQIIFVIPEAK 183

Query: 194 NQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS 253
                 KR  +AE SR + P   ++ + FA+ + DVS+     +L  ++ P +++L++++
Sbjct: 184 RGAITGKRKGEAEASRSKFPGC-DQAKTFAATMRDVSVRDLGRMLAPEIPPDWKSLVEQA 242

Query: 254 QNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKI--------EKHEAEYV 305
           + NTT   VT+KGVEY+AIC +R +  + A +     ++              ++  +Y+
Sbjct: 243 KGNTTGTRVTEKGVEYLAICSQRQVSDDQAAEMVFRQEDLDKSKAGKNGPPENENSKKYL 302

Query: 306 KKLRSNAIIHY 316
            +LR  A I Y
Sbjct: 303 DELRKKAQIAY 313


>gi|15640472|ref|NP_230099.1| survival protein SurA [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121729954|ref|ZP_01682374.1| survival protein SurA [Vibrio cholerae V52]
 gi|147674503|ref|YP_001218713.1| survival protein SurA [Vibrio cholerae O395]
 gi|153823925|ref|ZP_01976592.1| survival protein SurA [Vibrio cholerae B33]
 gi|227080656|ref|YP_002809207.1| survival protein SurA [Vibrio cholerae M66-2]
 gi|229507084|ref|ZP_04396590.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholerae BX
           330286]
 gi|229508761|ref|ZP_04398253.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholerae B33]
 gi|229519748|ref|ZP_04409191.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholerae RC9]
 gi|229606260|ref|YP_002876908.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholerae MJ-1236]
 gi|254850676|ref|ZP_05240026.1| chaperone surA precursor [Vibrio cholerae MO10]
 gi|255743828|ref|ZP_05417785.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholera CIRS 101]
 gi|262147181|ref|ZP_06027987.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholerae INDRE
           91/1]
 gi|262167591|ref|ZP_06035295.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholerae RC27]
 gi|298501023|ref|ZP_07010824.1| survival protein SurA [Vibrio cholerae MAK 757]
 gi|81788531|sp|Q9KUS0|SURA_VIBCH RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|9654869|gb|AAF93618.1| survival protein SurA [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121628294|gb|EAX60804.1| survival protein SurA [Vibrio cholerae V52]
 gi|126518552|gb|EAZ75775.1| survival protein SurA [Vibrio cholerae B33]
 gi|146316386|gb|ABQ20925.1| survival protein SurA [Vibrio cholerae O395]
 gi|227008544|gb|ACP04756.1| survival protein SurA [Vibrio cholerae M66-2]
 gi|227012299|gb|ACP08509.1| survival protein SurA [Vibrio cholerae O395]
 gi|229344437|gb|EEO09412.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholerae RC9]
 gi|229354164|gb|EEO19095.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholerae B33]
 gi|229355829|gb|EEO20749.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholerae BX
           330286]
 gi|229368915|gb|ACQ59338.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholerae MJ-1236]
 gi|254846381|gb|EET24795.1| chaperone surA precursor [Vibrio cholerae MO10]
 gi|255738577|gb|EET93965.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholera CIRS 101]
 gi|262023927|gb|EEY42624.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholerae RC27]
 gi|262031386|gb|EEY49994.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholerae INDRE
           91/1]
 gi|297540271|gb|EFH76331.1| survival protein SurA [Vibrio cholerae MAK 757]
          Length = 431

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 35/313 (11%), Positives = 108/313 (34%), Gaps = 12/313 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +KL     + ++  +    ++        +   +N  VI   D+   +  +K      + 
Sbjct: 1   MKLWKPTLISVLSALTLFNAHAEPKQLDSVAVIVNSGVILQSDVDSALKTIKANAKQNKQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++TL++QE ++ G+  D N +N    + A+N   + E   + +
Sbjct: 61  PLPQETVLREQVLEKLIIDTLQQQEADRIGVKIDDNRLNEAIKEIAKNNQQTQEQLIASV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            ++G+    F++ +  +    D        +   L  E+    + +   T      +   
Sbjct: 121 AQEGLTYPEFREQVRKEMAASDARNALVRRRINILPAEVDTLAELLAQETDATVQYKISH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +  +  Q++   +                      ++     +  G   ++ + ++  
Sbjct: 181 IQLRVDDGQDKSTAETLANKLVNDLRNGADFAQMAYAYSKGPKALQGGDWGWMRKEEMPT 240

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F +    +++ +   P+ +  G   + I D +    +        ++  + T    ++ 
Sbjct: 241 IFADQIKMQNKGSIIGPFRSGVGFHILKIDDVKGLETVAVTEVNARHILIKPTIILSDEG 300

Query: 301 EAEYVKKLRSNAI 313
             + + +      
Sbjct: 301 AQKQLNEFVQRIK 313



 Score = 83.2 bits (203), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 33/269 (12%), Positives = 82/269 (30%), Gaps = 4/269 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     LL  +       KI+  +L V+  + +   ++      N +        
Sbjct: 154 ILPAEVDTLAELLAQETDATVQYKISHIQLRVDDGQDKSTAETLANKLVNDLRNGADFAQ 213

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +        +   I       
Sbjct: 214 MAYAYSKGPKALQGGDWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIDDVK 273

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKI-HD 228
              TV    +      I    + +    QK++ +  +             ++++      
Sbjct: 274 GLETVAVTEVNARHILIKPTIILSDEGAQKQLNEFVQRIKNGEVTFAELAQQYSQDPGSA 333

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ ++       + P+ T  G   + + D+R++   + ALK 
Sbjct: 334 AQKGELGYQTPDLYVPEFKHQIETLPVGQISEPFKTVHGWHIVEVLDRREVDRTDSALKN 393

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
                    K  +  + ++++LR++A + 
Sbjct: 394 KAYRILFNRKFNEEASAWLQELRASAFVE 422


>gi|254292211|ref|ZP_04962978.1| survival protein SurA [Vibrio cholerae AM-19226]
 gi|150421868|gb|EDN13848.1| survival protein SurA [Vibrio cholerae AM-19226]
          Length = 431

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 35/313 (11%), Positives = 108/313 (34%), Gaps = 12/313 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +KL     + ++  +    ++        +   +N  VI   D+   +  +K      + 
Sbjct: 1   MKLWKPTLISVLSALTLFNAHAEPKQLDSVAVIVNSGVILQSDVDSALKTIKANAKQNKQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++TL++QE ++ G+  D N +N    + A+N   + E   + +
Sbjct: 61  PLPQETVLREQVLEKLIIDTLQQQEADRIGVKIDDNRLNEAIKEIAKNNQQTQEQLIASI 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            ++G+    F++ +  +    D        +   L  E+    + +   T      +   
Sbjct: 121 AQEGLTYPEFREQVRKEMAASDARNALVRRRINILPAEVDTLAELLAQETDATVQYKISH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +  +  Q++   +                      ++     +  G   ++ + ++  
Sbjct: 181 IQLRVDDGQDKSAAETLANKLVNDLRNGADFAQMAYAYSKGPKALQGGDWGWMRKEEMPT 240

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F +    +++ +   P+ +  G   + I D +    +        ++  + T    ++ 
Sbjct: 241 IFADQIKMQNKGSIIGPFRSGVGFHILKIDDVKGLETVAVTEVNARHILIKPTIILSDEG 300

Query: 301 EAEYVKKLRSNAI 313
             + + +      
Sbjct: 301 AQKQLNEFVQRIK 313



 Score = 82.4 bits (201), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 33/269 (12%), Positives = 82/269 (30%), Gaps = 4/269 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     LL  +       KI+  +L V+  + +   ++      N +        
Sbjct: 154 ILPAEVDTLAELLAQETDATVQYKISHIQLRVDDGQDKSAAETLANKLVNDLRNGADFAQ 213

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +        +   I       
Sbjct: 214 MAYAYSKGPKALQGGDWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIDDVK 273

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKI-HD 228
              TV    +      I    + +    QK++ +  +             ++++      
Sbjct: 274 GLETVAVTEVNARHILIKPTIILSDEGAQKQLNEFVQRIKNGEVTFAELAQQYSQDPGSA 333

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ ++       + P+ T  G   + + D+R++   + ALK 
Sbjct: 334 AQKGELGYQTPDLYVPEFKHQIETLPVGQISEPFKTVHGWHIVEVLDRREVDRTDSALKN 393

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
                    K  +  + ++++LR++A + 
Sbjct: 394 KAYRILFNRKFNEEASAWLQELRASAFVE 422


>gi|153827415|ref|ZP_01980082.1| survival protein SurA [Vibrio cholerae MZO-2]
 gi|149738658|gb|EDM53001.1| survival protein SurA [Vibrio cholerae MZO-2]
          Length = 431

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 35/313 (11%), Positives = 108/313 (34%), Gaps = 12/313 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +KL     + ++  +    ++        +   +N  VI   D+   +  +K      + 
Sbjct: 1   MKLWKPTLISVLSALTLFNAHAEPKQLDSVAVIVNSGVILQSDVDSALKTIKANAKQNKQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++TL++QE ++ G+  D N +N    + A+N   + E   + +
Sbjct: 61  PLPQETVLREQVLEKLIIDTLQQQEADRIGVKIDDNRLNEAIKEIAKNNQQTQEQLIASV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            ++G+    F++ +  +    D        +   L  E+    + +   T      +   
Sbjct: 121 AQEGLTYPEFREQVRKEMAASDARNALVRRRINILPAEVDTLAELLAQETDATVQYKISH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +  +  Q++   +                      ++     +  G   ++ + ++  
Sbjct: 181 IQLRVDDGQDKNAAETLANKLVNDLKNGADFAQMAYAYSKGPKALQGGDWGWMRKEEMPT 240

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F +    +++ +   P+ +  G   + I D +    +        ++  + T    ++ 
Sbjct: 241 IFADQIKMQNKGSIIGPFRSGVGFHILKIDDVKGLETVAVTEVNARHILIKPTIILSDEG 300

Query: 301 EAEYVKKLRSNAI 313
             + + +      
Sbjct: 301 AQKQLNEFVQRIK 313



 Score = 82.4 bits (201), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 33/269 (12%), Positives = 82/269 (30%), Gaps = 4/269 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     LL  +       KI+  +L V+  + +   ++      N +        
Sbjct: 154 ILPAEVDTLAELLAQETDATVQYKISHIQLRVDDGQDKNAAETLANKLVNDLKNGADFAQ 213

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +        +   I       
Sbjct: 214 MAYAYSKGPKALQGGDWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIDDVK 273

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKI-HD 228
              TV    +      I    + +    QK++ +  +             ++++      
Sbjct: 274 GLETVAVTEVNARHILIKPTIILSDEGAQKQLNEFVQRIKNGEVTFAELAQQYSQDPGSA 333

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ ++       + P+ T  G   + + D+R++   + ALK 
Sbjct: 334 AQKGELGYQTPDLYVPEFKHQIETLPVGQISEPFKTVHGWHIVEVLDRREVDRTDSALKN 393

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
                    K  +  + ++++LR++A + 
Sbjct: 394 KAYRILFNRKFNEEASAWLQELRASAFVE 422


>gi|153217229|ref|ZP_01950993.1| survival protein SurA [Vibrio cholerae 1587]
 gi|153830824|ref|ZP_01983491.1| survival protein SurA [Vibrio cholerae 623-39]
 gi|229519985|ref|ZP_04409414.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholerae TM
           11079-80]
 gi|229525138|ref|ZP_04414543.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholerae bv.
           albensis VL426]
 gi|124113752|gb|EAY32572.1| survival protein SurA [Vibrio cholerae 1587]
 gi|148873683|gb|EDL71818.1| survival protein SurA [Vibrio cholerae 623-39]
 gi|229338719|gb|EEO03736.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholerae bv.
           albensis VL426]
 gi|229342934|gb|EEO07923.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholerae TM
           11079-80]
          Length = 431

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 35/313 (11%), Positives = 108/313 (34%), Gaps = 12/313 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +KL     + ++  +    ++        +   +N  VI   D+   +  +K      + 
Sbjct: 1   MKLWKPTLISVLSALTLFNAHAEPKQLDSVAVIVNSGVILQSDVDSALKTIKANAKQNKQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++TL++QE ++ G+  D N +N    + A+N   + E   + +
Sbjct: 61  PLPQETVLREQVLEKLIIDTLQQQEADRIGVKIDDNRLNEAIKEIAKNNQQTQEQLIASV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            ++G+    F++ +  +    D        +   L  E+    + +   T      +   
Sbjct: 121 AQEGLTYPEFREQVRKEMAASDARNALVRRRINILPAEVDTLAELLAQETDATVQYKISH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +  +  Q++   +                      ++     +  G   ++ + ++  
Sbjct: 181 IQLRVDDGQDKSAAETLANKLVNDLKNGADFAQMAYAYSKGPKALQGGDWGWMRKEEMPT 240

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F +    +++ +   P+ +  G   + I D +    +        ++  + T    ++ 
Sbjct: 241 IFADQIKMQNKGSIIGPFRSGVGFHILKIDDVKGLETVAVTEVNARHILIKPTIILSDEG 300

Query: 301 EAEYVKKLRSNAI 313
             + + +      
Sbjct: 301 AQKQLNEFVQRIK 313



 Score = 82.4 bits (201), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 33/269 (12%), Positives = 82/269 (30%), Gaps = 4/269 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     LL  +       KI+  +L V+  + +   ++      N +        
Sbjct: 154 ILPAEVDTLAELLAQETDATVQYKISHIQLRVDDGQDKSAAETLANKLVNDLKNGADFAQ 213

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +        +   I       
Sbjct: 214 MAYAYSKGPKALQGGDWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIDDVK 273

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKI-HD 228
              TV    +      I    + +    QK++ +  +             ++++      
Sbjct: 274 GLETVAVTEVNARHILIKPTIILSDEGAQKQLNEFVQRIKNGEVTFAELAQQYSQDPGSA 333

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ ++       + P+ T  G   + + D+R++   + ALK 
Sbjct: 334 AQKGELGYQTPDLYVPEFKHQIETLPVGQISEPFKTVHGWHIVEVLDRREVDRTDSALKN 393

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
                    K  +  + ++++LR++A + 
Sbjct: 394 KAYRILFNRKFNEEASAWLQELRASAFVE 422


>gi|238918641|ref|YP_002932155.1| peptidyl-prolyl cis-trans isomerase SurA [Edwardsiella ictaluri
           93-146]
 gi|238868209|gb|ACR67920.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 434

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 39/311 (12%), Positives = 112/311 (36%), Gaps = 18/311 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   +    ++ +  +  ++   ++  V+ + D+   +  +KL              L
Sbjct: 7   LILGVALCANTAFAAPQVVDKVVAIVDNGVVLESDVDGMMKSVKLNAQQAGQQLPDDATL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ ++ Q  ++ G+    + ++      A+   +S +   S L   G+   
Sbjct: 67  RHQILERLIMDNVQLQMAKRMGLEISDSELDNAINGIAQQNHISMQQLRSRLAADGLDYK 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            ++  +  + +  +V  N+   +   L  E+ A  +++ +    E  +      IP  + 
Sbjct: 127 TYRDQIRKEMLISEVRNNEVRSRVTILPQEVDALAKQIGSQNSGETAVNLSHILIPLPEN 186

Query: 193 QNQGFVQKRIKDAE---ESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
             Q  V +  K AE   +   +          +++    +  G+  +    +L   F + 
Sbjct: 187 PTQQQVSEAQKQAESLIQQLHQGASFAKLAAAYSADPQALKGGEMGWGRLQELPTLFAEA 246

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKHEAEY 304
           L    + +   P  +  G   + + D R     +        ++  + +P   +      
Sbjct: 247 LQSAKKGDIVGPIRSGVGFHILRVNDLRGDQASVSVTEVHARHILLRPSPVMSDTQARAK 306

Query: 305 VKKLRSNAIIH 315
           ++ L  +A I 
Sbjct: 307 LEAL--SAQIK 315



 Score = 89.0 bits (218), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 35/285 (12%), Positives = 85/285 (29%), Gaps = 17/285 (5%)

Query: 47  NGEV-----ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNT 101
           N EV     I   ++      +  Q        ++   LI       + + S     + +
Sbjct: 143 NNEVRSRVTILPQEVDALAKQIGSQNSGETAVNLS-HILIPLPENPTQQQVSEAQKQAES 201

Query: 102 VNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND-------FML 154
           +     Q A    L+A   +     +G      +           +              
Sbjct: 202 LIQQLHQGASFAKLAAAYSADPQALKGGEMGWGRLQELPTLFAEALQSAKKGDIVGPIRS 261

Query: 155 KYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
             G   + +   +    +++V E   R +L   P   + +     K    + + +     
Sbjct: 262 GVGFHILRVNDLRGDQASVSVTEVHARHIL-LRPSPVMSDTQARAKLEALSAQIKSGQIT 320

Query: 215 DCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAI 272
                ++++         G   + + S   P F++  +K ++   + P  +  G   I +
Sbjct: 321 FEQAAKEYSQDPGSAQKGGDLGWAVPSMYDPAFRDALMKLNKGEISQPVHSNFGWHLIQL 380

Query: 273 CDKRDLG-GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            D R +   + A K          K  +    ++++ R+ A +  
Sbjct: 381 LDTRQVDRTDEAQKERAYRMLFNRKFAEEAQTWLQEQRAAAYVKI 425


>gi|229530289|ref|ZP_04419677.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholerae 12129(1)]
 gi|229332062|gb|EEN97550.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholerae 12129(1)]
          Length = 431

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 36/313 (11%), Positives = 108/313 (34%), Gaps = 12/313 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +KL     + ++  +    ++        +   +N  VI   D+   +  +K      + 
Sbjct: 1   MKLWKPTLISVLSALTLFNAHAEPKQLDSVAVIVNSGVILQSDVDSALKTIKANAKQNKQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++TL++QE ++ G+  D N +N    + A+N   + E   + +
Sbjct: 61  PLPQETVLREQVLEKLIIDTLQQQEADRIGVKIDDNRLNEAIKEIAKNNQQTQEQLIASV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            K+G+    F++ +  +    D        +   L  E+    + +   T      +   
Sbjct: 121 AKEGLTYPEFREQVRKEMAASDARNALVRRRINILPAEVDTLAELLAQETDATVQYKISH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +  +  Q++   +                      ++     +  G   ++ + ++  
Sbjct: 181 IQLRVDDGQDKSAAETLANKLVNDLKNGADFAQMAYAYSKGPKALQGGDWGWMRKEEMPT 240

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F +    +++ +   P+ +  G   + I D +    +        ++  + T    ++ 
Sbjct: 241 IFADQIKMQNKGSIIGPFRSGVGFHILKIDDVKGLETVAVTEVNARHILIKPTIILSDEG 300

Query: 301 EAEYVKKLRSNAI 313
             + + +      
Sbjct: 301 AQKQLNEFVQRIK 313



 Score = 82.4 bits (201), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 33/269 (12%), Positives = 82/269 (30%), Gaps = 4/269 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     LL  +       KI+  +L V+  + +   ++      N +        
Sbjct: 154 ILPAEVDTLAELLAQETDATVQYKISHIQLRVDDGQDKSAAETLANKLVNDLKNGADFAQ 213

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +        +   I       
Sbjct: 214 MAYAYSKGPKALQGGDWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIDDVK 273

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKI-HD 228
              TV    +      I    + +    QK++ +  +             ++++      
Sbjct: 274 GLETVAVTEVNARHILIKPTIILSDEGAQKQLNEFVQRIKNGEVTFAELAQQYSQDPGSA 333

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ ++       + P+ T  G   + + D+R++   + ALK 
Sbjct: 334 AQKGELGYQTPDLYVPEFKHQIETLPVGQISEPFKTVHGWHIVEVLDRREVDRTDSALKN 393

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
                    K  +  + ++++LR++A + 
Sbjct: 394 KAYRILFNRKFNEEASAWLQELRASAFVE 422


>gi|262403929|ref|ZP_06080486.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio sp. RC586]
 gi|262349891|gb|EEY99027.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio sp. RC586]
          Length = 431

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 35/313 (11%), Positives = 108/313 (34%), Gaps = 12/313 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +KL     + ++  +    ++        +   +N  VI   D+   +  +K      + 
Sbjct: 1   MKLWKPTLISVLSALTLFNAHAEPKQLDSVAVIVNSGVILQSDVDSALKTIKANAKQNKQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++TL++QE ++ G+  D N +N    + A+N   + E   + +
Sbjct: 61  PLPQETVLREQVLEKLIIDTLQQQEADRIGVKIDDNRLNEAIKEIAKNNQQTQEQLIASV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            ++G+    F++ +  +    D        +   L  E+    + +   T      +   
Sbjct: 121 AQEGLTYPEFREQIRKEMAASDARNALVRRRINILPAEVDTLAELLAQETDATVQYKISH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +  +  Q++   +                      ++     +  G   ++ + ++  
Sbjct: 181 IQLRVDDGQDKSAAETLANKLVNDLKNGADFAQMAYAYSKGPKALQGGDWGWMRKEEMPT 240

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F +    +++ +   P+ +  G   + I D +    +        ++  + T    ++ 
Sbjct: 241 IFADQIKMQNKGSIIGPFRSGVGFHILKIDDVKGLETVAVTEVNARHILIKPTIILSDEG 300

Query: 301 EAEYVKKLRSNAI 313
             + + +      
Sbjct: 301 AQKQLNEFVQRIK 313



 Score = 82.4 bits (201), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 33/269 (12%), Positives = 82/269 (30%), Gaps = 4/269 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     LL  +       KI+  +L V+  + +   ++      N +        
Sbjct: 154 ILPAEVDTLAELLAQETDATVQYKISHIQLRVDDGQDKSAAETLANKLVNDLKNGADFAQ 213

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +        +   I       
Sbjct: 214 MAYAYSKGPKALQGGDWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIDDVK 273

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKI-HD 228
              TV    +      I    + +    QK++ +  +             ++++      
Sbjct: 274 GLETVAVTEVNARHILIKPTIILSDEGAQKQLNEFVQRIKNGEVTFAELAQQYSQDPGSA 333

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ ++       + P+ T  G   + + D+R++   + ALK 
Sbjct: 334 AQKGELGYQTPDLYVPEFKHQIETLPVGQISEPFKTVHGWHIVEVLDRREVDRTDSALKN 393

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
                    K  +  + ++++LR++A + 
Sbjct: 394 KAYRILFNRKFNEEASAWLQELRASAFVE 422


>gi|240949661|ref|ZP_04753996.1| peptidyl-prolyl cis-trans isomerase SurA [Actinobacillus minor
           NM305]
 gi|240295919|gb|EER46595.1| peptidyl-prolyl cis-trans isomerase SurA [Actinobacillus minor
           NM305]
          Length = 317

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 58/316 (18%), Positives = 106/316 (33%), Gaps = 15/316 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +K  +   +L+ F     +S   +A   R+  T++G +I +  +++    L  +      
Sbjct: 1   MKFTSAKSLLVAFVATLGLSQSLFAAEERVVATVDGNMIMESQVARA---LGKKANTEAN 57

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            K A++ +I E L ++ I++SG+  D   V+    + A   GL+       LD QGI  N
Sbjct: 58  RKAALESIIDEMLVQKAIQQSGVKVDYRRVDQAIEEIAARNGLTYGQLLDALDYQGISLN 117

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITV---------REYLIRTV 183
            ++Q +A Q +   V              E+ A  Q +                    + 
Sbjct: 118 QYRQQIAQQMMMEAVRHQSIGKSIQVNPEEVRAQAQALMAKDKAAGKLKAVSGTEPRISH 177

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQY-LLESD 241
           +       L +     K      + +          +  +         G   +  L+  
Sbjct: 178 ILIKTTPVLNDAQAKAKLNSIIADIKAGKTTFEEAAKANSVDYVSAADGGDLGFNFLDIY 237

Query: 242 LHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKH 300
                    K  Q   T P+ +Q G   + + D R         A     Q    + E  
Sbjct: 238 DPAFANAAAKAKQGQITAPFKSQFGWHILKVTDSRQGDRTEDAYAQRAYEQLANQQAEAA 297

Query: 301 EAEYVKKLRSNAIIHY 316
             ++VK LR  A I Y
Sbjct: 298 SKDWVKALRKTANIQY 313


>gi|254509382|ref|ZP_05121467.1| chaperone SurA [Vibrio parahaemolyticus 16]
 gi|219547690|gb|EED24730.1| chaperone SurA [Vibrio parahaemolyticus 16]
          Length = 431

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 43/313 (13%), Positives = 110/313 (35%), Gaps = 12/313 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--- 69
           +K      + +       ++Y       +I   +N  VI + DI   I  LK        
Sbjct: 1   MKFWKKSLLALFAASQFTLAYAQPVALDKINVIVNSGVILESDIDTSIKTLKANARKNGQ 60

Query: 70  -----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +   ++LI++TL++QE E+ G+  D N +N    + A+N   + E  S  +
Sbjct: 61  GLPEQEVLRQQVTEKLIIDTLQQQEAERIGVRIDDNRLNQAIEEIAKNNNQTIEQLSDSI 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
             +G+  + F++ +  +    +        +   L  E+      +   T      +   
Sbjct: 121 AAEGLEYSEFREQVRKEIAATEARNALVRRRINILPAEVDNLANILAQETNATVQYKISH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +  N   +   ++K+ KD                 ++     +  G   ++ + ++  
Sbjct: 181 IQLRVNDGDDASALEKQAKDIVAKLKEGADFATMAYTYSKGPKALQGGDWGWMRKEEMPT 240

Query: 245 QFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F + +  +++ +   P+ +  G   + I D +    +        ++  + T    ++ 
Sbjct: 241 IFADNINLENKGSVIGPFRSGVGFHILKIDDVKGLETVAVTEVNARHILIRPTVILSDEG 300

Query: 301 EAEYVKKLRSNAI 313
             + + ++     
Sbjct: 301 VQKELNEIIERIQ 313



 Score = 81.3 bits (198), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 32/270 (11%), Positives = 77/270 (28%), Gaps = 4/270 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     +L  +       KI+  +L V         +         +        
Sbjct: 154 ILPAEVDNLANILAQETNATVQYKISHIQLRVNDGDDASALEKQAKDIVAKLKEGADFAT 213

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +   +I  +   +        +   I       
Sbjct: 214 MAYTYSKGPKALQGGDWGWMRKEEMPTIFADNINLENKGSVIGPFRSGVGFHILKIDDVK 273

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDC-NKLEKFASKI-HD 228
              TV    +      I    + +   VQK + +  E              +++      
Sbjct: 274 GLETVAVTEVNARHILIRPTVILSDEGVQKELNEIIERIQAGEATFGELARQYSQDPGSA 333

Query: 229 VSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ +    +   + P+ T  G   + + D+R +   + A+K 
Sbjct: 334 AQNGELGYQTSDLYVPEFKHQVDTLPEGQISEPFKTVHGWHIVEVLDRRQVDRTDSAMKN 393

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                    K  +  + ++++LR++A +  
Sbjct: 394 KAYRILFNRKFNEEASAWLQELRASAFVEI 423


>gi|220919569|ref|YP_002494873.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|219957423|gb|ACL67807.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 338

 Score =  132 bits (332), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 38/293 (12%), Positives = 94/293 (32%), Gaps = 18/293 (6%)

Query: 40  SRIRTTINGEVITDGDISKRIALLKLQKI------------NGELEKIAVQELIVETLKK 87
            R+   +NG+V+T  ++ +R A L L                 +  + A  +++ + L  
Sbjct: 37  DRVAAIVNGDVVTLQELEQRAAALGLAAADALPAGPARDKARADALRRAFDQVVSDKLFA 96

Query: 88  QEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDV 147
           ++ ++  I      V+       +  G +     S L  +G     ++  +  +     +
Sbjct: 97  EKAKELEIEVTEKQVDDAIEGVKKQNGFTDAQLESALASEGYSMTDYRARIRRELQNFSL 156

Query: 148 VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPD---NKLQNQGFVQKRIKD 204
           ++     K    E ++    Q        E  +R     IP       Q +   +   + 
Sbjct: 157 LQYKVAGKIKTSEEDLRNYYQSHPQEFDGEDEVRVRHIFIPFAEGGGAQAEAQARAEGRR 216

Query: 205 AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVT 263
             +            +  +        G+  +L    +H   ++          +     
Sbjct: 217 VLQRLKTGEDFGAVAKAVSRGPSAEEGGELGWLKRGTIHRTLEDAAFALKTGEMSGLVEA 276

Query: 264 QKGVEYIAICDKR--DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
             GV  + + ++R          +  +  +    + E +  +YV +LR +A+I
Sbjct: 277 GPGVHILKVEERRRGGGKSFEQARDEIRQRLGEEQAENYRQQYVAELRRDALI 329


>gi|332531190|ref|ZP_08407103.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Hylemonella gracilis
           ATCC 19624]
 gi|332039297|gb|EGI75710.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Hylemonella gracilis
           ATCC 19624]
          Length = 447

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 37/325 (11%), Positives = 98/325 (30%), Gaps = 25/325 (7%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSW----AMSSRIRTTINGEVITDGDISKRIALLKLQK-- 67
           ++L T  +L +          +       +  I   +N E IT+  ++  +A    Q   
Sbjct: 9   RVLCTAMLLAVLGAAQAQGTPAPPPSVRSADYIVAVVNSEPITNAQVNAEVARALRQLAA 68

Query: 68  ------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFS 121
                     L +  + +LI E  + Q   + G+  D  +V+      AR   L+     
Sbjct: 69  QRRPAPEGQALRRQVLDQLINERAQLQLAREMGLKIDEPSVDQAEQNVARQNQLTVTQLR 128

Query: 122 SFLDKQGIGDNHF-KQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVRE--- 177
             + +Q        +  L  Q +   + + +   +    + ++     + +         
Sbjct: 129 EQVQQQDGMTTQALRARLKEQLLLTRLREREVDARVKVSDADVEQYLSEQQQRNSNPASQ 188

Query: 178 -YLIRTVLFSIPDNKLQNQGFVQKRIKDAEE--SRLRLPKDCNKLEKFASKIHDVSIGKA 234
              I  +L ++P++         +R  +     +R +         + +      + G+ 
Sbjct: 189 LIHIAHILVAVPEDASATFQLESQRKAEQIARRAREKGADFAALARELSDAADRANGGQL 248

Query: 235 QYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKR-----DLGGEIALKAYL 288
                      F N ++  +    + P  +  G   + + ++R           +   ++
Sbjct: 249 GLRAGDRYPALFTNAVRTLAVGEISEPVRSGAGFHVLKLIERRQPAPAPQTVTQSRARHI 308

Query: 289 SAQNTPTKIEKHEAEYVKKLRSNAI 313
               +    E    + +   R    
Sbjct: 309 LLIPSAQLSEAQARDKLNDFRRRIQ 333



 Score = 94.4 bits (232), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 19/155 (12%), Positives = 49/155 (31%), Gaps = 3/155 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           I   +      TV +   R +L        + Q    K        +           + 
Sbjct: 288 IERRQPAPAPQTVTQSRARHILLIPSAQLSEAQA-RDKLNDFRRRIQSGDTDFATLARQN 346

Query: 223 ASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
           +        G   +       P+F+N++ + +    + P +++ GV  I + ++R     
Sbjct: 347 SQDGSAAQGGDLGWASPGMFVPEFENVMNQLAPGQISEPLISRFGVHLIQLLERRQATLN 406

Query: 282 IALKAY-LSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
              +   +       K+ +    +++  R+ A + 
Sbjct: 407 EREQRELVRNMLRERKMAEAYDNWIRDTRARAYVE 441


>gi|261855875|ref|YP_003263158.1| SurA domain protein [Halothiobacillus neapolitanus c2]
 gi|261836344|gb|ACX96111.1| SurA domain protein [Halothiobacillus neapolitanus c2]
          Length = 465

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 57/341 (16%), Positives = 118/341 (34%), Gaps = 30/341 (8%)

Query: 1   MTSKVFTS--LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSS-----------RIRTTIN 47
           MT+   +S  L  F +L   +  L       +V       +            RI   +N
Sbjct: 1   MTTSPRSSFLLHIFARLTPAWLALAAGLSFGVVFSTPTIAADLTPAAGEQMFDRIVAVVN 60

Query: 48  GEVITDGDISKRIALLKLQKING--------ELEKIAVQELIVETLKKQEIEKSGITFDS 99
             VIT   ++ RI  +  Q            +LE+  +  +I E ++ Q  ++ GIT D 
Sbjct: 61  QSVITQRQLNDRIQQVSSQINIQALSPSDFKQLEERVLDRMITEEVELQRAKQIGITVDE 120

Query: 100 NTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNL 159
             ++      A+  G+S +     + +QG   N ++  +  Q I  ++ + +   +    
Sbjct: 121 QRLDSALDGIAQRNGMSLDQLQQAVTRQGEDWNAYRDNIRKQIIIDELKRREVYERVDIT 180

Query: 160 EMEIPAN--KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCN 217
           + +I     +    +    EY +  +L S+P+N   +Q    K+  D   + L+  +D  
Sbjct: 181 DRDIDEYLKQYMGADTDTTEYHLAQILISVPENATPSQVENAKKRADDVMAALKAGQDFA 240

Query: 218 KLEKF-ASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDK 275
           K+    +        G   +   S +   F + +K       +    +  G   + +  +
Sbjct: 241 KVSAERSDAPDATKGGDLGWRDMSRIPGLFTDTVKSLKTGEISGLIRSPNGFHILKLLGE 300

Query: 276 RD-----LGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
           R               ++  Q    +         +KLR  
Sbjct: 301 RKRTAGNTQLTEYEAEHVLIQVNGKRDATAAKAQAEKLRQE 341



 Score = 86.3 bits (211), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 34/275 (12%), Positives = 93/275 (33%), Gaps = 13/275 (4%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           ITD DI + +        + +  +  + ++++   +     +              ++  
Sbjct: 179 ITDRDIDEYLKQY--MGADTDTTEYHLAQILISVPENATPSQVENAKKRADDVMAALKAG 236

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYG--------NLEME 162
           ++    + + S   D    GD  ++    I  ++ D VK+    +             ++
Sbjct: 237 QDFAKVSAERSDAPDATKGGDLGWRDMSRIPGLFTDTVKSLKTGEISGLIRSPNGFHILK 296

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +   +++    T         +    + K        +  K  +E             K+
Sbjct: 297 LLGERKRTAGNTQLTEYEAEHVLIQVNGKRDATAAKAQAEKLRQEIISGKATFAEIASKY 356

Query: 223 ASK-IHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG 280
           +         G   ++  SD+ P+F  +L+++     +  + TQ G  ++ +   R++  
Sbjct: 357 SDDKGSAQQGGLLGWVNPSDMVPEFATMLEQTPVGKISPVFQTQFGFHFLEVLKTREVQV 416

Query: 281 EIAL-KAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
                +A         + ++    Y+++LR+ A I
Sbjct: 417 PTDKLRAQARQAIGQRRADEDLVNYIRRLRAEAYI 451


>gi|197124851|ref|YP_002136802.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Anaeromyxobacter sp.
           K]
 gi|196174700|gb|ACG75673.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Anaeromyxobacter sp.
           K]
          Length = 336

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 39/293 (13%), Positives = 96/293 (32%), Gaps = 18/293 (6%)

Query: 40  SRIRTTINGEVITDGDISKRIALLKLQKI------------NGELEKIAVQELIVETLKK 87
            R+   +NG+V+T  ++ +R A L L                 +  + A  +++ + L  
Sbjct: 35  DRVAAIVNGDVVTLQELEQRAAALGLAAADALPAGPARDKARADALRRAFDQVVSDKLFA 94

Query: 88  QEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDV 147
           ++ ++  I      V+       +  G +     S L  +G     ++  +  +     +
Sbjct: 95  EKAKELEIEVTEKQVDDAIEGVKKQNGFTDAQLESALASEGYSMTDYRARIRRELQNFSL 154

Query: 148 VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEE 207
           ++     K    E ++    Q        E  +R     IP  +        +   + + 
Sbjct: 155 LQYKVAGKIKTSEEDLRNYYQSHPQEFDGEDEVRVRHIFIPFAEGGGAQAEAQARAEGQR 214

Query: 208 SRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVT 263
              RL    +     +  +        G+  +L    +H   ++          +     
Sbjct: 215 VLQRLKTGEDFGAVAKAVSRGPSAEEGGELGWLKRGTIHRTLEDAAFALKTGEMSGLVEA 274

Query: 264 QKGVEYIAICDKR--DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
             GV  + + ++R          +  +  +    + E +  +YV +LR +A+I
Sbjct: 275 GPGVHILKVEERRRGGGKSFEQARDEIRQRLGEEQAENYRQQYVAELRRDALI 327


>gi|326794311|ref|YP_004312131.1| Chaperone surA [Marinomonas mediterranea MMB-1]
 gi|326545075|gb|ADZ90295.1| Chaperone surA [Marinomonas mediterranea MMB-1]
          Length = 419

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 39/306 (12%), Positives = 102/306 (33%), Gaps = 10/306 (3%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI----NG 70
           +   + +L I   +    + +  +   +   ++ + + + DI+ R  ++K +        
Sbjct: 2   MKKLFLLLSIVVTMNSPLFAAPKLLDGVVAIVDSQPLLESDINTRFQVIKDRIPGGVMTA 61

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
            + +  + +LI ET++    ++ GI       +   +  A+            L +QGI 
Sbjct: 62  GIRRQILNQLIEETVQINYGKRLGIRIPQENTDAAVLNVAQKFSTDLGGLKQLLSRQGID 121

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
            + ++Q +  + +   V +     +    E EI       +N    +  +      +   
Sbjct: 122 YSRYRQQIENEILINAVKQRVIKDRISITEQEISDFISASQNTQSSKNELHLRHIIVRAK 181

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLL 250
                    K+I     S        N+   ++     +  G   +   S L   F   +
Sbjct: 182 NETEALAKIKQIASGIASENDF---INQAITYSDGQFALEGGDLGWRPVSQLPALFTKAI 238

Query: 251 KKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK---AYLSAQNTPTKIEKHEAEYVKK 307
              +     P  +  G   + + +KR    ++  +    ++  Q    + E+     + +
Sbjct: 239 NTQKGPLIGPLKSNAGYHLLWVIEKRSANVQLQAQTKTRHILLQPNEIRTEQQTVALINE 298

Query: 308 LRSNAI 313
           L   A+
Sbjct: 299 LYKRAM 304



 Score = 89.3 bits (219), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 30/267 (11%), Positives = 80/267 (29%), Gaps = 7/267 (2%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           IT+ +IS  I+    Q       ++ ++ +IV    + E         S   +     + 
Sbjct: 149 ITEQEISDFIS--ASQNTQSSKNELHLRHIIVRAKNETEALAKIKQIASGIASENDFINQ 206

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
             T    +      D      +                         N    +    +K 
Sbjct: 207 AITYSDGQFALEGGDLGWRPVSQLPALFTKAINTQK--GPLIGPLKSNAGYHLLWVIEKR 264

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
                 +   +T    +  N+++ +      I +  +  +          +++      +
Sbjct: 265 SANVQLQAQTKTRHILLQPNEIRTEQQTVALINELYKRAMSGEDFAGLASEYSDDQGSTL 324

Query: 230 SIGKAQYLLESDLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-AY 287
             G   ++    + P F+ ++        + P+ +Q G   + + D+R      ++K   
Sbjct: 325 QGGDLGWVKLGMMVPAFEKVMTATKTGAVSKPFRSQFGWHILKVEDRRKEDISESVKQQQ 384

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAII 314
                   K +   + ++ +L+ +A I
Sbjct: 385 AEKALVAQKQDFVLSNWLDELKESAFI 411


>gi|222085450|ref|YP_002543980.1| peptidyl-prolyl cis-trans isomerase protein [Agrobacterium
           radiobacter K84]
 gi|221722898|gb|ACM26054.1| peptidyl-prolyl cis-trans isomerase protein [Agrobacterium
           radiobacter K84]
          Length = 316

 Score =  132 bits (331), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 88/308 (28%), Positives = 151/308 (49%), Gaps = 4/308 (1%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           ++ +      +I     + S      +S ++  +N  VIT GDI+KRI  LKLQ   G+L
Sbjct: 8   MRAVLFGAAALIMATFAMPSSDVAFAASEVKVVVNNSVITSGDIAKRINFLKLQHQKGDL 67

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            K+A ++L+ ETLK+ EI +  ++  ++ V+  F + A +  +S +     LDK G+G +
Sbjct: 68  NKLAQEQLVDETLKRAEISRVRMSVSTSDVDSAFGRFAASNKMSPQQLGQILDKMGVGVD 127

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
           HFK Y+A+   WP VV   F    GN         +  +N T        +   +     
Sbjct: 128 HFKSYIAVSMSWPRVVNARFGSSGGNKLSNDDLVTRMTENKTKPVTTEYFLKQIVFVVPQ 187

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK 252
             +  +  + K   E+       C++ + FA+ + DVS+     +L  DL   ++ LL++
Sbjct: 188 AKRNAILNQRKSEAEASRAKFPGCDQAKVFAATMRDVSVQDLGRVLAPDLPEIWKPLLEQ 247

Query: 253 SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHE----AEYVKKL 308
           ++ NTT P VT +GVEY+AIC +R +  ++A  A   A++      +       +Y+ +L
Sbjct: 248 AKGNTTTPVVTDRGVEYVAICSQRQVNDDVAAAAVFRAEDIGKAGAQGISANDKKYMDEL 307

Query: 309 RSNAIIHY 316
           RS A I Y
Sbjct: 308 RSKAQILY 315


>gi|198284724|ref|YP_002221045.1| SurA domain [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|198249245|gb|ACH84838.1| SurA domain [Acidithiobacillus ferrooxidans ATCC 53993]
          Length = 477

 Score =  132 bits (331), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 35/290 (12%), Positives = 101/290 (34%), Gaps = 13/290 (4%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE---------LEKIAVQELIVET 84
           ++     ++   +N  +IT   + +R+  ++ +              L +  +Q++I++ 
Sbjct: 66  QNTQNLDKVVAVVNDNIITSMQLEQRVGAVRARLQTQNPNAMPPEDILRRQVLQQMILQD 125

Query: 85  LKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIW 144
           ++ Q   ++GI  D  T++      A+   L+ +     L  QG     F   L  + + 
Sbjct: 126 IELQIAHRAGIKVDKATLDQAISNLAQANHLTPDQLRQALANQGQSWERFTHDLEDRILV 185

Query: 145 PDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKD 204
             +++ +   +      E+    Q++K +    + ++ +   +PDN   +     +R  +
Sbjct: 186 DRLMQQEVENRVHIGPDEVKTFAQQLKEMGGVSFDLQQIFIPLPDNPTPDAVGAARRDAE 245

Query: 205 A-EESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYV 262
              +  L   +      + +S    +  G+  ++   +L P      L+      +    
Sbjct: 246 QARDHVLAGERFGRVATQVSSGRDALQGGRLGWIKAGELPPAVAQTLLQLKVGEISPVIP 305

Query: 263 TQKGVEYIAICDKR--DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRS 310
              G     + D +           A +  +   +   +      + ++ 
Sbjct: 306 GPTGFHIFKLLDVKHGQPTVTEVKTAMIVLRAGNSLQLQEAEARAQDIQQ 355



 Score = 70.5 bits (170), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 13/123 (10%), Positives = 39/123 (31%), Gaps = 3/123 (2%)

Query: 196 GFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL-LKKS 253
              + R +D +++     +       ++       + G+  ++    L    +   L   
Sbjct: 344 QEAEARAQDIQQALQSGTRFSELARSYSQDPRTAANGGEMGWVAPGQLPDSLERTLLTLQ 403

Query: 254 QNNTTNPYVTQKGVEYIAICDKRDLGGEI-ALKAYLSAQNTPTKIEKHEAEYVKKLRSNA 312
               ++P      +  +    +R    E   + A    Q     + +   E+ +++R  A
Sbjct: 404 PGGVSSPIRVGNAIYILHSQAQRQQAVEEKQIMAAARMQLYNRIVHERMDEWQRRIRDGA 463

Query: 313 IIH 315
            + 
Sbjct: 464 YVE 466


>gi|260767121|ref|ZP_05876066.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio furnissii CIP
           102972]
 gi|260617876|gb|EEX43050.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio furnissii CIP
           102972]
 gi|315181264|gb|ADT88178.1| survival protein SurA [Vibrio furnissii NCTC 11218]
          Length = 431

 Score =  132 bits (331), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 42/307 (13%), Positives = 106/307 (34%), Gaps = 12/307 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +KL     + ++  +   +         R+   +N  VI   DI   +  +K        
Sbjct: 1   MKLWKHTLLTLLGLMSIGLVQAQPVEMDRVAVIVNNGVILQSDIDTALLSVKANAKKNNR 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  V++LI++TL++QE E+ G+  D N +N      A+    +AE     +
Sbjct: 61  ALPDEAVLREQVVEKLIIDTLQQQEAERIGVRIDDNRLNEAINDIAKENHQTAEQLRVSV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
             +G+    F++ +  +    +        +   L  E+      +   T      +   
Sbjct: 121 AAEGLTYPEFREQIRKEMSASEARNALVRRRINILPAEVNTLADLLAKETNATIQYKISH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +  N  Q++  V+ + K   E   +          ++     +  G   ++ + ++  
Sbjct: 181 IQLRFNDGQDKSEVEAQAKKLVEQLNKGADFSTMAITYSKGPKALDGGDWGWMRKEEMPT 240

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F +    +++     P+ +  G   + I D +    +        ++  + T    +  
Sbjct: 241 IFADQIKMQNKGTIIGPFRSGVGFHILKIDDVKGLETVAVTEVNARHILIKPTIILSDDG 300

Query: 301 EAEYVKK 307
             + + +
Sbjct: 301 AQKQLNE 307



 Score = 79.3 bits (193), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 32/269 (11%), Positives = 78/269 (28%), Gaps = 4/269 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   +++    LL  +       KI+  +L     + +   ++        +N       
Sbjct: 154 ILPAEVNTLADLLAKETNATIQYKISHIQLRFNDGQDKSEVEAQAKKLVEQLNKGADFST 213

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I               +   I       
Sbjct: 214 MAITYSKGPKALDGGDWGWMRKEEMPTIFADQIKMQNKGTIIGPFRSGVGFHILKIDDVK 273

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDC-NKLEKFASKI-HD 228
              TV    +      I    + +    QK++ +                ++++      
Sbjct: 274 GLETVAVTEVNARHILIKPTIILSDDGAQKQLNEFVRRIQAGEATFGELAQQYSQDPGSA 333

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ ++       + P+ T  G   + + D+R++   + ALK 
Sbjct: 334 AQNGELGYQTPDLYVPEFKHQVETLPVGQISQPFKTVHGWHIVEVLDRREVDRTDSALKN 393

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
                    K  +  + ++++LR+ A + 
Sbjct: 394 KAYRILFSRKFNEEASAWLQELRAGAFVE 422


>gi|86160750|ref|YP_467535.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|85777261|gb|ABC84098.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 338

 Score =  132 bits (331), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 39/293 (13%), Positives = 96/293 (32%), Gaps = 18/293 (6%)

Query: 40  SRIRTTINGEVITDGDISKRIALL------------KLQKINGELEKIAVQELIVETLKK 87
            R+   +NG+V+T  ++ +R A L            +  +   E  + A  +++ + L  
Sbjct: 37  DRVAAIVNGDVVTLQELEQRAAALGLAAADALPAGPERDRARAEALRRAFDQVVSDKLFA 96

Query: 88  QEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDV 147
           ++ ++  I      V+       +  G +     S L  +G     ++  +  +     +
Sbjct: 97  EKAKELEIEVTEKQVDDAIEGVKKQNGFTDAQLESALASEGYSMADYRTRIRRELQNFSL 156

Query: 148 VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNK---LQNQGFVQKRIKD 204
           ++     K    E ++    Q        E  +R     IP  +    Q Q   +   + 
Sbjct: 157 LQYKVAGKIKTSEEDLRNYYQSHPQEFDGEDEVRVRHIFIPFPEGGGKQAQAQARAEGQR 216

Query: 205 AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVT 263
             +            +  +        G+  +L    +H   ++          +     
Sbjct: 217 VLQRLKTGEDFGAVAKAVSRGPSAEEGGELGWLKRGTIHRTLEDAAFALKTGEISGLVEA 276

Query: 264 QKGVEYIAICDKR--DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
             GV  + + ++R          +  +  +    + E +  +YV +LR +A+I
Sbjct: 277 GPGVHILKVEERRRGGGKSFEQAREEIRQRLGEEQAENYRQQYVAELRRDALI 329


>gi|329122338|ref|ZP_08250925.1| peptidyl-prolyl cis-trans isomerase [Haemophilus aegyptius ATCC
           11116]
 gi|327473620|gb|EGF19039.1| peptidyl-prolyl cis-trans isomerase [Haemophilus aegyptius ATCC
           11116]
          Length = 313

 Score =  132 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 57/318 (17%), Positives = 116/318 (36%), Gaps = 20/318 (6%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMS-SRIRTTINGEVITDGDISKRIALLKLQKINGE 71
           +K+        +   +  V++ S A +  R+  T++G  I +  +       +       
Sbjct: 1   MKMKKFVLRSFLLAALGCVAFASMAQAGERVVATVDGIPILESQV-------RANMGKKG 53

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
             + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  
Sbjct: 54  DRQSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISL 113

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEI----------PANKQKMKNITVREYLIR 181
           N F+Q +A Q +   V              E+             K   + +  +EY +R
Sbjct: 114 NTFRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVR 173

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQY-LLES 240
            +L  +       Q   Q     ++    +       L+     +   + G   Y   E+
Sbjct: 174 HILLKLNPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPET 233

Query: 241 DLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEK 299
                 Q ++K  Q   + P+ T+ G   + +   RD              +   T+++ 
Sbjct: 234 YAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGVRDGDLTAEAYTQKAYERLVNTQLQD 293

Query: 300 HEAEYVKKLRSNAIIHYY 317
              ++VK LR  A I Y+
Sbjct: 294 ATNDWVKALRKRANIQYF 311


>gi|52424684|ref|YP_087821.1| SurA protein [Mannheimia succiniciproducens MBEL55E]
 gi|52306736|gb|AAU37236.1| SurA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 353

 Score =  132 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 41/328 (12%), Positives = 106/328 (32%), Gaps = 16/328 (4%)

Query: 2   TSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYK-SWAMSSRIRTTINGEVITDGDISKRI 60
             +   + ++ I +       ++  ++ + +   +     ++  T++G  I +  + +  
Sbjct: 26  NERNLLNFNNGIMMKPGNLKSLLLVMIGMFAVSVNVQAVEQVVATVDGTPILESQLKRA- 84

Query: 61  ALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
             L  Q  N      A+ ++I + L ++ ++++ +      ++      A    ++    
Sbjct: 85  --LGKQANNATNRAKALDKIIDDMLVQKAVKEANVHISEGQLDKIVENIAAQNNMTYGQL 142

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVRE--- 177
              LD QGIG   F+  +  Q +  +V              ++    ++M      +   
Sbjct: 143 LDALDYQGIGITKFRNNIRNQLMMAEVRNRSIGKNIDVTREQVETLSKQMLEQAKTQGKK 202

Query: 178 ------YLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVS 230
                       +    +  L +     +  +   + +          + ++       +
Sbjct: 203 AQVTGTEYQVRHILLKLNPLLNDAQAKAQLNQICSDIQSGKTTFAAAAKDYSKDYLSGAN 262

Query: 231 IGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-L 288
            G   Y       P F Q +    +   + P+ TQ G   + + D R      A      
Sbjct: 263 GGDLGYAFPEIYDPAFGQVIKATKKGVISAPFKTQFGWHILEVTDTRQGDMTEAAYRQKA 322

Query: 289 SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                  +++    ++VK LR  A I Y
Sbjct: 323 YETLVNQQLQDDAKDWVKALRKGAEIKY 350


>gi|53805075|ref|YP_113118.1| peptidyl-prolyl cis-trans isomerase SurA [Methylococcus capsulatus
           str. Bath]
 gi|81682783|sp|Q60B78|SURA_METCA RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|53758836|gb|AAU93127.1| peptidyl-prolyl cis-trans isomerase SurA [Methylococcus capsulatus
           str. Bath]
          Length = 454

 Score =  132 bits (330), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 36/312 (11%), Positives = 102/312 (32%), Gaps = 18/312 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK--------INGEL 72
           +  +     +    + A   RI   ++  VI + ++ +++  +K            +  L
Sbjct: 12  LGALALFAVVCWSMADAAVDRIVAVVDDGVILESELVRKVDEIKRSLRASRASLPPDSVL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            +  ++ +IV+ ++ Q  EK GI  D +T+     Q A+   L+ + F   L ++GI   
Sbjct: 72  VRQVLERMIVDKIQIQMAEKMGIQVDDDTLRMAVSQIAQRNNLTPDQFRRSLAREGIDYG 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITV----REYLIRTVLFSIP 188
            F   +  +     +  +    +    + E+    +              L   ++ +  
Sbjct: 132 DFLDQVRSEIAMGRLRASQINNQIKISDREVEHYLEAQGGSGAVADREYRLGHILIATPR 191

Query: 189 DNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-Q 247
           +         ++R     +         +   +++     +  G   +   S++     +
Sbjct: 192 EASPDEVKKARERADRVVKELKAGLDFKDASIRYSDDPQALEGGDLGWRKLSEIPSHIAE 251

Query: 248 NLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNT---PTKIEKHEAEY 304
            +        ++P  +  G   + +   R +G     K ++            ++     
Sbjct: 252 VVGGMKDGEVSDPIRSPGGYHIVKMLAMRGVGEAKLTKTHVRHILIRPNEVLSDEDAKNK 311

Query: 305 VKKLRSNAIIHY 316
           +  L++   I  
Sbjct: 312 LLALKTR--IEN 321



 Score = 94.0 bits (231), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 18/139 (12%), Positives = 48/139 (34%), Gaps = 3/139 (2%)

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK-IHDVSIGKAQYLLE 239
                 I  N++ +    + ++   +                +      +  G   ++  
Sbjct: 291 HVRHILIRPNEVLSDEDAKNKLLALKTRIENGDDFAELARGHSDDKGSAIKGGDLGWVKP 350

Query: 240 SDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKI 297
             L P F+  +    +N  ++P  TQ G   I + ++++       LK     +    K+
Sbjct: 351 GALVPPFEEAMNALDENQLSDPVQTQFGWHLIQVLERQESSDTNEVLKNRARDELFKRKV 410

Query: 298 EKHEAEYVKKLRSNAIIHY 316
           ++    +++K+R  A +  
Sbjct: 411 DEETELWLRKIRDEAYVEI 429


>gi|90416848|ref|ZP_01224777.1| peptidyl-prolyl cis-trans isomerase SurA [marine gamma
           proteobacterium HTCC2207]
 gi|90331195|gb|EAS46439.1| peptidyl-prolyl cis-trans isomerase SurA [marine gamma
           proteobacterium HTCC2207]
          Length = 434

 Score =  132 bits (330), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 34/317 (10%), Positives = 104/317 (32%), Gaps = 15/317 (4%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE 71
             K   T  + ++     + +     +  ++   ++ +V+ + ++ +R+A +  Q     
Sbjct: 3   LKKTCNTALLAVLLGAFSVTASAQIEILDKVVAIVDEDVVLESEVQRRLATIYAQIQQSG 62

Query: 72  LE--------KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSF 123
            +        +  ++ LI E L+      +GI      +N    + A++  L+ E ++  
Sbjct: 63  TQPPPQEIIVQQVLERLISERLQLNMGYSAGIRITDAELNDAMARIAKSNQLTMEQYAEQ 122

Query: 124 LDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI--- 180
           +   G   ++ ++ +  + I   V +   M +      E+       +   +    +   
Sbjct: 123 IHATGSTLSNVREEIRNEMILMRVQQGQVMRRIRISNQELDNFLNSEEGRFMTSPDVNVG 182

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLES 240
             +L             + +R +   +               ++    +  G   +   +
Sbjct: 183 HILLPVPSGKNTDEVNAILQRAQGILDQANSGTDFRQLAIANSADQTALQGGDLGWRKMA 242

Query: 241 DLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTK 296
            L   F + + K   +  + P  +  G   I + +++   +   E     ++  +    +
Sbjct: 243 QLPGVFIEAVEKLEIDQVSEPIRSDAGYHLIKLYERKGGGEQLIEQHFARHILIKPNQIR 302

Query: 297 IEKHEAEYVKKLRSNAI 313
            E      + +LR    
Sbjct: 303 DEATVVSQLTELRERIK 319



 Score = 84.7 bits (207), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 18/146 (12%), Positives = 53/146 (36%), Gaps = 3/146 (2%)

Query: 174 TVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIG 232
                        I  N+++++  V  ++ +  E            ++F+      ++ G
Sbjct: 283 EQLIEQHFARHILIKPNQIRDEATVVSQLTELRERIKAGEDFALLTKEFSEDPGSALNGG 342

Query: 233 KAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSA 290
           +  +       P+F+  +     N  + P+++Q G   + + ++R+    E   +     
Sbjct: 343 ELGWSTPGMFVPEFEQTMGSIELNEVSAPFLSQFGWHILQVTERRNQDFSENITRNRAQN 402

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIHY 316
                K E+    +++++R  A +  
Sbjct: 403 LLRQRKYEEELQVWLQEIRDEAFVEI 428


>gi|146309025|ref|YP_001189490.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas
           mendocina ymp]
 gi|145577226|gb|ABP86758.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas
           mendocina ymp]
          Length = 430

 Score =  132 bits (330), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 36/287 (12%), Positives = 94/287 (32%), Gaps = 15/287 (5%)

Query: 40  SRIRTTINGEVITDGDISKRIALLK--------LQKINGELEKIAVQELIVETLKKQEIE 91
            R+   ++ +V+    +  R+  ++               L +  ++ LI+E ++ Q  E
Sbjct: 31  DRVVAIVDNDVVMQSQLDARLREVQQTIDKRGGALPPEHVLSQQVLERLIIENIQLQIGE 90

Query: 92  KSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
           +SGI      +N      A+  G+S E F   L + G+     +  +  + I   V +  
Sbjct: 91  RSGIRITDEELNQAMGTIAQRNGMSLEQFRQALARDGLSYADARDQVRREMIISRVRQRR 150

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIR---TVLFSIPDNKLQNQGFVQKRIKDAEES 208
              +    + E+                 R    ++               ++ ++  + 
Sbjct: 151 VAERIQVTDQEVQNFLASDLGKMQLSEEFRLANILIPVSEGASSSEIQAADRQARELYQQ 210

Query: 209 RLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGV 267
             +           ++    +  G+  +     L P F +++ + +    T P  T  G 
Sbjct: 211 LQQGADFAQLAISRSASETALEGGEMGWRKAGQLPPPFDSMISQLNPGEVTEPVRTPGGF 270

Query: 268 EYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
             + + +KR       +     ++  + +  +  +     V++L   
Sbjct: 271 IILKLIEKRGGDTQVRDEVHVRHILIKPSEIRSPEETRRLVERLYQR 317



 Score = 89.0 bits (218), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 14/138 (10%), Positives = 53/138 (38%), Gaps = 3/138 (2%)

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLE 239
                 I  +++++    ++ ++   +  +         + F+      ++ G   ++  
Sbjct: 290 HVRHILIKPSEIRSPEETRRLVERLYQRIVAGEDFAELAKSFSEDPGSALNGGDLNWIDP 349

Query: 240 SDLHPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKI 297
           + L P+F+ ++ ++     + P+ TQ G   + +  +R        +    +      K 
Sbjct: 350 NALVPEFRQVMSETASGELSKPFQTQFGWHVLQVMGRRATDSSAQFREQQAANLLRNRKY 409

Query: 298 EKHEAEYVKKLRSNAIIH 315
           ++    +++++R  A + 
Sbjct: 410 DEELQAWLRQIRDEAYVE 427


>gi|289209139|ref|YP_003461205.1| peptidylprolyl isomerase [Thioalkalivibrio sp. K90mix]
 gi|288944770|gb|ADC72469.1| Peptidylprolyl isomerase [Thioalkalivibrio sp. K90mix]
          Length = 475

 Score =  132 bits (330), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 39/300 (13%), Positives = 94/300 (31%), Gaps = 19/300 (6%)

Query: 35  SWAMSSRIRTTINGEVITDGDISKRIALLKLQK--------INGELEKIAVQELIVETLK 86
               + RI   +  +V+T  ++ +R+ L+  Q             L +  ++ LIVE ++
Sbjct: 66  GDQFTDRILAVVGDDVVTQRELVERMNLVAQQMMERGTRPPDRDTLARQVMERLIVERVQ 125

Query: 87  KQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPD 146
            QE ++ GI  D  T+N      AR   ++       L + G+  N F++ +  +     
Sbjct: 126 LQEAQRVGINIDEMTLNRAMENIARENRMTLPQLRQALLQDGVDFNAFREQIRNELTVNQ 185

Query: 147 VVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAE 206
           + +     +    + EI            R    R     +   +  + G +    + A 
Sbjct: 186 LQRRQVDNQIRVSDQEIADLIASESGAIDRGVRYRIAHIQVSLPRGADSGQIATAREKAR 245

Query: 207 ESRLRLPKDCNKLE---KFASKIHDVSIGKAQYLLESDLHPQFQNLLK-KSQNNTTNPYV 262
           E R R+ +  +        +     +  G   +    ++   F            ++   
Sbjct: 246 ELRQRVREGEDFASVAISESDAPDALEGGDLGWRTAGEIPSVFAREAVLMRTGEISDVLR 305

Query: 263 TQKGVEYIAICDKRDLGGEIALKAYLSAQNT-------PTKIEKHEAEYVKKLRSNAIIH 315
           +  G   + + D+         +  +              +  +       ++R  +   
Sbjct: 306 SPNGFHIMKLVDREGGDQTRVRQTQVRHILISPDQVRSDEEARRQAESLYNRIREGSDFE 365



 Score =  103 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 20/157 (12%), Positives = 52/157 (33%), Gaps = 3/157 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           I     +      R    +     I  +++++    +++ +                   
Sbjct: 312 IMKLVDREGGDQTRVRQTQVRHILISPDQVRSDEEARRQAESLYNRIREGSDFEALARAN 371

Query: 223 ASKI-HDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDL-G 279
           +         G+  ++   +L P+F+  +        + P  +Q G   I + D R++  
Sbjct: 372 SDDPGSAAQGGQLGWISPGELVPEFEEAMNALQPGEISEPVESQFGWHIIEVLDHREVDT 431

Query: 280 GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
               ++A         K E+    ++++LR  A + Y
Sbjct: 432 SREQIRARAREILQNRKREEEIELWMRRLRDEAYVEY 468


>gi|153009931|ref|YP_001371146.1| SurA domain-containing protein [Ochrobactrum anthropi ATCC 49188]
 gi|151561819|gb|ABS15317.1| SurA domain protein [Ochrobactrum anthropi ATCC 49188]
          Length = 319

 Score =  132 bits (330), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 72/317 (22%), Positives = 133/317 (41%), Gaps = 8/317 (2%)

Query: 5   VFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK 64
           +  +   F  +L+    L     V + ++ + A  S ++  ++G  IT+ DI  R+A LK
Sbjct: 1   MMIARPLFASMLSAAVCLTTLGTVAVPAFAAGAG-SEVKVIVSGNAITNSDIQHRVAFLK 59

Query: 65  LQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
           LQ+  G L ++A +EL  E LK+ E++   I      V+  +   A    +S    +  +
Sbjct: 60  LQRKGGNLSQVAKEELTDEMLKRIEMKSRSINITDQQVDEAYAGFASRNKMSLAQLNQLM 119

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
           ++ G+  +HFK+Y+ +Q  W  +V   F       E E      K           R   
Sbjct: 120 NQSGVTPDHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKDGGKKPVATEYRLQQ 179

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
                   +    +  + K    +     + C+   + A  I DV++     ++E  L  
Sbjct: 180 VIFVIPASKRSPALLSKRKQEANALRSRFQSCDATRQQAKGILDVTVRDLGRIIEQQLPN 239

Query: 245 QF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ------NTPTKI 297
           ++ + +   S   TT P  T+KGVE++A+C  R +  +   +   S +          K 
Sbjct: 240 EWAKAVKATSVGGTTPPQETEKGVEFLAVCSTRQISDDRVAQLVFSMEGADSPAGQEKKA 299

Query: 298 EKHEAEYVKKLRSNAII 314
           E+   +Y+K+LR  A I
Sbjct: 300 EQLSEKYLKELREKATI 316


>gi|309972385|gb|ADO95586.1| Putative survival protein SurA-like protein [Haemophilus influenzae
           R2846]
          Length = 313

 Score =  132 bits (330), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 54/318 (16%), Positives = 109/318 (34%), Gaps = 20/318 (6%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAM-SSRIRTTINGEVITDGDISKRIALLKLQKINGE 71
           +K+        +   +  V++ S A    R+  T++G  I +  +       +       
Sbjct: 1   MKMKKFILKSFLLATLGCVAFTSMAQAEERVVATVDGIPILESQV-------RANMGKKG 53

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
             + A+ ++I + L ++ I++SG+  D   ++      A   GL+   F   LD QGI  
Sbjct: 54  DRQSALDKIIDDLLVQKAIQESGVKIDPREIDRVVEDTAARNGLTYGQFLDALDYQGISL 113

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEI---------PANKQKMKNITVREYLIRT 182
           N F+Q +A Q +   V              E+          A  Q        +     
Sbjct: 114 NTFRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLDEAKSQGTAQKVTGKEYEVR 173

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQY-LLES 240
            +    +  L +    ++  K   +         +   K++       + G   Y   E+
Sbjct: 174 HILLKLNPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPET 233

Query: 241 DLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEK 299
                 Q ++K  Q   + P+ T+ G   + +    D              +   T+++ 
Sbjct: 234 YAPQFAQTVMKSKQGVISAPFKTEFGWHILEVTGVSDGDLTAEAYTQKAYERLVNTQLQD 293

Query: 300 HEAEYVKKLRSNAIIHYY 317
              ++VK LR  A I Y+
Sbjct: 294 ATNDWVKALRKRANIQYF 311


>gi|16272406|ref|NP_438619.1| stationary-phase survival protein SurA [Haemophilus influenzae Rd
           KW20]
 gi|260580479|ref|ZP_05848307.1| stationary-phase survival protein SurA [Haemophilus influenzae
           RdAW]
 gi|1174486|sp|P44721|SURA_HAEIN RecName: Full=Chaperone surA homolog; Flags: Precursor
 gi|1573432|gb|AAC22116.1| stationary phase survival protein SurA, putative [Haemophilus
           influenzae Rd KW20]
 gi|260092821|gb|EEW76756.1| stationary-phase survival protein SurA [Haemophilus influenzae
           RdAW]
          Length = 313

 Score =  132 bits (330), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 53/318 (16%), Positives = 111/318 (34%), Gaps = 20/318 (6%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAM-SSRIRTTINGEVITDGDISKRIALLKLQKINGE 71
           +K+        +   +  V++ S A    R+  T++G  + +  +       +       
Sbjct: 1   MKMKKFVLRSFLLATLGCVAFTSMAQAEERVVATVDGIPVLESQV-------RANMGKKG 53

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
             + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  
Sbjct: 54  DRQSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISL 113

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEI---------PANKQKMKNITVREYLIRT 182
           N F+Q +A Q +   V              E+          A  Q        +     
Sbjct: 114 NTFRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLDEAKSQGTAQKVTGKEYEVR 173

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQY-LLES 240
            +    +  L +    ++  K   +         +   K++       + G   Y   E+
Sbjct: 174 HILLKLNPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPET 233

Query: 241 DLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEK 299
                 Q ++K  Q   + P+ T+ G   + +   RD              +   T+++ 
Sbjct: 234 YAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGVRDGDLTAEAYTQKAYERLVNTQLQD 293

Query: 300 HEAEYVKKLRSNAIIHYY 317
              ++VK LR  A I Y+
Sbjct: 294 ATNDWVKALRKRANIQYF 311


>gi|258627055|ref|ZP_05721853.1| survival protein SurA [Vibrio mimicus VM603]
 gi|258580729|gb|EEW05680.1| survival protein SurA [Vibrio mimicus VM603]
          Length = 431

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 38/313 (12%), Positives = 107/313 (34%), Gaps = 12/313 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +KL     + +I  +    ++        +   +N  VI   D+   +  +K        
Sbjct: 1   MKLWKPTLISVISALTLFNAHAEPEQLDGVAVIVNSGVILQSDVDGALKTVKANAKQNNQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++TL++QE E+ G+  D N +N    + A+N   + E   S +
Sbjct: 61  PLPQETVLREQVLEKLIIDTLQQQEAERIGVKIDDNRLNDAIKEIAKNNQQTQEQLISSV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            ++G+    F++ +  +    D        +   L  E+    + +   T      +   
Sbjct: 121 AQEGLTYPEFREQVRKEMAASDARNALVRRRINILPAEVDTLAELLAQETDATVQYKISH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +   + Q++   +                      ++     +  G   ++ + ++  
Sbjct: 181 IQLRVEEGQDKSEAESLANKLVGELKHGADFAQMAYTYSKGPKALQGGDWGWMRKEEMPT 240

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F +    +++ +   P+ +  G   + I D +    +        ++  + T    ++ 
Sbjct: 241 IFADQIKMQNKGSIIGPFRSGVGFHILKIDDVKGLETVAVTEVNARHILIKPTIILSDEG 300

Query: 301 EAEYVKKLRSNAI 313
             + + +      
Sbjct: 301 AQKQLNEFVQRIK 313



 Score = 82.0 bits (200), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 34/269 (12%), Positives = 82/269 (30%), Gaps = 4/269 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     LL  +       KI+  +L VE  + +   +S        + +      
Sbjct: 154 ILPAEVDTLAELLAQETDATVQYKISHIQLRVEEGQDKSEAESLANKLVGELKHGADFAQ 213

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +        +   I       
Sbjct: 214 MAYTYSKGPKALQGGDWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIDDVK 273

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDC-NKLEKFASKI-HD 228
              TV    +      I    + +    QK++ +  +             ++++      
Sbjct: 274 GLETVAVTEVNARHILIKPTIILSDEGAQKQLNEFVQRIKNGEATFGELAQQYSQDPGSA 333

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ ++       + P+ T  G   + + D+R++   + ALK 
Sbjct: 334 AQKGELGYQTPDLYVPEFKHQIEILPVGQISEPFQTVHGWHIVEVLDRREVDRTDSALKN 393

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
                    K  +  + ++++LR++A + 
Sbjct: 394 KAYRILFNRKFNEEASAWLQELRASAFVE 422


>gi|86160749|ref|YP_467534.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|85777260|gb|ABC84097.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 317

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 35/310 (11%), Positives = 87/310 (28%), Gaps = 19/310 (6%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE---- 71
           +     L   C     +      +      +NGE I    +++ +   +           
Sbjct: 8   ILIATALAAGCGRCGGARSGERPAPGAVAVVNGEPIPPDALARELRDAQAGAEGQAPAAG 67

Query: 72  --LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
             L +  + +L+   L  Q+     I    + V   F++           F   L ++ +
Sbjct: 68  DVLRRRVLDDLVDRALLLQQARARSIVVGQDQVERAFLRLRAE--YPGTHFDDLLAQERL 125

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPD 189
                K  L  Q     + + +   +   ++ E+     +          +  +   +  
Sbjct: 126 SQAELKARLKDQLTVERLFEQEVFPQVQVVDAEVERYYAEHGAEFQEPERVHVLQIVV-- 183

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESD-LHPQFQN 248
                    ++  +  E+ R           + +        G   ++         F  
Sbjct: 184 ------ASREEAAQVREKLRRNPQTFAEVARRSSIAPEGKGGGDLGFIGRGSGFPEVFDT 237

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLG--GEIALKAYLSAQNTPTKIEKHEAEYVK 306
                 N  ++   +  G     + +K+          +A ++ +    K    +AEY++
Sbjct: 238 CFALPVNVISDVTPSPYGFHLFKVVEKKPAQRRTLEQARAEIAEKLGREKRAGAQAEYLE 297

Query: 307 KLRSNAIIHY 316
            LR  A I  
Sbjct: 298 ALRKRAQIEI 307


>gi|237749066|ref|ZP_04579546.1| chaperone SurA [Oxalobacter formigenes OXCC13]
 gi|229380428|gb|EEO30519.1| chaperone SurA [Oxalobacter formigenes OXCC13]
          Length = 459

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 39/326 (11%), Positives = 95/326 (29%), Gaps = 33/326 (10%)

Query: 19  YFVLIIFCIVPIVSYKSWAMS--------SRIRTTINGEVITDGDISKRIALLKLQKING 70
             +L                +          I   +N +VIT G++++R+ L++ Q    
Sbjct: 16  ALILAFGVFFSATVLAQDNQAQPSKQVVVDSIAAIVNSDVITKGELNERVTLVEAQLKQQ 75

Query: 71  EL--------EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSS 122
            +        +K  ++ +IVE  + Q  +  G+  D   ++      A    +S   F  
Sbjct: 76  NIALPPRTEFQKQVLEHMIVERAQLQLAKDMGLRVDDTQLDRTIALMAEQNHMSLAQFKR 135

Query: 123 FLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVRE--YLI 180
             ++ G     F++ +  +     +   + + K    + E+         + + E   L 
Sbjct: 136 QTEQNGTPFEKFREKVREEITMSRLRDREVVNKIQINDAEVDNLLGADSQLQMPEQLRLG 195

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLES 240
             ++    +   +     + R +   +              ++     +S G   +    
Sbjct: 196 HILIRIPENASPEQIAEKRARAEKVLDVLKSGGDFQQTAASYSDADEGLSGGDIGWRSTD 255

Query: 241 DLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDL--------------GGEIALK 285
            L   F   L      N T    +  G   + + D+R +                +    
Sbjct: 256 RLPKSFVDALAGVKPGNVTGIIKSPNGFHILKVLDRRKMTNGAESVASASDKNTVQQIHA 315

Query: 286 AYLSAQNTPTKIEKHEAEYVKKLRSN 311
            ++  +             +  LR  
Sbjct: 316 RHILIKVNQLVSADEAKRKLIDLRQR 341



 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 20/147 (13%), Positives = 48/147 (32%), Gaps = 2/147 (1%)

Query: 172 NITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI 231
           +    + +    +    +  +      +K I   +    +        + +++       
Sbjct: 306 DKNTVQQIHARHILIKVNQLVSADEAKRKLIDLRQRIINKSATFEELAKTYSNDGSASRG 365

Query: 232 GKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LS 289
           G   ++   D  P+F+  +        + P  TQ G   I + DK+        K     
Sbjct: 366 GDLGWIYPGDTVPEFEKAMVALKPGEISEPIETQFGFHLIQVLDKKTDDVSAERKRIAAK 425

Query: 290 AQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                 K+ +   E++++LR  A + Y
Sbjct: 426 QALRERKVAEATEEWLRQLRDKAYVEY 452


>gi|269137960|ref|YP_003294660.1| peptidyl-prolyl cis-trans isomerase SurA [Edwardsiella tarda
           EIB202]
 gi|267983620|gb|ACY83449.1| peptidyl-prolyl cis-trans isomerase SurA [Edwardsiella tarda
           EIB202]
 gi|304558008|gb|ADM40672.1| Survival protein SurA precursor [Edwardsiella tarda FL6-60]
          Length = 435

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 38/310 (12%), Positives = 114/310 (36%), Gaps = 18/310 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------L 72
           +++   +    ++ +  +  ++   ++  V+ + D+   +  +KL     +        L
Sbjct: 7   LILGVALCANTAFAAPQVVDKVVAIVDNGVVLESDVDGMMKSVKLNAQQADQQLPDNATL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ ++ Q  ++ G+    + ++      A+   +S +   S L   G+   
Sbjct: 67  RHQILERLIMDNVQLQMAKRMGLEISDSELDNAINGIAQQNHISMQQLRSRLAADGLDYK 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            ++  +  + +  +V  N+   +   L  E+ A  +++ +    E  +      IP  + 
Sbjct: 127 TYRAQIRKEMLISEVRNNEVRRRVTILPQEVDALAKQIGSQNSGETAVNLSHILIPLPEN 186

Query: 193 QNQGFVQKRIKDAE---ESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
             Q  V +  + AE   +   +          +++    +  G+  +    +L   F + 
Sbjct: 187 PTQQQVSEAQQQAESLIQQLHQGASFAKLAAAYSADPQALKGGEMGWGRLQELPTLFAEA 246

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKHEAEY 304
           L    + +   P  +  G   + + D R    ++        ++  + +P   +      
Sbjct: 247 LQSAKKGDIVGPIRSGVGFHILRVNDLRGDQANVSVTEVHARHILLRTSPVMSDAQARAK 306

Query: 305 VKKLRSNAII 314
           ++ L  +A I
Sbjct: 307 LEAL--SAQI 314



 Score = 87.8 bits (215), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/285 (12%), Positives = 81/285 (28%), Gaps = 17/285 (5%)

Query: 47  NGEV-----ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNT 101
           N EV     I   ++      +  Q        ++   LI       + + S     + +
Sbjct: 143 NNEVRRRVTILPQEVDALAKQIGSQNSGETAVNLS-HILIPLPENPTQQQVSEAQQQAES 201

Query: 102 VNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND-------FML 154
           +     Q A    L+A   +     +G      +           +              
Sbjct: 202 LIQQLHQGASFAKLAAAYSADPQALKGGEMGWGRLQELPTLFAEALQSAKKGDIVGPIRS 261

Query: 155 KYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
             G   + +   +    N++V E   R +L          Q    K    + +       
Sbjct: 262 GVGFHILRVNDLRGDQANVSVTEVHARHILLRTSPVMSDAQA-RAKLEALSAQITSGKIT 320

Query: 215 DCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAI 272
                ++++         G   + + S   P F++  +K ++   + P  +  G   I +
Sbjct: 321 FEQAAKEYSQDPGSAQKGGDLGWAVPSMYDPAFRDALMKLNKGEISQPVHSNFGWHLIQL 380

Query: 273 CDKRDLG-GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
              R +   + A K          K  +    ++++ R+ A +  
Sbjct: 381 LGTRQVDRTDEAQKERAYRMLFNRKFAEEAQTWLQEQRAAAYVKI 425


>gi|260582276|ref|ZP_05850069.1| stationary-phase survival protein SurA [Haemophilus influenzae
           NT127]
 gi|260094644|gb|EEW78539.1| stationary-phase survival protein SurA [Haemophilus influenzae
           NT127]
          Length = 313

 Score =  131 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 57/318 (17%), Positives = 115/318 (36%), Gaps = 20/318 (6%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAM-SSRIRTTINGEVITDGDISKRIALLKLQKINGE 71
           +K+        +   +  V++ S A    R+  T++G  I +  +       +       
Sbjct: 1   MKMKKFILKSFLLATLGCVAFTSMAQAEERVVATVDGIPILESQV-------RANMGKKG 53

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
             + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  
Sbjct: 54  DRQSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISL 113

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEI----------PANKQKMKNITVREYLIR 181
           N F+Q +A Q +   V              E+             K   + +  +EY +R
Sbjct: 114 NTFRQQIANQMVMGAVRNKAIQESIDVTRAEVVALGQKMLEEAKEKGTAQKVMGKEYEVR 173

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQY-LLES 240
            +L  +       Q   Q     ++    +       L+     +   + G   Y   E+
Sbjct: 174 HILLKLNPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPET 233

Query: 241 DLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEK 299
                 Q ++K  Q   + P+ T+ G   + +   RD              +   T+++ 
Sbjct: 234 YAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGVRDGDLTAEAYTQKAYERLVNTQLQD 293

Query: 300 HEAEYVKKLRSNAIIHYY 317
              ++VK LR  A I Y+
Sbjct: 294 ATNDWVKALRKRANIQYF 311


>gi|120556415|ref|YP_960766.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Marinobacter
           aquaeolei VT8]
 gi|120326264|gb|ABM20579.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Marinobacter
           aquaeolei VT8]
          Length = 447

 Score =  131 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 43/325 (13%), Positives = 115/325 (35%), Gaps = 20/325 (6%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK- 67
           +   ++   T  + +   ++ + +     +  R+   ++ EVI   ++  RI  +  +  
Sbjct: 1   MKATVRHGLTILLTLAMVVLSVTAQAERKLLDRVVAIVDDEVILQSELDARINTIVGRLS 60

Query: 68  -------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
                      LE+  + +LI E+L+ Q  ++ G+    N +N      AR+ G++  +F
Sbjct: 61  AQGTGLPPRELLEQRVLDQLIQESLQLQMADQMGMRISDNELNETLANIARSNGMTLAEF 120

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180
              L ++G+     ++ +  + +   V +     +    + E+    Q  +     +   
Sbjct: 121 EGQLAEEGVTYQQAREQIRNEMLTSRVQQRRVGNRVRVTDREVENYLQAQQANGSTDAEY 180

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYL 237
           R     I  +   ++  V +  + A+  R ++    +        +   + +  G   + 
Sbjct: 181 RLAYIFIEVDDPASEASVDEARETAQALRQQIANGRDFREVAVAESDASNALEGGDMGWR 240

Query: 238 LESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPT 295
            ES L      ++        +       G   + + DKR    +  ++ + +       
Sbjct: 241 SESQLPSLVAPVVPDLEVGEPSQVLENNSGFHLVMVMDKRGGEQQQFIQQHRVRHILVRP 300

Query: 296 -------KIEKHEAEYVKKLRSNAI 313
                  + E+   E  ++L+  A 
Sbjct: 301 SEAVTDVQAEQRIREIYQQLQDGAD 325



 Score = 99.7 bits (246), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 27/286 (9%), Positives = 82/286 (28%), Gaps = 20/286 (6%)

Query: 45  TINGEV-ITDGDISKRIALLKLQKING----------ELEKIAVQELIVETLKKQEIEKS 93
            +   V +TD ++   +   +                E++  A +  + E  +  +  + 
Sbjct: 151 RVGNRVRVTDREVENYLQAQQANGSTDAEYRLAYIFIEVDDPASEASVDEARETAQALRQ 210

Query: 94  GITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFM 153
            I    +       +   +  L   D     + Q                   V++N+  
Sbjct: 211 QIANGRDFREVAVAESDASNALEGGDMGWRSESQLPSLVAPVVPDLEVGEPSQVLENNSG 270

Query: 154 LKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP 213
                +  +      +           R     +  ++       ++RI++  +      
Sbjct: 271 FHLVMVMDK------RGGEQQQFIQQHRVRHILVRPSEAVTDVQAEQRIREIYQQLQDGA 324

Query: 214 KDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIA 271
              +   + +         G   ++    + P F+  + ++Q      P+ +Q G   + 
Sbjct: 325 DFADLARERSDDPVSGSDGGNLGWVSPGQMVPAFEEAMNQAQVGEYFGPFRSQFGWHILQ 384

Query: 272 ICDKRDLGGEIALKA-YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           + ++R        +           K E     +++++R  A + +
Sbjct: 385 VEERRRQDVTEQNRESQARQAIYMRKFELELQNWLREIRDEAFVEF 430


>gi|329119266|ref|ZP_08247953.1| sura/ppiase domain protein [Neisseria bacilliformis ATCC BAA-1200]
 gi|327464613|gb|EGF10911.1| sura/ppiase domain protein [Neisseria bacilliformis ATCC BAA-1200]
          Length = 321

 Score =  131 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 46/289 (15%), Positives = 94/289 (32%), Gaps = 14/289 (4%)

Query: 40  SRIRTTINGEVITDGDISKRIALLKLQKI------NGELEKIAVQELIVETLKKQEIEKS 93
             I       VIT   +    A  +            EL +  + +L+   L  Q  ++ 
Sbjct: 29  DGIAAVAGDAVITVRQLDNAAAAARQSIPAAQRPSENELRRHILAQLVNRALVVQAGKRR 88

Query: 94  GITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFM 153
           GIT      +      A     + E+  +   K GI     ++  A   I   V +   +
Sbjct: 89  GITASEAETDEALAHAAAQKHTTVENLYAQNAKNGISRATLRKDTAEGIIAEKVRQQAIL 148

Query: 154 LKYGNLEMEIPANKQKMKNIT------VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEE 207
            +    + E+ A  ++ K               R     I   K       +  I+  + 
Sbjct: 149 QQARVSDAEVDAAIERAKQQGITLPAGKPVRQYRARHILIKAEKDNALASAESVIRKIQN 208

Query: 208 SRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKG 266
                    +  ++++        G   +  +  + P+F++ +KK  +   + P  TQ G
Sbjct: 209 QAKAGRDFGDLAKQYSQDTSAAQGGDLGWFGDGVMVPEFEDAVKKLKKGQISRPVKTQFG 268

Query: 267 VEYIAICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
              I + D R+    E   +  +       K E   A+ +++L  +A +
Sbjct: 269 WHLIQLTDTRESGTPEERQRNAVRQYIMQQKAEAASAQLLQQLHESAYV 317


>gi|295675486|ref|YP_003604010.1| SurA domain protein [Burkholderia sp. CCGE1002]
 gi|295435329|gb|ADG14499.1| SurA domain protein [Burkholderia sp. CCGE1002]
          Length = 477

 Score =  131 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 39/334 (11%), Positives = 101/334 (30%), Gaps = 34/334 (10%)

Query: 12  FIKLLTTYFVLIIFCIVPIV-----------SYKSWAMSSRIRTTINGEVITDGDISKRI 60
            +K L    +                        S      I   +N  VIT  ++ +R+
Sbjct: 26  IMKQLRLAILAAGLVAAASFVPVASVQAQALGGNSGQTVDTIAAVVNNGVITQRELDERV 85

Query: 61  ALLKLQKINGE--------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
            L+  +             L +  + ++++E ++ Q+ ++ GI  D   V     + A+ 
Sbjct: 86  GLIAHRLNQQNAPVPPTDQLRQQVLTQMVLERIQLQKAKEDGINIDDAAVQRTLERLAQA 145

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMK- 171
             +    + + ++ QG+    F      +     + + +   K    + E+       + 
Sbjct: 146 NNMPLAMYRARIEAQGVPWATFSNDARTELTLSRLREKEVDSKITVTDAEVANYIASQRG 205

Query: 172 ---NITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHD 228
                T   ++    + +  +    +    QK+ +                +  +     
Sbjct: 206 PGAGQTSDLHMQHIFVSAPLNAPETDIEAAQKKAQGLLAEAKGGADFGKLAKANSQAPDA 265

Query: 229 -VSIGKAQYLLESDLHPQF-QNLLKKSQNNTTN-PYVTQKGVEYIAICDKRDLGGE---- 281
             + G   +L  S L P+F +          +     T  G E + + ++R   G     
Sbjct: 266 SKNGGDLGFLAPSKLPPEFVKAASTLRPGEISPDLIRTNDGFEIVRLVERRAGQGTSADA 325

Query: 282 ----IALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
                    ++  +    + E    + +  +R+ 
Sbjct: 326 PKLVQTHVRHILLRVGDGQSEPQARQKLIDIRNQ 359



 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 19/145 (13%), Positives = 48/145 (33%), Gaps = 2/145 (1%)

Query: 173 ITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIG 232
              +          +     Q++   ++++ D                 ++        G
Sbjct: 324 DAPKLVQTHVRHILLRVGDGQSEPQARQKLIDIRNQIAAGGDFAKFAHTYSQDGSSSQGG 383

Query: 233 KAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-AYLSA 290
              ++   +  P+F+  +        + P  ++ G   I +  +RD  G IA +      
Sbjct: 384 DLGWISPGETVPEFERAMNALQDGQISEPVRSEYGYHLIQVLGRRDAEGSIAQQMDLARQ 443

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIH 315
                K E+  A+++++LR  A + 
Sbjct: 444 AIGQRKAEQAYADWLRELRDTAYVE 468


>gi|261209784|ref|ZP_05924089.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio sp. RC341]
 gi|260841174|gb|EEX67687.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio sp. RC341]
          Length = 431

 Score =  131 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/313 (12%), Positives = 108/313 (34%), Gaps = 12/313 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +KL  T  + +I  +    ++        +   +N  VI   D+   +  +K      + 
Sbjct: 1   MKLWKTTLISVISMLTLFNAHAEPQQLDGVAVIVNSGVILQSDVDGALKTVKANAKQNKQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++TL++QE ++ G+  D N +N    + A+N   + E   + +
Sbjct: 61  PLPQESVLREQVLEKLIIDTLQQQEADRIGVKIDDNRLNEAIKEIAKNNQQTQEQLIASV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            ++G+    F++ +  +    D        +   L  E+    + +   T      +   
Sbjct: 121 AQEGLTYPEFREQVRKEMAASDARNALVRRRINILPAEVDTLAELLAQETDATVQYKISH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +   + Q++   +                      ++     +  G   ++ + ++  
Sbjct: 181 IQLRVEEGQDKSEAESLANKLVGELKHGADFAQMAYTYSKGPKALQGGDWGWMRKEEMPT 240

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F +    +++ +   P+ +  G   + I D R    +        ++  + T    +  
Sbjct: 241 IFADQIKMQNKGSIIGPFRSGVGFHILKIDDVRGLETVAVTEVNARHILIKPTIILSDDG 300

Query: 301 EAEYVKKLRSNAI 313
             + + +      
Sbjct: 301 AQKQLSEFVQRIK 313



 Score = 81.3 bits (198), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 34/270 (12%), Positives = 81/270 (30%), Gaps = 4/270 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     LL  +       KI+  +L VE  + +   +S        + +      
Sbjct: 154 ILPAEVDTLAELLAQETDATVQYKISHIQLRVEEGQDKSEAESLANKLVGELKHGADFAQ 213

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +        +   I       
Sbjct: 214 MAYTYSKGPKALQGGDWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIDDVR 273

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDCNKLEKFASKI-HD 228
              TV    +      I    + +    QK++ +  +             ++++      
Sbjct: 274 GLETVAVTEVNARHILIKPTIILSDDGAQKQLSEFVQRIKNGEVSFGELAQQYSQDPGSA 333

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ ++       + P+ T  G   + + D+R +   + ALK 
Sbjct: 334 AQKGELGYQTPDLYVPEFKHQVETLPVGQISEPFKTVHGWHIVEVLDRRQVDRTDSALKN 393

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                    K  +  + ++++LR++A +  
Sbjct: 394 KAYRILFNRKFNEEASAWLQELRASAFVEI 423


>gi|258623407|ref|ZP_05718411.1| survival protein SurA [Vibrio mimicus VM573]
 gi|258584373|gb|EEW09118.1| survival protein SurA [Vibrio mimicus VM573]
          Length = 431

 Score =  131 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/313 (12%), Positives = 107/313 (34%), Gaps = 12/313 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +KL     + +I  +    ++        +   +N  VI   D+   +  +K        
Sbjct: 1   MKLWKPTLISVISALTLFNAHAEPEQLDGVAVIVNSGVILQSDVDGALKTVKANAKQNNQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++TL++QE E+ G+  D N +N    + A+N   + E   S +
Sbjct: 61  PLPQETVLREQVLEKLIIDTLQQQEAERIGVKIDDNRLNDAIKEIAKNNQQTQEQLISSV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            ++G+    F++ +  +    D        +   L  E+    + +   T      +   
Sbjct: 121 AQEGLTYPEFREQVRKEMAASDARNALVRRRINILPAEVDTLAELLAQETDATVQYKISH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +   + Q++   +                      ++     +  G   ++ + ++  
Sbjct: 181 IQLRVEEGQDKSKAESLANKLVGELKHGADFAQMAYTYSKGPKALQGGDWGWMRKEEMPT 240

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F +    +++ +   P+ +  G   + I D +    +        ++  + T    ++ 
Sbjct: 241 IFADQIKMQNKGSIIGPFRSGVGFHILKIDDVKGLETVAVTEVNARHILIKPTIILSDEG 300

Query: 301 EAEYVKKLRSNAI 313
             + + +      
Sbjct: 301 AQKQLNEFVQRIK 313



 Score = 82.0 bits (200), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 34/269 (12%), Positives = 82/269 (30%), Gaps = 4/269 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     LL  +       KI+  +L VE  + +   +S        + +      
Sbjct: 154 ILPAEVDTLAELLAQETDATVQYKISHIQLRVEEGQDKSKAESLANKLVGELKHGADFAQ 213

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +        +   I       
Sbjct: 214 MAYTYSKGPKALQGGDWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIDDVK 273

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDC-NKLEKFASKI-HD 228
              TV    +      I    + +    QK++ +  +             ++++      
Sbjct: 274 GLETVAVTEVNARHILIKPTIILSDEGAQKQLNEFVQRIKNGEATFGELAQQYSQDPGSA 333

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ ++       + P+ T  G   + + D+R++   + ALK 
Sbjct: 334 AQKGELGYQTPDLYVPEFKHQIEILPVGQISEPFQTVHGWHIVEVLDRREVDRTDSALKN 393

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
                    K  +  + ++++LR++A + 
Sbjct: 394 KAYRILFNRKFNEEASAWLQELRASAFVE 422


>gi|89898918|ref|YP_521389.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodoferax
           ferrireducens T118]
 gi|121956453|sp|Q223E5|SURA_RHOFD RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|89343655|gb|ABD67858.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodoferax
           ferrireducens T118]
          Length = 459

 Score =  131 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 39/294 (13%), Positives = 92/294 (31%), Gaps = 20/294 (6%)

Query: 38  MSSRIRTTINGEVITDGDISKRIALLKLQKING--------ELEKIAVQELIVETLKKQE 89
            +  I   +N E IT+ ++   +  +  Q             L +  ++ LI E  + Q 
Sbjct: 50  AADYIVAVVNSEPITNNEVRAALQRVLQQLAQQGNPQVDSKTLVRQVLERLINEKAQLQL 109

Query: 90  IEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVK 149
             +SGI  D   ++      AR   L+  +    L ++G     F+  L  Q +   + +
Sbjct: 110 ARESGIAADEAAIDQAEQNIARQNQLTVAELRRRLTQEGGVPGQFRNQLRDQILLTRLRE 169

Query: 150 NDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESR 209
            +   +    E+EI    ++ ++ T     I      +          V      A+ + 
Sbjct: 170 REVEPRARVSELEIDQFLREQQSSTPAVQQINLAQVLVSVPDTATPVQVTALQARAQRAL 229

Query: 210 LRLPKDCNK------LEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYV 262
            R     +           + K    + G+          P F +     +    +    
Sbjct: 230 ARARAGEDFVTLVREFSDASDKASLANGGELGLRTADRYPPLFLEATHNLAVGEISALVR 289

Query: 263 TQKGVEYIAICDKRDL-----GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
           +  G   + + +K+           +   ++  + +P   E    + + + +  
Sbjct: 290 SGAGFHILKVLEKKSAALPAMTVTQSRARHILLRVSPQLTESAARDKLNEFKKR 343



 Score = 95.9 bits (236), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 17/170 (10%), Positives = 47/170 (27%), Gaps = 2/170 (1%)

Query: 148 VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEE 207
           +        G   +++   K                +      +L       K  +  + 
Sbjct: 284 ISALVRSGAGFHILKVLEKKSAALPAMTVTQSRARHILLRVSPQLTESAARDKLNEFKKR 343

Query: 208 SRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKG 266
                          +        G   +       P+F+ ++   +    + P V++ G
Sbjct: 344 VAAGQADFAALARDHSQDGSAAQGGDLGWANPGMFVPEFEAVMNSLTPGQISEPLVSRFG 403

Query: 267 VEYIAICDKRDLG-GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           V  I + ++R         +  + A     K+++    + + +R  A + 
Sbjct: 404 VHLIQLMERRQATLSPQEQREAVRAMLHEKKLDEAYISWAQDVRGRAYVE 453


>gi|153007318|ref|YP_001381643.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Anaeromyxobacter sp.
           Fw109-5]
 gi|152030891|gb|ABS28659.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Anaeromyxobacter sp.
           Fw109-5]
          Length = 323

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/293 (14%), Positives = 95/293 (32%), Gaps = 17/293 (5%)

Query: 40  SRIRTTINGEVITDGDISKRI--ALLKLQKINGELE---------KIAVQELIVETLKKQ 88
            R+   +NGEV+T  ++++R   ALLK +++    E         K A  +++ E L + 
Sbjct: 23  DRVAALVNGEVVTLSELAERAGPALLKAEQLPAGAERESAQTAALKRAFDDVVAERLLQS 82

Query: 89  EIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVV 148
           +  +  +      V+       R  G         L +QGI    F+  +  +     V+
Sbjct: 83  KAAELQLEATEAQVDEAVEDIKRRNGFDDAALERALKEQGIDRATFRANVKREYDAFLVL 142

Query: 149 KNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEES 208
           +     K    + ++    Q        E  ++     +P  +   +    K        
Sbjct: 143 QYQVRSKVKVSDDDLRNYYQSHPQEFGGEDEVKVRHIFLPMPEGATKAQQAKVEDQMNRV 202

Query: 209 RLRLPKDCNKLE---KFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQ 264
             RL    +      + +        G   +L    +    ++          + P    
Sbjct: 203 LQRLKTGEDFAAVAREVSKGPSAAEGGDLGWLRRGTIDKALEDTAFALQAGQLSQPVRAG 262

Query: 265 KGVEYIAICDKRDL--GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            G+    + ++R          K  + A     +   +  + + +LR +A+I 
Sbjct: 263 PGLHLFKVEERRVAGEKSFEDAKEEIRAHLVDQQAGTYRQQLIAELRRDALIE 315


>gi|297537786|ref|YP_003673555.1| SurA domain-containing protein [Methylotenera sp. 301]
 gi|297257133|gb|ADI28978.1| SurA domain protein [Methylotenera sp. 301]
          Length = 448

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 52/318 (16%), Positives = 106/318 (33%), Gaps = 19/318 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWA---MSSRIRTTINGEVITDGDISKRIALLKLQKIN 69
           IK    + +L     +        A      RI   ++  VIT+ ++  RIA +  Q   
Sbjct: 15  IKHAIQFILLASVLFIGNQFNAQAADIVKLDRIVAIVDQTVITEQELESRIATVTAQFKK 74

Query: 70  GE--------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFS 121
                     L K  ++ LI +TL+ Q   + G+  D N ++    + A    L+  +FS
Sbjct: 75  QGTELPEESVLRKQILERLITDTLQIQYAAQIGLKVDDNQLDKTVERIADQNNLTLTEFS 134

Query: 122 SFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIR 181
             L K GI    F+  +  +     + + +   +    E EI        ++        
Sbjct: 135 EALAKDGISMRKFRADIRNEITVARLREREVDGRVNVSESEIDNYLTSQASLNENTDEFE 194

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE---KFASKIHDVSIGKAQYLL 238
                I   +      +QK     +E+  +L    +  +    F+   + +  G   +  
Sbjct: 195 ISHILIRTPEEGATEDIQKAKAKVDEALSQLNSGVSFAKVSASFSDAPNALEGGSLGWKK 254

Query: 239 ESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNT 293
            S +   F   L        + P  +  G   + + +KR     L  +     ++  + T
Sbjct: 255 GSQMPALFLDALKNMQAGEVSAPLRSPNGFHLLKLTNKRGGNSPLVIQQTHARHILIKIT 314

Query: 294 PTKIEKHEAEYVKKLRSN 311
               +K     +  ++  
Sbjct: 315 EVMSDKEAETKIDAIKER 332



 Score = 96.3 bits (237), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 19/139 (13%), Positives = 49/139 (35%), Gaps = 2/139 (1%)

Query: 179 LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLL 238
                   I   ++ +    + +I   +E      K      +F+      + G   ++ 
Sbjct: 303 QTHARHILIKITEVMSDKEAETKIDAIKERLDNGEKFEVLARQFSEDSTASNGGDLNWVN 362

Query: 239 ESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKR-DLGGEIALKAYLSAQNTPTK 296
             D  P F+N +        + P  +Q G   I + ++R     + + +     +    K
Sbjct: 363 PGDTVPPFENAMNALKDGQISAPVRSQFGWHIIQVMERRSQDMSKESARLKARQEIRARK 422

Query: 297 IEKHEAEYVKKLRSNAIIH 315
            ++   +++++LR  A + 
Sbjct: 423 ADEAYQDWIRELRDRAYVE 441


>gi|262172454|ref|ZP_06040132.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio mimicus MB-451]
 gi|261893530|gb|EEY39516.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio mimicus MB-451]
          Length = 431

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/313 (12%), Positives = 107/313 (34%), Gaps = 12/313 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +KL     + +I  +    ++        +   +N  VI   D+   +  +K        
Sbjct: 1   MKLWKPTLISVISALTLFNAHAEPQQLDSVAVIVNSGVILQSDVDGALKTVKANAKQNNQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++TL++QE E+ G+  D N +N    + A+N   + E   S +
Sbjct: 61  PLPQETVLREQVLEKLIIDTLQQQEAERIGVKIDDNRLNDAIKEIAKNNQQTQEQLISSV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            ++G+    F++ +  +    D        +   L  E+    + +   T      +   
Sbjct: 121 AQEGLTYPEFREQVRKEMAASDARNALVRRRINILPAEVDTLAELLAQETDATVQYKISH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +   + Q++   +                      ++     +  G   ++ + ++  
Sbjct: 181 IQLRVEEGQDKSEAESLANKLVGELKHGADFAQMAYTYSKGPKALQGGDWGWMRKEEMPT 240

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F +    +++ +   P+ +  G   + I D +    +        ++  + T    ++ 
Sbjct: 241 IFADQIKMQNKGSIIGPFRSGVGFHILKIDDVKGLETVAVTEVNARHILIKPTIILSDEG 300

Query: 301 EAEYVKKLRSNAI 313
             + + +      
Sbjct: 301 AQKQLNEFIQRIK 313



 Score = 82.0 bits (200), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 34/269 (12%), Positives = 82/269 (30%), Gaps = 4/269 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     LL  +       KI+  +L VE  + +   +S        + +      
Sbjct: 154 ILPAEVDTLAELLAQETDATVQYKISHIQLRVEEGQDKSEAESLANKLVGELKHGADFAQ 213

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +        +   I       
Sbjct: 214 MAYTYSKGPKALQGGDWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKIDDVK 273

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDC-NKLEKFASKI-HD 228
              TV    +      I    + +    QK++ +  +             ++++      
Sbjct: 274 GLETVAVTEVNARHILIKPTIILSDEGAQKQLNEFIQRIKNGEATFGELAQQYSQDPGSA 333

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ ++       + P+ T  G   + + D+R++   + ALK 
Sbjct: 334 AQKGELGYQTPDLYVPEFKHQIEILPVGQISEPFQTVHGWHIVEVLDRREVDRTDSALKN 393

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
                    K  +  + ++++LR++A + 
Sbjct: 394 KAYRILFNRKFNEEASAWLQELRASAFVE 422


>gi|294634977|ref|ZP_06713494.1| peptidylprolyl cis-trans isomerase SurA [Edwardsiella tarda ATCC
           23685]
 gi|291091576|gb|EFE24137.1| peptidylprolyl cis-trans isomerase SurA [Edwardsiella tarda ATCC
           23685]
          Length = 434

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 39/311 (12%), Positives = 111/311 (35%), Gaps = 18/311 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI--------NGEL 72
           +++   +    ++ +  +  ++   ++  V+ + D+   +  +KL           N  L
Sbjct: 7   LILGVVLCANTAFAAPQVVDKVVAIVDNGVVLESDVDGMMKSVKLNAQQAGQQLPDNATL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ ++ Q  ++ G+    + ++      A    L+ +   S L   G+   
Sbjct: 67  RHQILERLIMDNIQLQMAKRMGLEVSDSELDNAINGIAAQNHLTPQQLRSRLAADGLDYK 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            ++  +  + +  +V  N+   +   L  E+ A  +++ +    E  +      IP  + 
Sbjct: 127 AYRAQIRKEMLISEVRNNEVRRRVTILPQEVDALAKQISSQNSGETAVNLSHILIPLPEN 186

Query: 193 QNQGFVQKRIKDAEESRLR---LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
             Q  V +  + AE    +             +++    +  G+  +    +L   F + 
Sbjct: 187 PTQQQVSEAQQQAESLVQQLRHGADFAKLAATYSADPQALKGGEMGWGRLQELPTLFAEA 246

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKHEAEY 304
           L    + +   P  +  G   + + D R    ++        ++  + +P   +      
Sbjct: 247 LQSAKKGDIVGPIRSGVGFHILRVNDLRGDQANVAVTEVHARHILLRTSPVMSDAQARAK 306

Query: 305 VKKLRSNAIIH 315
           ++ L   A I 
Sbjct: 307 LEAL--AAQIK 315



 Score = 87.8 bits (215), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/285 (12%), Positives = 80/285 (28%), Gaps = 17/285 (5%)

Query: 47  NGEV-----ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNT 101
           N EV     I   ++      +  Q        ++   LI       + + S     + +
Sbjct: 143 NNEVRRRVTILPQEVDALAKQISSQNSGETAVNLS-HILIPLPENPTQQQVSEAQQQAES 201

Query: 102 VNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND-------FML 154
           +       A    L+A   +     +G      +           +              
Sbjct: 202 LVQQLRHGADFAKLAATYSADPQALKGGEMGWGRLQELPTLFAEALQSAKKGDIVGPIRS 261

Query: 155 KYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
             G   + +   +    N+ V E   R +L          Q    K    A + +     
Sbjct: 262 GVGFHILRVNDLRGDQANVAVTEVHARHILLRTSPVMSDAQA-RAKLEALAAQIKSGQIT 320

Query: 215 DCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAI 272
                ++++         G   + + S   P F++  +K ++   + P  +  G   I +
Sbjct: 321 FEQAAKQYSDDPGSAQKGGDLGWAVPSMYDPAFRDALMKLNKGEISQPVHSNFGWHLIQL 380

Query: 273 CDKRDLG-GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
              R +   + A K          K  +    ++++ R+ A +  
Sbjct: 381 LGTRQVDRTDEAQKERAYRILFNRKFAEEAQTWLQEQRAAAYVKI 425


>gi|82701654|ref|YP_411220.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Nitrosospira
           multiformis ATCC 25196]
 gi|122070651|sp|Q2YBP3|SURA_NITMU RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|82409719|gb|ABB73828.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Nitrosospira
           multiformis ATCC 25196]
          Length = 440

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/308 (12%), Positives = 107/308 (34%), Gaps = 17/308 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--------EL 72
           +L    I    ++        I   +N  VIT  ++ + +  +  Q             L
Sbjct: 18  LLAGMAIAQQPAHSGVETIDHIVAVVNENVITRHELDEMLGAMLKQLQKQGVQPPPPAVL 77

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           EK  ++ +I+  ++ Q   ++G+T     ++    + A+   +S ++F   L + G+  +
Sbjct: 78  EKQLLERIILNRVQLQLANETGLTVSDAELDQTLRRIAQENKMSLQEFDRALAEDGVSFS 137

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            F+  +  + I   + + +   +    E E+    +  ++   +    R     I  ++ 
Sbjct: 138 KFRDEIRDEIILVRLKEREVSNRVSVTEGEVDHFLETQEDSPSQSDEYRIAHILIQVSEG 197

Query: 193 QNQGFVQKRIKDAEESRLRLP---KDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +        + AE +  +L    +      +F+     +  G   +   + L  +F + 
Sbjct: 198 ADPLKRDAARQRAESALAKLKAGTEFAQVAAEFSDAPDAMEGGLLNWRPAAQLTKKFAEI 257

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-----EIALKAYLSAQNTPTKIEKHEAE 303
           L        T    +  G   + + ++R+        +     ++  + +    E     
Sbjct: 258 LTPMKPGEITGIIPSPNGFHILKLVERRNQDTVTTMIDQTHARHILIKISELTSEADAHR 317

Query: 304 YVKKLRSN 311
            V +L+  
Sbjct: 318 RVTELKER 325



 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 22/167 (13%), Positives = 54/167 (32%), Gaps = 2/167 (1%)

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
            +       +     ++    +T            I  ++L ++    +R+ + +E    
Sbjct: 269 IIPSPNGFHILKLVERRNQDTVTTMIDQTHARHILIKISELTSEADAHRRVTELKERLDN 328

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYI 270
             K     +  +      + G   ++   D  P+F+  +        ++P  +  G   I
Sbjct: 329 GSKFEELAKLHSEDASAPTGGDLGWISPGDTVPEFEQAMSALKPGEISSPVQSPFGWHLI 388

Query: 271 AICDKRDLGGEIALKAY-LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            + ++R        K           K E    E++++LR  A + Y
Sbjct: 389 QVIERRTQDVSQERKRQSARQAIRARKAETAFQEWLQRLRDRAYVEY 435


>gi|85711793|ref|ZP_01042849.1| Periplasmic parvulin-like peptidyl-prolyl isomerase [Idiomarina
           baltica OS145]
 gi|85694408|gb|EAQ32350.1| Periplasmic parvulin-like peptidyl-prolyl isomerase [Idiomarina
           baltica OS145]
          Length = 432

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 44/318 (13%), Positives = 112/318 (35%), Gaps = 16/318 (5%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI 68
           +   +K  T+  + ++ CI   V++    +  R+   ++  VI +  I + I  +K  + 
Sbjct: 1   MKQLVKFSTSVSIALMMCITATVAHAQ-QVLDRVAVIVDDGVILESQIEQLIKQVKQSEN 59

Query: 69  --------NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
                   +  L   A + LI + L+ Q  E+ GI      ++    + A++ G+S ++ 
Sbjct: 60  FSSANAPSDKVLRTQATERLIQQELQLQMAERMGIEVSEAQLDQAISRIAQDRGMSVDEL 119

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQ---KMKNITVRE 177
                  G     F++ +  + I   V +     +      E+        +        
Sbjct: 120 RENTINSGQSWPAFREQIKTEIITSQVERAAVQRRVSVTPQEVENLVNLIEQNDASPTEY 179

Query: 178 YLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYL 237
            L + ++    D   + Q   ++R +   +             + +S  + +  G   ++
Sbjct: 180 RLRQILIGVDSDAPNEKQEAAKRRAQAVIDRLEEGEDFSQLAIRSSSGSNALDGGDLGWM 239

Query: 238 LESDLHPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKRD---LGGEIALKAYLSAQNT 293
            E+ +   F  ++K   +     P  +  G   + + DKR    +  +     ++  + +
Sbjct: 240 TENSMPTLFAEVVKGKSKGEIIGPIRSGVGFHILQVADKRGEQVVEVQEVKARHILIKPS 299

Query: 294 PTKIEKHEAEYVKKLRSN 311
               +    E + + R  
Sbjct: 300 VILSDNKAKEMLAQFREQ 317



 Score = 77.4 bits (188), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 16/136 (11%), Positives = 41/136 (30%), Gaps = 3/136 (2%)

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLES 240
             +   P   L +    +   +  E+            ++ ++        G   +    
Sbjct: 292 RHILIKPSVILSDNKAKEMLAQFREQILSGEKTFAELAKEHSADPGSASRGGDLGWSRPD 351

Query: 241 DLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-AYLSAQNTPTKIE 298
               +F+  +    +   + P+ TQ G   + + D+R L      K           K  
Sbjct: 352 RYAEEFKQRVSTLEKGVISEPFRTQFGWHIVEVTDRRTLDATQESKRDKAYQMLFSRKYR 411

Query: 299 KHEAEYVKKLRSNAII 314
           +    + +++R  A +
Sbjct: 412 EEVDTWRQEMRDRAYV 427


>gi|37524613|ref|NP_927957.1| peptidyl-prolyl cis-trans isomerase SurA [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|81707805|sp|Q7N8V5|SURA_PHOLL RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|36784037|emb|CAE12906.1| Survival protein SurA precursor (Peptidyl-prolyl cis-trans
           isomerase surA) (PPIase) (Rotamase C) [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 433

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 37/304 (12%), Positives = 105/304 (34%), Gaps = 16/304 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI--------NGEL 72
           ++         ++ +     +I   +N  V+ + DI+ R+  +K               L
Sbjct: 7   LIFGLMFSVSTAFAAPQQMDKIAAVVNNGVVLESDINNRLQSVKRDAQHAGQQIPDEQTL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ +  Q  ++ GIT     ++      A    ++ +     +   G+  +
Sbjct: 67  RHQILERLIIDNILLQMAKQMGITIPDQALDSTIANIAAQNHITVDQMKHRIAADGMNFD 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            ++  +  + +  +V  N+   +   L  EI A  +++ N    +  +      IP  + 
Sbjct: 127 TYRDQIRKEMLIAEVRNNEVRRRVTILPQEIDALVKQISNQNTNDTELNISHILIPLPEN 186

Query: 193 QNQGFVQKRIKDAEESRLRLP---KDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +Q  ++K +   ++    L            +++    +  G   +    +L   F + 
Sbjct: 187 PDQAQMEKAMTVVQKIMSELKHGVDFGKLAIAYSADPQALKGGNMGWSRLQELPTLFAEQ 246

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKHEAEY 304
           L    +     P  +  G   + + D R     +        ++  + +P   +      
Sbjct: 247 LQLAQKGAVVGPIRSGVGFHILKVNDIRGGNPTIAVTEVHARHILLRTSPVMTDDQARTK 306

Query: 305 VKKL 308
           ++++
Sbjct: 307 LQQI 310



 Score = 85.9 bits (210), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 36/294 (12%), Positives = 87/294 (29%), Gaps = 26/294 (8%)

Query: 43  RTTI-NGEV-----ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGIT 96
              + N EV     I   +I   +  +  Q  N     I+        +   E       
Sbjct: 138 IAEVRNNEVRRRVTILPQEIDALVKQISNQNTNDTELNIS-----HILIPLPENPDQAQM 192

Query: 97  FDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND----- 151
             + TV    +   ++     +   ++             +  +Q +     +       
Sbjct: 193 EKAMTVVQKIMSELKHGVDFGKLAIAYSADPQALKGGNMGWSRLQELPTLFAEQLQLAQK 252

Query: 152 ------FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDA 205
                      G   +++   +     I V E   R +L         +Q    K  + A
Sbjct: 253 GAVVGPIRSGVGFHILKVNDIRGGNPTIAVTEVHARHILLRTSPVMTDDQART-KLQQIA 311

Query: 206 EESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVT 263
            + R       +  ++F+      +  G   +       P F++  ++ ++   + P  +
Sbjct: 312 SDIRSGKTDFADAAKEFSDDPGSALRGGDLGWTAPDIYDPAFRDALMRLNKGEISQPVHS 371

Query: 264 QKGVEYIAICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
             G   I + D R +   ++A K          K  +    ++++ R++A +  
Sbjct: 372 SFGWHLIQLLDTRKVDKTDVAQKDRAYRMLFNRKFTEEAQSWMQEQRASAYVKI 425


>gi|118581988|ref|YP_903238.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pelobacter
           propionicus DSM 2379]
 gi|118504698|gb|ABL01181.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pelobacter
           propionicus DSM 2379]
          Length = 321

 Score =  130 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 40/297 (13%), Positives = 95/297 (31%), Gaps = 16/297 (5%)

Query: 35  SWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN---------GELEKIAVQELIVETL 85
              + + +   +N E+IT  +++     L  +              + + A+  L+ + L
Sbjct: 17  PGKLLNAVAAIVNDEIITLYEVNHEAQPLIREGEKKGSMNDEERKRIRRAALDGLVEKKL 76

Query: 86  KKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWP 145
            +Q+I++  I    + +N       R   L  E     L  QG+  + +K  L  Q    
Sbjct: 77  VEQKIKELNIKIGDDEINQAIDDVKRQNNLDQEGLVKALASQGLSYDQYKSQLREQLERL 136

Query: 146 DVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIK-- 203
            +V  +   +    E E+ A   +       +   R        N+      +++ +   
Sbjct: 137 RLVSMEVRSRIQVGESEVRAYYNENLATYSEDETFRARHIFFKTNEKAPAEEIKRTMNTA 196

Query: 204 -DAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQFQNLL-KKSQNNTTNP 260
                              ++         G      + D+ P+ +  +    Q   +  
Sbjct: 197 LMVLAEAKSGKDFAELARTYSEDPAAKKDGGDLGSFKKGDMQPELEQAILGMKQGEVSEL 256

Query: 261 YVTQKGVEYIAICDKRDLGGE--IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
             T  G   I +  +     +   ++K+ +       K E+   ++  ++R+ A I 
Sbjct: 257 VYTPLGFHLIKLEARTPGTPKPLESVKSEIEETIYRKKSEERFKKWATEMRAKASIE 313


>gi|78222035|ref|YP_383782.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter
           metallireducens GS-15]
 gi|78193290|gb|ABB31057.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter
           metallireducens GS-15]
          Length = 339

 Score =  130 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 45/337 (13%), Positives = 111/337 (32%), Gaps = 30/337 (8%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRI-------------RTTINGEVITDGD 55
           ++ F         L    ++   +  + A +++                 +NG  IT  +
Sbjct: 1   MNVFKTARRQIIALSAIALLAGTAGANAAPTAKADAKAGEAPSATTAVARVNGVDITRAE 60

Query: 56  ISKRIALLKLQKI----------NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           + +   ++  +            + ++E+ A+ +LI + L  Q  +K  I      +   
Sbjct: 61  LERAKKIILSRNQMASAAMNDEMSKKVEEAALNQLIAKELLFQAGKKQEIKDLDKKIQEK 120

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA 165
             +H       A+ +   L +  + +   + +     +  ++++   +      + E   
Sbjct: 121 VAEHKARFKSQAD-YEKALKEMDMTEKEVETFTREDMVIGNLIETKIVANTKITDDEAKK 179

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR---LPKDCNKLEKF 222
                K+   RE  +R     +  ++  +    +K  + AE    +           +K 
Sbjct: 180 FYNDNKDKFRREEAVRASHILVSADQKASPEEKKKAKEKAEALLKQLKGGADFAELAKKE 239

Query: 223 ASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLG-- 279
           +S       G   +  +  + P+F+           ++   TQ G   I + +K+D    
Sbjct: 240 SSCPSSAQGGDLGFFGKGQMVPEFEKTAFNLKPGEVSDVVETQFGYHIIKLAEKKDAETV 299

Query: 280 GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                K  +    T  K++    EYV +LR    +  
Sbjct: 300 PFEEAKERIVQFLTQQKVQAGIGEYVDELRKKGKVEI 336


>gi|309750126|gb|ADO80110.1| Putative survival protein SurA-like protein [Haemophilus influenzae
           R2866]
          Length = 313

 Score =  130 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 52/318 (16%), Positives = 112/318 (35%), Gaps = 20/318 (6%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAM-SSRIRTTINGEVITDGDISKRIALLKLQKINGE 71
           +K+        +   +  V++ S A    R+  T++G  + +  +       +       
Sbjct: 1   MKMKKFVLRSFLLAALGCVAFVSMAQAEERVVATVDGIPVLESQV-------RANMGKKG 53

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
             + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  
Sbjct: 54  DRQSAIDKIIDDILVQKAVQESGVKIDPREIDHVVEDTAARNGLTYGQFLDALDYQGISL 113

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEI---------PANKQKMKNITVREYLIRT 182
           N F+Q +A Q +   V              E+          A ++        +     
Sbjct: 114 NAFRQQIANQMMMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVTGKEYEVR 173

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQY-LLES 240
            +    +  L +    ++  K   +         +   K++       + G   Y   E+
Sbjct: 174 HILLKLNPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPET 233

Query: 241 DLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEK 299
                 Q ++K  Q   + P+ T+ G   + +   RD              +   T+++ 
Sbjct: 234 YAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGTRDGDLTSEAYTQKAYERLVNTQLQD 293

Query: 300 HEAEYVKKLRSNAIIHYY 317
              ++VK LR  A I Y+
Sbjct: 294 ATNDWVKALRKRANIQYF 311


>gi|90580797|ref|ZP_01236600.1| putative survival protein SurA [Vibrio angustum S14]
 gi|90438065|gb|EAS63253.1| putative survival protein SurA [Vibrio angustum S14]
          Length = 433

 Score =  130 bits (325), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 41/314 (13%), Positives = 119/314 (37%), Gaps = 15/314 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK----- 67
           +K      + ++   +   S  +     ++  T+N  VI   D+S  +  ++L       
Sbjct: 1   MKTWKYSVLSLMMMGMSATSMAAPQELDQVVMTVNDGVILQSDVSAMLKTVRLNAAEEHQ 60

Query: 68  ---INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
               N  L +  + +LI+E L+ Q+ ++ GI  D + ++      A+   +S +     L
Sbjct: 61  QLPPNNILRQQVMDQLILENLQIQQAQQLGIRIDDSQLDQAIADVAKQRNMSVDQLRQSL 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            K G+  + F++ +    +  +        +   L  E+ +  ++M   T +        
Sbjct: 121 AKAGVSYSMFREQMRNDMLASEARTIIVRKRVNVLPQEVESLAKQMAEQTQQNVQYNISQ 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEES---RLRLPKDCNKLEKFASKIHDVSIGKAQYLLESD 241
             I  ++  ++    K  ++AE+      +         +++     +  G+  ++ +++
Sbjct: 181 IQIRVDEDADKAERDKAKQEAEDIVAQLKKGANFSQLAYRYSKGPKALKGGEWGWMSKAE 240

Query: 242 LHPQFQNLLKKSQNN-TTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKI 297
           +   F + ++ +  +    P+ +  G   + I D +    +        ++  + +    
Sbjct: 241 MPTVFADQIQNNGKDAIIGPFRSGVGYHILKINDVKGMPSVSVVEVKARHILIKPSMILS 300

Query: 298 EKHEAEYVKKLRSN 311
           +      ++K+R +
Sbjct: 301 DAAAKAELEKIRQS 314



 Score = 81.6 bits (199), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/264 (9%), Positives = 83/264 (31%), Gaps = 4/264 (1%)

Query: 56  ISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGL 115
           ++K++A    Q +   + +I ++        +++  K         +             
Sbjct: 162 LAKQMAEQTQQNVQYNISQIQIRVDEDADKAERDKAKQEAEDIVAQLKKGANFSQLAYRY 221

Query: 116 SAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITV 175
           S    +    + G         +    I  +            +   I          +V
Sbjct: 222 SKGPKALKGGEWGWMSKAEMPTVFADQIQNNGKDAIIGPFRSGVGYHILKINDVKGMPSV 281

Query: 176 REYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK-DCNKLEKFASKI-HDVSIGK 233
               ++     I  + + +    +  ++   +S +   +      + ++       + G+
Sbjct: 282 SVVEVKARHILIKPSMILSDAAAKAELEKIRQSIISGKQTFAAAAKAYSEDPGSAANGGQ 341

Query: 234 AQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQ 291
             + +     P F++ ++    +  + P+ +  G   + +  +R +   + A+K   +  
Sbjct: 342 LGWQVPDMYAPAFKDKVETLPVDKISEPFKSTFGWHIVEVEGRRKVDRTDAAMKNRAAQI 401

Query: 292 NTPTKIEKHEAEYVKKLRSNAIIH 315
               K  +    ++++LR+ A I 
Sbjct: 402 IFNRKFNEEAQTWLQELRAGAYIE 425


>gi|49474098|ref|YP_032140.1| hypothetical protein BQ04600 [Bartonella quintana str. Toulouse]
 gi|49239602|emb|CAF25959.1| hypothetical protein BQ04600 [Bartonella quintana str. Toulouse]
          Length = 324

 Score =  130 bits (325), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 75/317 (23%), Positives = 125/317 (39%), Gaps = 9/317 (2%)

Query: 7   TSLSDFIKLLTTYFVLIIF----CIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIAL 62
           T ++ F K +   F +        +V           + I  T+NG  IT+ DI +R A 
Sbjct: 5   TYMNKFKKRILALFCIAPLSVSNLLVSGFLISPVFAQTVIVVTVNGNPITNYDIQRRTAF 64

Query: 63  LKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSS 122
           LKLQ+  G L   A  ELI E +K  EI++  I    N V   F   A    ++ +  + 
Sbjct: 65  LKLQQKQGNLAAQAKNELINEIVKNTEIKRRNIEVSDNEVESAFENFAMQNNMTVDQLNQ 124

Query: 123 FLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRT 182
            L +  I   HFK Y+  Q  W  +V   +  + G +  +    +              T
Sbjct: 125 ILMQNDITVQHFKDYIRGQIGWGRLVNARYQAEIGMVSEQEAVRRILKNGGVKPSTNEYT 184

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDL 242
           +   I       +  + +R +   +S     + C   +K A  I DV+I      LE  L
Sbjct: 185 LQQIIFVIPEHRRSEILERRQREAKSFRAHFQGCANAQKQARGILDVTIRHLGKFLEPQL 244

Query: 243 HPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS----AQNTPTKI 297
             ++ Q +        T    T  G+E +A+C  + +  +   +   S     + +P K+
Sbjct: 245 PREWGQAVRATPVGKMTQLRETTDGIEALAVCKIKRVSDDYVARLIFSLQDNKEKSPQKL 304

Query: 298 EKHEAEYVKKLRSNAII 314
           E    +Y+K+LR  A I
Sbjct: 305 EILSEKYLKELRQAAHI 321


>gi|122070641|sp|Q145L3|SURA_BURXL RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
          Length = 450

 Score =  130 bits (325), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 41/314 (13%), Positives = 99/314 (31%), Gaps = 22/314 (7%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE-------- 71
           F+ +       +S         I   +N  VIT  ++ +R+ L+  +             
Sbjct: 19  FLSVAPVQAQALSGSGGQTVDTIAAVVNNGVITRRELDERMGLITRRLNQQNAPVPPMDQ 78

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L +  + ++++E ++ Q+ ++ GIT D  TV     + A    L+ + + S ++ QG+  
Sbjct: 79  LRQQVLNQMVLERIQLQKAKEDGITIDDATVQKTLERLAAANNLTLDVYRSRIEAQGVPW 138

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNK 191
             F      +     + + +   K    + E+       +           +        
Sbjct: 139 TTFTSDARTELTLSRLREKEVDSKVTVSDAEVANYIASQRGPNAGLTSDLHLQHIFLKAP 198

Query: 192 ----LQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
                 +    Q++ +                +  +        G   ++  S L P+F 
Sbjct: 199 LNASETDIEAAQRKAQALLAEAKGGANFEKLAKSNSQAPDASKGGDTGFVSPSKLPPEFV 258

Query: 248 NLLKKSQNNTTNP--YVTQKGVEYIAICDKRDLGGE--------IALKAYLSAQNTPTKI 297
                 +    NP    T  G E + + D+R   G              ++  +      
Sbjct: 259 KAASALRPGEVNPDLIRTSDGFEIVRLVDRRAGQGTSSDAPKLVQTHVRHILLRVGDGMS 318

Query: 298 EKHEAEYVKKLRSN 311
           E    + + ++++ 
Sbjct: 319 EPQARQKLLEIKNE 332



 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 15/145 (10%), Positives = 49/145 (33%), Gaps = 2/145 (1%)

Query: 173 ITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIG 232
              +          +      ++   ++++ + +               ++        G
Sbjct: 297 DAPKLVQTHVRHILLRVGDGMSEPQARQKLLEIKNEIAAGGDFAKFAHTYSQDGSSSQGG 356

Query: 233 KAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-AYLSA 290
              ++   +  P+F+  +        ++P  ++ G   I +  +R+  G +A +      
Sbjct: 357 DLGWISPGETVPEFERAMNSLQDGQISDPVRSEYGYHLIQVLGRRESEGSVAQQMDLARQ 416

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIH 315
                K E+  A+++++LR  A + 
Sbjct: 417 AIGQRKAEQAYADWLRELRDTAYVE 441


>gi|315635080|ref|ZP_07890360.1| peptidyl-prolyl cis-trans isomerase [Aggregatibacter segnis ATCC
           33393]
 gi|315476201|gb|EFU66953.1| peptidyl-prolyl cis-trans isomerase [Aggregatibacter segnis ATCC
           33393]
          Length = 307

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 42/310 (13%), Positives = 103/310 (33%), Gaps = 20/310 (6%)

Query: 20  FVLIIFCIVPIVSY-KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQ 78
              ++F  +  +++  +     ++  T+NG  + +  +   +             + A+ 
Sbjct: 3   LKSVLFVALGFLAFIANAQAEEKVVATVNGVPVLESQVKSAL-------TKKSNRQAALD 55

Query: 79  ELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYL 138
           ++I + L  Q +++SG++ ++  V+      A   GL+       LD QGI    ++Q +
Sbjct: 56  KVIDDILVAQAVKESGVSVNNAQVDQIIEGIAAQNGLTFGQLLDALDYQGISYAAYRQQI 115

Query: 139 AIQSIWPDVVKNDFMLKYGNLEMEIPA---------NKQKMKNITVREYLIRTVLFSIPD 189
           A Q +  +V              ++ A           +               +    +
Sbjct: 116 AQQLMMSEVRNRAISQSVDVSREQVEALAKKMLAEAKAKGNVAKLTDTQYEVRHILLKLN 175

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQY-LLESDLHPQFQ 247
             L +     +  +   +         +   K++       + G   Y   E  + P  +
Sbjct: 176 PLLNDAQAKAQLEQIRADILAGKTTFADAALKYSKDYLSGANGGSLGYAFPEMYVGPFNK 235

Query: 248 NLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKHEAEYVK 306
            +    Q   + P+ T+ G   + + + R               Q    +++    ++V+
Sbjct: 236 AVRTTKQGVISAPFKTEFGWHILEVTNTRQADRTEDAYRQKAYEQIVNQQLQDSARDWVQ 295

Query: 307 KLRSNAIIHY 316
            LR  A I Y
Sbjct: 296 ALRKRANIKY 305


>gi|107099580|ref|ZP_01363498.1| hypothetical protein PaerPA_01000593 [Pseudomonas aeruginosa PACS2]
 gi|313111760|ref|ZP_07797553.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           39016]
 gi|310884055|gb|EFQ42649.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           39016]
          Length = 404

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 36/289 (12%), Positives = 98/289 (33%), Gaps = 15/289 (5%)

Query: 40  SRIRTTINGEVITDGDISKRIALLKL--------QKINGELEKIAVQELIVETLKKQEIE 91
            R+   ++ +VI    + +R+  +                L +  ++ LI+E +++Q  +
Sbjct: 5   DRVVAIVDNDVIMQSQLDQRLREVHQTLLKRGAPLPPEHVLTQQVLERLIIENIQQQIGD 64

Query: 92  KSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
           +SGI      +N      A+  G+S E F + L + G+     ++ +  + +   V +  
Sbjct: 65  RSGIRISDEELNQAMGTIAQRNGMSLEQFQAALTRDGLSYADAREQVRREMVISRVRQRR 124

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIR---TVLFSIPDNKLQNQGFVQKRIKDAEES 208
              +    E E+                 R    ++               ++ ++  + 
Sbjct: 125 VAERIQVSEQEVKNFLASDMGKIQLSEEYRLANILIPVPEAASSDVIQAAARQAQELYQQ 184

Query: 209 RLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGV 267
             +           ++  + +  G+  +   + L   F +++   +  + T P  T  G 
Sbjct: 185 LKQGADFGQLAISRSAGDNALEGGEIGWRKAAQLPQPFDSMIGSLAVGDVTEPVRTPGGF 244

Query: 268 EYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAI 313
             + + +KR       +     ++  + +  + E    +  +KL     
Sbjct: 245 IILKLEEKRGGSKMVRDEVHVRHILLKPSEIRSEAETEKLAQKLYERIQ 293



 Score = 90.9 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 15/139 (10%), Positives = 49/139 (35%), Gaps = 3/139 (2%)

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLE 239
                 +  ++++++   +K  +   E            + F+      ++ G   ++  
Sbjct: 264 HVRHILLKPSEIRSEAETEKLAQKLYERIQSGEDFGELAKSFSEDPGSALNGGDLNWIDP 323

Query: 240 SDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKI 297
             L P+F+  +    Q   + P+ +Q G   + +  +R        +     +     K 
Sbjct: 324 EALVPEFRQVMNDTPQGELSKPFRSQFGWHILQVLGRRATDSSEKFREQQAVSVLRNRKY 383

Query: 298 EKHEAEYVKKLRSNAIIHY 316
           ++    +++++R  A +  
Sbjct: 384 DEELQAWLRQIRDEAYVEI 402


>gi|319775614|ref|YP_004138102.1| survival protein SurA [Haemophilus influenzae F3047]
 gi|317450205|emb|CBY86421.1| survival protein SurA homolog [Haemophilus influenzae F3047]
          Length = 311

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 56/316 (17%), Positives = 114/316 (36%), Gaps = 20/316 (6%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMS-SRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +        +   +  V++ S A +  R+  T++G  I +  +       +         
Sbjct: 1   MKKFVLRSFLLAALGCVAFASMAQAGERVVATVDGIPILESQV-------RANMGKKGDR 53

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 54  QSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNT 113

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEI----------PANKQKMKNITVREYLIRTV 183
           F+Q +A Q +   V              E+             K   + +  +EY +R +
Sbjct: 114 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 173

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQY-LLESDL 242
           L  +       Q   Q     ++    +       L+     +   + G   Y   E+  
Sbjct: 174 LLKLNPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPETYA 233

Query: 243 HPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKHE 301
               Q ++K  Q   + P+ T+ G   + +   RD              +   T+++   
Sbjct: 234 PQFAQTVVKSKQGVISAPFKTEFGWHILEVTGVRDGDLTAEAYTQKAYERLVNTQLQDAT 293

Query: 302 AEYVKKLRSNAIIHYY 317
            ++VK LR  A I Y+
Sbjct: 294 NDWVKALRKRANIQYF 309


>gi|218665253|ref|YP_002427402.1| survival protein SurA [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|218517466|gb|ACK78052.1| survival protein SurA [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 436

 Score =  129 bits (324), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 35/290 (12%), Positives = 101/290 (34%), Gaps = 13/290 (4%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE---------LEKIAVQELIVET 84
           ++     ++   +N  +IT   + +R+  ++ +              L +  +Q++I++ 
Sbjct: 25  QNTQNLDKVVAVVNDNIITSMQLEQRVGAVRARLQTQNPNAMPPEDILRRQVLQQMILQD 84

Query: 85  LKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIW 144
           ++ Q   ++GI  D  T++      A+   L+ +     L  QG     F   L  + + 
Sbjct: 85  IELQIAHRAGIKVDKATLDQAISNLAQANHLTPDQLRQALANQGQSWERFTHDLEDRILV 144

Query: 145 PDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKD 204
             +++ +   +      E+    Q++K +    + ++ +   +PDN   +     +R  +
Sbjct: 145 DRLMQQEVENRVHIGPDEVKTFAQQLKEMGGVSFDLQQIFIPLPDNPTPDAVGAARRDAE 204

Query: 205 A-EESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYV 262
              +  L   +      + +S    +  G+  ++   +L P      L+      +    
Sbjct: 205 QARDHVLAGERFGRVATQVSSGRDALQGGRLGWIKAGELPPAVAQTLLQLKVGEISPVIP 264

Query: 263 TQKGVEYIAICDKR--DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRS 310
              G     + D +           A +  +   +   +      + ++ 
Sbjct: 265 GPTGFHIFKLLDVKHGQPTVTEVKTAMIVLRAGNSLQLQEAEARAQDIQQ 314



 Score = 68.9 bits (166), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 13/123 (10%), Positives = 39/123 (31%), Gaps = 3/123 (2%)

Query: 196 GFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL-LKKS 253
              + R +D +++     +       ++       + G+  ++    L    +   L   
Sbjct: 303 QEAEARAQDIQQALQSGTRFSELARSYSQDPRTAANGGEMGWVAPGQLPDSLERTLLTLQ 362

Query: 254 QNNTTNPYVTQKGVEYIAICDKRDLGGEI-ALKAYLSAQNTPTKIEKHEAEYVKKLRSNA 312
               ++P      +  +    +R    E   + A    Q     + +   E+ +++R  A
Sbjct: 363 PGGVSSPIRVGNAIYILHSQAQRQQAVEEKQIMAAARMQLYNRIVHERMDEWQRRIRDGA 422

Query: 313 IIH 315
            + 
Sbjct: 423 YVE 425


>gi|85858737|ref|YP_460939.1| peptidyl-prolyl cis-trans isomerase [Syntrophus aciditrophicus SB]
 gi|85721828|gb|ABC76771.1| peptidyl-prolyl cis-trans isomerase [Syntrophus aciditrophicus SB]
          Length = 322

 Score =  129 bits (324), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 44/321 (13%), Positives = 114/321 (35%), Gaps = 18/321 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING-- 70
           +K L  +  L++  ++  +      +  RI   +N E+IT  +++      + +  +   
Sbjct: 1   MKKLQIFTFLLLSVLMATL-QARAEIVDRIVAFVNDEIITLHELNTAFEPYRKKIDDSYK 59

Query: 71  ---------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFS 121
                    E     +  +I   L +QE +KS I      V      +      + + F 
Sbjct: 60  GTDKDRIMSETRLTLLNRMIDNLLIEQEAKKSAIAVSDEEVMASIRDNLARRKTTMDAFQ 119

Query: 122 SFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANK--QKMKNITVREYL 179
             L ++G     +K+ +    +   +++ +   K    + EI       + +        
Sbjct: 120 QSLAREGTNFEDYKKEMRDSMVRTRLLRREVRSKVTVNDEEIGEYYRLHREEYEGKDAVK 179

Query: 180 IRTVLFSIPDNKLQN-QGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLL 238
           ++ +L   P N  +N +  +Q    +  +         +   +F+        G   ++ 
Sbjct: 180 LKHILLLFPGNMDENAKAKLQADAMEILKRLRMGESFDSLAARFSQGPAASDGGNVGFVE 239

Query: 239 ES-DLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDL--GGEIALKAYLSAQNTPT 295
           +   L    +      ++  ++   +  G   I + D+R         ++A + ++    
Sbjct: 240 KGAMLPEVEKAAFSLDRDKISDLIESPVGFHIIKVIDRRGPGLKPIEEVRAEIKSRLEDG 299

Query: 296 KIEKHEAEYVKKLRSNAIIHY 316
           KIEK    ++ +LR+ +++  
Sbjct: 300 KIEKKFDSWISELRAKSLVEI 320


>gi|296161011|ref|ZP_06843822.1| SurA domain protein [Burkholderia sp. Ch1-1]
 gi|295888710|gb|EFG68517.1| SurA domain protein [Burkholderia sp. Ch1-1]
          Length = 453

 Score =  129 bits (324), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 41/314 (13%), Positives = 100/314 (31%), Gaps = 22/314 (7%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE-------- 71
           F+ +       +S  S      I   +N  VIT  ++ +R+ L+  +             
Sbjct: 22  FLSVAPVQAQALSGSSGQTVDTIAAVVNNGVITRRELDERMGLITRRLNQQNAPVPPMDQ 81

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L +  + ++++E ++ Q+ ++ GI  D  TV     + A    L+ + + S ++ QG+  
Sbjct: 82  LRQQVLNQMVLERIQLQKAKEDGINIDDATVQKTLERLAAANNLTLDVYRSRIEAQGVPW 141

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNK 191
           + F      +     + + +   K    + E+       +           +        
Sbjct: 142 STFTSDARTELTLSRLREKEVDSKVTVSDAEVANYIASQRGPNAGLTSDLHLQHIFLKAP 201

Query: 192 ----LQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
                 +    Q++ +                +  +        G   ++  S L P+F 
Sbjct: 202 LNASETDIEAAQRKAQALLAEAKGGANFEKLAKSNSQAPDASKGGDTGFVSPSKLPPEFV 261

Query: 248 NLLKKSQNNTTNP--YVTQKGVEYIAICDKRDLGGE--------IALKAYLSAQNTPTKI 297
                 +    NP    T  G E + + D+R   G              ++  +      
Sbjct: 262 KAASTLRPGEINPDLIRTNDGFEIVRLVDRRTGQGTSSDAPKLVQTHVRHILLRVGDGMS 321

Query: 298 EKHEAEYVKKLRSN 311
           E    + + ++++ 
Sbjct: 322 EPQARQKLLEIKNE 335



 Score =  103 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 15/145 (10%), Positives = 49/145 (33%), Gaps = 2/145 (1%)

Query: 173 ITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIG 232
              +          +      ++   ++++ + +               ++        G
Sbjct: 300 DAPKLVQTHVRHILLRVGDGMSEPQARQKLLEIKNEIAAGGDFAKFAHTYSQDGSSSQGG 359

Query: 233 KAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-AYLSA 290
              ++   +  P+F+  +        ++P  ++ G   I +  +R+  G +A +      
Sbjct: 360 DLGWISPGETVPEFERAMNSLQDGQISDPVRSEYGYHLIQVLGRRESEGSVAQQMDLARQ 419

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIH 315
                K E+  A+++++LR  A + 
Sbjct: 420 AIGQRKAEQAYADWLRELRDTAYVE 444


>gi|108760198|ref|YP_628739.1| putative foldase protein PrsA [Myxococcus xanthus DK 1622]
 gi|108464078|gb|ABF89263.1| putative foldase protein PrsA [Myxococcus xanthus DK 1622]
          Length = 349

 Score =  129 bits (324), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 33/314 (10%), Positives = 97/314 (30%), Gaps = 25/314 (7%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSR---IRTTINGEVITDGDISKRI--------ALLK 64
                 + +   V + +     M +    +  ++NGEV++  D  + +           +
Sbjct: 26  FLVPLAIALAAGVGMPACTKPVMETPEALVVASVNGEVLSRADFEQELWRELALTDVSQR 85

Query: 65  LQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
             +     ++  +   I   L  QE  K  +T     V+   ++   +    A +F+  L
Sbjct: 86  TLEDVEPFKRALLDTYIHRMLLLQEARKHNVTVTPEEVDRGVLRL--SGDYPAGNFNEVL 143

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            +  +     +   A +     +  +    +    E E+ A     +        +    
Sbjct: 144 AQGQLSMAELRSREASRLTIEKLFASHVYSRVAVTEEELRAWYGAHEKDFHEPEQVHAAQ 203

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +       +   Q +            K  +   +++        G   +     + P
Sbjct: 204 IVVKGLDEARRLQTQLK---------SGKKFADLARRYSLSADAKVGGDLGFFPRGQMPP 254

Query: 245 QF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDL--GGEIALKAYLSAQNTPTKIEKHE 301
            F + + K      ++   T+ G     + +++       + +++ +  +    K  + +
Sbjct: 255 AFDEVVFKLGVGQVSDVVSTEYGFHLFRVLERKPARKREFVEVRSLVEGKLLEQKRSQAQ 314

Query: 302 AEYVKKLRSNAIIH 315
             + ++LR  A + 
Sbjct: 315 ETFEQELRQKAQVQ 328


>gi|301169179|emb|CBW28776.1| survival protein SurA homolog [Haemophilus influenzae 10810]
          Length = 311

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 56/316 (17%), Positives = 114/316 (36%), Gaps = 20/316 (6%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMS-SRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +        +   +  V++ S A +  R+  T++G  I +  +       +         
Sbjct: 1   MKKFVLRSFLLAALGCVAFASMAQAGERVVATVDGIPILESQV-------RANMGKKGDR 53

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 54  QSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNT 113

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEI----------PANKQKMKNITVREYLIRTV 183
           F+Q +A Q +   V              E+             K   + +  +EY +R +
Sbjct: 114 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 173

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQY-LLESDL 242
           L  +       Q   Q     ++    +       L+     +   + G   Y   E+  
Sbjct: 174 LLKLNPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPETYA 233

Query: 243 HPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKHE 301
               Q ++K  Q   + P+ T+ G   + +   RD              +   T+++   
Sbjct: 234 PQFAQTVMKSKQGVISAPFKTEFGWHILEVTGVRDGDLTAEAYTQKAYERLVNTQLQDAT 293

Query: 302 AEYVKKLRSNAIIHYY 317
            ++VK LR  A I Y+
Sbjct: 294 NDWVKALRKRANIQYF 309


>gi|91781822|ref|YP_557028.1| putative peptidyl-prolyl cis-trans isomerase [Burkholderia
           xenovorans LB400]
 gi|91685776|gb|ABE28976.1| Putative peptidyl-prolyl cis-trans isomerase [Burkholderia
           xenovorans LB400]
          Length = 453

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 41/314 (13%), Positives = 99/314 (31%), Gaps = 22/314 (7%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE-------- 71
           F+ +       +S         I   +N  VIT  ++ +R+ L+  +             
Sbjct: 22  FLSVAPVQAQALSGSGGQTVDTIAAVVNNGVITRRELDERMGLITRRLNQQNAPVPPMDQ 81

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L +  + ++++E ++ Q+ ++ GIT D  TV     + A    L+ + + S ++ QG+  
Sbjct: 82  LRQQVLNQMVLERIQLQKAKEDGITIDDATVQKTLERLAAANNLTLDVYRSRIEAQGVPW 141

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNK 191
             F      +     + + +   K    + E+       +           +        
Sbjct: 142 TTFTSDARTELTLSRLREKEVDSKVTVSDAEVANYIASQRGPNAGLTSDLHLQHIFLKAP 201

Query: 192 ----LQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
                 +    Q++ +                +  +        G   ++  S L P+F 
Sbjct: 202 LNASETDIEAAQRKAQALLAEAKGGANFEKLAKSNSQAPDASKGGDTGFVSPSKLPPEFV 261

Query: 248 NLLKKSQNNTTNP--YVTQKGVEYIAICDKRDLGGE--------IALKAYLSAQNTPTKI 297
                 +    NP    T  G E + + D+R   G              ++  +      
Sbjct: 262 KAASALRPGEVNPDLIRTSDGFEIVRLVDRRAGQGTSSDAPKLVQTHVRHILLRVGDGMS 321

Query: 298 EKHEAEYVKKLRSN 311
           E    + + ++++ 
Sbjct: 322 EPQARQKLLEIKNE 335



 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 15/145 (10%), Positives = 49/145 (33%), Gaps = 2/145 (1%)

Query: 173 ITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIG 232
              +          +      ++   ++++ + +               ++        G
Sbjct: 300 DAPKLVQTHVRHILLRVGDGMSEPQARQKLLEIKNEIAAGGDFAKFAHTYSQDGSSSQGG 359

Query: 233 KAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-AYLSA 290
              ++   +  P+F+  +        ++P  ++ G   I +  +R+  G +A +      
Sbjct: 360 DLGWISPGETVPEFERAMNSLQDGQISDPVRSEYGYHLIQVLGRRESEGSVAQQMDLARQ 419

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIH 315
                K E+  A+++++LR  A + 
Sbjct: 420 AIGQRKAEQAYADWLRELRDTAYVE 444


>gi|260912727|ref|ZP_05919213.1| chaperone/peptidyl-prolyl cis-trans isomerase SurA [Pasteurella
           dagmatis ATCC 43325]
 gi|260633105|gb|EEX51270.1| chaperone/peptidyl-prolyl cis-trans isomerase SurA [Pasteurella
           dagmatis ATCC 43325]
          Length = 311

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 59/318 (18%), Positives = 121/318 (38%), Gaps = 20/318 (6%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE 71
            +K L    +      +  +S  + A + R+  T+NG  + +  +       K       
Sbjct: 1   MMKTLNIKSIFFALVGLFAISTTTQA-AERVVATVNGIPVLESQV-------KANSGKKG 52

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
             + A+ + I + L +Q I+ SG+  +   V+      A   GL+   F   LD QGI  
Sbjct: 53  NRQAALDKAIDDILVQQAIQNSGVKVNYAQVDQIIEGIAAQNGLTYGQFLDALDYQGISY 112

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP----------ANKQKMKNITVREYLIR 181
           N ++Q +A Q +  +V              ++             K   K ++ ++Y +R
Sbjct: 113 NTYRQQIANQLLMTEVRNQAIGQSIDVTREQVEALGKQLLQEAKEKGTEKKVSGKQYEVR 172

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQY-LLES 240
            +L  +       Q   Q     A+    ++      L+     +   + G   +   E+
Sbjct: 173 HILLKLNPLLNDTQAKAQLSQIRADIMAGKMTFADAALKYSKDYLSGANGGSLGFAFPET 232

Query: 241 DLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIAL-KAYLSAQNTPTKIEK 299
            + P  + ++   Q   + P+ T+ G   + + + RD    +   +     Q   ++++ 
Sbjct: 233 YVGPFQKTVITSKQGVISAPFKTEFGWHILEVTNTRDGDRTLDAYRQQAYEQLINSQVKD 292

Query: 300 HEAEYVKKLRSNAIIHYY 317
            E ++VK LR NA I Y+
Sbjct: 293 AEKDWVKALRKNADIQYF 310


>gi|319408317|emb|CBI81970.1| conserved exported hypothetical protein [Bartonella schoenbuchensis
           R1]
          Length = 308

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 71/301 (23%), Positives = 127/301 (42%), Gaps = 5/301 (1%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQEL 80
           +L +          S    + +  T+NG  IT+ DI +RIA LKLQ+  G+L   A  EL
Sbjct: 1   MLGVSSFTGAFFISSVFAQTTVAITVNGNPITNYDIQRRIAFLKLQQKQGDLSAQARNEL 60

Query: 81  IVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAI 140
           I E LK  EI++  I    N +N  F   A    ++ +  S  L++  + + HFK Y++ 
Sbjct: 61  IDEMLKNIEIQRLNIDVSDNEINSAFANFAEQNNMTVDQLSEMLNQTEVTEEHFKAYISG 120

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQK 200
           Q  W  +V   +  + G L  +  A++              T+   I       +  +  
Sbjct: 121 QMGWGRLVNARYQSEDGYLSEQEAAHRILKNGGIKPSTNEYTLQQIIFVIPAHRRAELLT 180

Query: 201 RIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTN 259
           +      +     + C+  +K    I DV++      LE  L   ++  ++ +     T 
Sbjct: 181 KRTQEINNFRAHFRGCDNTKKQTRGILDVTVRNLGKFLEPQLPTDWEQAIRATPAGKMTQ 240

Query: 260 PYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTP----TKIEKHEAEYVKKLRSNAIIH 315
           P+ T  G+E +A+C  + +  +   +   S Q++      K+E    +Y+K+LR  A I 
Sbjct: 241 PHETPYGIEALAVCQIKKVSDDRVAQLMFSIQDSQKRTPQKLEALSEKYLKELRQRAHIQ 300

Query: 316 Y 316
            
Sbjct: 301 N 301


>gi|239906716|ref|YP_002953457.1| putative peptidyl-prolyl cis-trans isomerase [Desulfovibrio
           magneticus RS-1]
 gi|239796582|dbj|BAH75571.1| putative peptidyl-prolyl cis-trans isomerase [Desulfovibrio
           magneticus RS-1]
          Length = 371

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 53/335 (15%), Positives = 112/335 (33%), Gaps = 32/335 (9%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI 68
           + D +  +  +F ++           +  +  R+   +NG++IT  D++ R+A +  Q  
Sbjct: 38  MEDTLPQIAKFFGVLALLASLATPAGAAELVDRVVAVVNGKLITLFDVNTRVADMVKQTQ 97

Query: 69  N----------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
                       +L +  ++ +I + L + E  K  +T     ++    +  +   LS +
Sbjct: 98  GVALKPDDPRLDDLRRQVLESMITDMLIESEANKLKVTVSDTEIDSQIEEIKKKNNLSQQ 157

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITV--R 176
            F + L K+G+    F+  + + SI   ++      K    + EI    +K K      +
Sbjct: 158 QFVTELAKEGLTLKQFRDKMRLDSIKKRLLGFMVHRKVLVTDDEIRDYYEKNKGSLSAAK 217

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQY 236
             L   V   +    + N+   ++         +      +  +KF+        G    
Sbjct: 218 SVLGPKVSGGLGFIMVPNKKQAEELRDRINSGSMSF---ADAAKKFSIGPGRDQGGDLGD 274

Query: 237 LLESDL-HPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDL---------------GG 280
           +   DL  P    L        + P +   G   + +                       
Sbjct: 275 VQIKDLAPPLRSALTAVPPGQVSEPVLLD-GKAVLLVQRTASAPAEKPAAPAAAAGSNPS 333

Query: 281 EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
             A K  +       K +K   EY+  LRS A++ 
Sbjct: 334 YEAAKEQIQELLYKQKFDKLFQEYIDNLRSKAVVE 368


>gi|322434749|ref|YP_004216961.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Acidobacterium sp.
           MP5ACTX9]
 gi|321162476|gb|ADW68181.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Acidobacterium sp.
           MP5ACTX9]
          Length = 672

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 38/284 (13%), Positives = 99/284 (34%), Gaps = 14/284 (4%)

Query: 47  NGEVITDGDISKRIALLKLQKINGEL--------EKIAVQELIVETLKKQEIEKSGITFD 98
           N ++I+  D+ +    L+ +     L        +K  ++++I + L   + ++ G+  D
Sbjct: 79  NDQIISRSDVDRSEEQLEQESAQQNLSPADLASRQKDMLRDMIDQQLLLSKAKELGLNAD 138

Query: 99  SNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGN 158
           +  +        +N   S +D      +QG+    FK  +  Q +   VV+++   +   
Sbjct: 139 AEVIRRLDDIRKQNKLDSMDDLEKAARQQGVSFEDFKAQIRNQILTQQVVRDEVGRRLQT 198

Query: 159 LEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAE---ESRLRLPKD 215
            + E     +  K    +   +R     +P     +   +++    A       ++    
Sbjct: 199 TQAEQAKYYEAHKKDFEQPEQVRLSEILVPLPDTASPAEIEQAETKANGLKSELMKGGDF 258

Query: 216 CNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICD 274
               +K +        G+        L    ++     +   +T P  T++G   + + +
Sbjct: 259 AEVAKKNSGGPTAAQGGELGLFKRGALAKVIEDQTFALAPGESTQPIRTRQGFVILKVNE 318

Query: 275 KRD--LGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            ++        ++  +        ++     Y+ KLR NA +  
Sbjct: 319 HQEPGAAPMKDVEPQIQEALYMNAMQPALRAYLTKLRENAYVDI 362


>gi|90419499|ref|ZP_01227409.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336436|gb|EAS50177.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 346

 Score =  129 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 77/305 (25%), Positives = 130/305 (42%), Gaps = 5/305 (1%)

Query: 14  KLLTTYFVLIIFCIVPIVSYK-SWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +     FVL       + +   S   +S I+  +NG  IT   I +R A L+L+++ G  
Sbjct: 40  RRAALAFVLAGSAAATLPATTVSVQAASEIKAVVNGMPITSYQIRQRAAFLQLRRVGGNA 99

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            + A  ELI E LKKQEI + GI      V+  F + A    L+ E     L + G   +
Sbjct: 100 TQKATDELIDEALKKQEIGRRGIAIPDEAVDEAFGRFAAENKLTREQLGQVLSRAGFSSD 159

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            FK Y+ +Q  W   V+ +        E ++                             
Sbjct: 160 GFKDYIRVQMGWGQAVQANMRSTERLSEQDVVQRMLAQGGEKPSTTEYTLQQVIFVIPDA 219

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK 252
           Q    + +R ++AE  R R     +   +FA  + DV++     + + +L P+++  ++ 
Sbjct: 220 QRSALMAQRKREAESMRSRFQSCESTY-EFAKGLRDVTVRDLGRVAQPELPPRWKKDIQA 278

Query: 253 SQNNTTNPYV-TQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHE--AEYVKKLR 309
           +    T P   T++GVE+IA+C+ R++  + A      A+      E+ E  A Y+KKLR
Sbjct: 279 TSVGRTTPAQATERGVEFIAVCNTRNISDDKAAALVFQAREMEKLGEQAEPDAAYLKKLR 338

Query: 310 SNAII 314
             A I
Sbjct: 339 DRAQI 343


>gi|94264357|ref|ZP_01288149.1| PpiC-type peptidyl-prolyl cis-trans isomerase [delta
           proteobacterium MLMS-1]
 gi|93455251|gb|EAT05464.1| PpiC-type peptidyl-prolyl cis-trans isomerase [delta
           proteobacterium MLMS-1]
          Length = 335

 Score =  129 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 42/294 (14%), Positives = 109/294 (37%), Gaps = 19/294 (6%)

Query: 40  SRIRTTINGEVITDGDISKRIALLKLQKING-----------ELEKIAVQELIVETLKKQ 88
            R+   +NGE+IT  ++ + +A ++ Q +             E  +  +  +I   L +Q
Sbjct: 38  DRVVAEVNGEIITMSELEREMAGVEQQVLQQAPAADREQVLAEARQQVLSGMIDRLLARQ 97

Query: 89  EIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVV 148
           + ++ GI      V+    Q   +  ++ E+  + + +      ++++ L  Q +   ++
Sbjct: 98  QADRLGIRVGEREVDEAIAQILADNRITMEELEAEIARHHGSMENYRRDLQTQILQSRLL 157

Query: 149 KNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEES 208
             +   +    E  I    Q+             +L    +    +    ++  + AEE 
Sbjct: 158 SLEVRERVVIPERRIKEYYQQHHQEQTSPEEAYHILQIGFNWPPGDDEAREQARRQAEEI 217

Query: 209 RLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQ 264
             +  +  +      +++      + G      + +L     +++ +      +    T 
Sbjct: 218 HRQARQGADFRELARRYSDLPSARNDGDLGVFQKDELAGIMLEHIPELEPGEISTILETA 277

Query: 265 KGVEYIAIC----DKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
            G ++  +     + R  G    LK  +  +     +E+  +++VK+LR NA I
Sbjct: 278 AGYQFFKLLSNQGELRATGSYEELKGKIREKLYQQALEEQFSKWVKELRENAYI 331


>gi|323700040|ref|ZP_08111952.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Desulfovibrio sp.
           ND132]
 gi|323459972|gb|EGB15837.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Desulfovibrio
           desulfuricans ND132]
          Length = 633

 Score =  129 bits (322), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 49/402 (12%), Positives = 102/402 (25%), Gaps = 96/402 (23%)

Query: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI 60
           M   +  + S +I  +    ++I+F     +S  + +       T+NG+ IT  +     
Sbjct: 1   MLEVMRENASGWIVKILFAIIIIVFVFAFGMSGLN-SSGDPTVATVNGQAITRAEYEAMY 59

Query: 61  ALL------------KLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFF-- 106
                            Q  + E +++ + ELI + L   E  K GI      V      
Sbjct: 60  QRAAENLRRTNPDLPPAQTRSPEFKQMVLGELISQKLLLGEAAKLGIRASDKEVAAGIGA 119

Query: 107 --VQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN-------------- 150
                  N     + + + L    +    F++          V                 
Sbjct: 120 VDAFKDANGNFDQQRYQTALRDIRMTPGDFEENYRRDLTMEKVKDAVGVPADLSESQARQ 179

Query: 151 -------------------DFMLKYGNLEMEIPANKQKMKNITV---------------- 175
                              DF  +    E EI A  Q  ++                   
Sbjct: 180 IFDWLGETAAIDYIEVLPTDFRNEIKIGETEIEAYYQANQDRFQIPAQVTLRTLAFTPAS 239

Query: 176 ------------------------REYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
                                       +      +   +  +Q   +K     ++    
Sbjct: 240 LAKFQTVTDDEIKAYYAANKDSLEEPAQVHARHILVAVKESDSQADQEKAKARIDKLYQE 299

Query: 212 ---LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGV 267
                      +K +      + G   +  +  + P F+      ++   + P  TQ G 
Sbjct: 300 AKAGADFAELAKKNSDGPSAPNGGDLGWFGKGAMIPDFEKAAFALNKGGVSEPVRTQFGW 359

Query: 268 EYIAICDKRD--LGGEIALKAYLSAQNTPTKIEKHEAEYVKK 307
             I + DK++         K  + A+    K      + + +
Sbjct: 360 HIIMVEDKKEGTTKTFDEAKDEIKARLAEEKASDQANDLLDQ 401


>gi|253998290|ref|YP_003050353.1| SurA domain-containing protein [Methylovorus sp. SIP3-4]
 gi|253984969|gb|ACT49826.1| SurA domain protein [Methylovorus sp. SIP3-4]
          Length = 438

 Score =  129 bits (322), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 39/321 (12%), Positives = 111/321 (34%), Gaps = 16/321 (4%)

Query: 6   FTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL 65
            T  +  +  +  +   +I  +       S     RI   ++  V+T+ +++ RI ++  
Sbjct: 1   MTIKNCLMAGVFLWLGALIPHVASAAQDGSVNKIDRIVAVVDQGVVTEKELNDRIEIVSA 60

Query: 66  QKINGE--------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSA 117
           Q             LEK  ++ LI + L+ Q   ++G+  D + ++   ++ A    +  
Sbjct: 61  QLEKQGNQLPPRNVLEKQILERLINDRLQLQYAAQTGLRVDDDQLDKTIMRIAEQNKMGV 120

Query: 118 EDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVRE 177
            +F   L  +GI    F++ +  + +   + + +   +    E E+        +     
Sbjct: 121 PEFKEALAAEGIVYKKFREDIRNEILLARLREREVDNRVNVTESEVDNFLTTQSSRQDSS 180

Query: 178 YLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKL---EKFASKIHDVSIGKA 234
                    I   +  +   +++  + AE++  +L    +      + +   + +  GK 
Sbjct: 181 DEYEISHILIRAPEDGSPEDLKRLREKAEDALKKLQAGEDFGQVSARVSDAPNALEGGKL 240

Query: 235 QYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLS 289
            +   + +   F + L        +    +  G   + + D+R        +     ++ 
Sbjct: 241 GWKTAAQVPALFLEALKPMQVGQLSGILRSPNGFHILKLTDRRGGNTSTMVQQTHTRHIL 300

Query: 290 AQNTPTKIEKHEAEYVKKLRS 310
            + +    E      +  ++ 
Sbjct: 301 IKTSEVLSETEAKRKIDGIKQ 321



 Score = 99.7 bits (246), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 16/144 (11%), Positives = 53/144 (36%), Gaps = 2/144 (1%)

Query: 174 TVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGK 233
           +       T    I  +++ ++   +++I   ++            +++++     + G 
Sbjct: 288 STMVQQTHTRHILIKTSEVLSETEAKRKIDGIKQLIDNGEDFGEAAKRYSNDGSAANGGD 347

Query: 234 AQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLSAQ 291
             ++   D  PQF+  +        ++   +  G   I + ++R+       +      +
Sbjct: 348 LGWVNPGDTVPQFEKAMNALQPGQISDAVRSPFGWHLIQVLERRNQDMTREAERMKARQE 407

Query: 292 NTPTKIEKHEAEYVKKLRSNAIIH 315
               K ++   ++V++LR  A + 
Sbjct: 408 IRQRKADEAYQDWVRELRDRAYVE 431


>gi|258593267|emb|CBE69606.1| putative PpiC-type peptidyl-prolyl cis-trans isomerase [NC10
           bacterium 'Dutch sediment']
          Length = 351

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 53/317 (16%), Positives = 113/317 (35%), Gaps = 18/317 (5%)

Query: 17  TTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL---- 72
            +   +I+   V   S     +  RI   +N +VIT  D+ +       + +   L    
Sbjct: 32  ASLMTVILLLSVFAASGADAVILDRIVAVVNDDVITLTDVQEEGIQAIRRIVRETLGAER 91

Query: 73  -------EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTG-LSAEDFSSFL 124
                  E+  + ELI+  L+ QE  K  I      +     +  +  G  S E+  + L
Sbjct: 92  ERLLRSTERQILDELILRRLQLQEATKEKIETAPAEIQSAIEELKKRNGLASDEELRAAL 151

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            ++ + +  F++ +A Q +   +V      K   L+ E+    ++ ++        +   
Sbjct: 152 SREQLSEEQFRKGIADQVMLTKLVARRVRAKVVVLDEEVQQYYEQRQDQFREIPQFKIRH 211

Query: 185 FSIPDNKLQNQGF---VQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESD 241
             +        G     +KRI++A+    +  +     +++A      S G+   +   +
Sbjct: 212 LLVATPPQATPGELSRAKKRIEEAQTLLKKGTQFATVAKQYAEGPLASSSGEVWTMKHGE 271

Query: 242 LHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDK--RDLGGEIALKAYLSAQNTPTKIE 298
           L P+ +           +    T  G   I + ++          +K  L A     K E
Sbjct: 272 LAPELEQAALALPIGQPSGIITTPAGFHLIVVEERVPGQTLSFDQVKERLRALLFEQKTE 331

Query: 299 KHEAEYVKKLRSNAIIH 315
               E+++ LR+ A + 
Sbjct: 332 TKFKEWIESLRTKANVE 348


>gi|256823427|ref|YP_003147390.1| SurA domain-containing protein [Kangiella koreensis DSM 16069]
 gi|256796966|gb|ACV27622.1| SurA domain protein [Kangiella koreensis DSM 16069]
          Length = 427

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 46/310 (14%), Positives = 115/310 (37%), Gaps = 15/310 (4%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK------- 67
           +L    +    C+          +  ++   ++ +VI   ++ +++   K Q        
Sbjct: 2   ILKKALIGFTLCLAAFS--LQAEVIDKVIAHVDEDVILQSELDRKVIQAKQQIRSRGGQL 59

Query: 68  -INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDK 126
                L+K  +++LI+++L+ Q   +SG+      +  +  Q A+++G++ ++F   L +
Sbjct: 60  PPEDVLKKELLEQLIIQSLQYQMAVRSGMQLQPAELQQYAAQVAQSSGMTLDEFRLSLAQ 119

Query: 127 QGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
           QGI    F   L  + +   +       +    + EI +  Q M      EY +  +L +
Sbjct: 120 QGIAYELFLDDLRKEILTGQLRDAFVSRRIKVSDKEIESLIQSMNAQNQVEYHLGHILIA 179

Query: 187 IPDNKLQNQGFVQKRIK-DAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ 245
           + ++  +      K+      +            +  +S       G   +  ES++   
Sbjct: 180 VQEDADEETQKQAKQNALKVMKELKAGADFAETAKVVSSSPDAAEGGDFGWRTESNMPTL 239

Query: 246 FQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLG---GEIALKAYLSAQNTPTKIEKHE 301
           F N++      + + P  +  G   + I DKR       +     ++  +      E + 
Sbjct: 240 FANVVNFLDTGDISQPIRSPSGFHILKIKDKRGEQQHLVQQTNARHILIRPDAITTESNA 299

Query: 302 AEYVKKLRSN 311
            + ++ +R  
Sbjct: 300 KQQLQNIRQR 309



 Score = 78.9 bits (192), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 22/271 (8%), Positives = 65/271 (23%), Gaps = 5/271 (1%)

Query: 50  VITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQH 109
            ++D +I   I  +  Q          +  +  +  ++ + +                  
Sbjct: 150 KVSDKEIESLIQSMNAQNQVEYHLGHILIAVQEDADEETQKQAKQNALKVMKELKAGADF 209

Query: 110 ARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQK 169
           A    + +    +                   ++   +   D      +         + 
Sbjct: 210 AETAKVVSSSPDAAEGGDFGWRTESNMPTLFANVVNFLDTGDISQPIRSPSGFHILKIKD 269

Query: 170 MKNITVREYLI--RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI- 226
            +              +   PD         Q+     +          ++ +K +    
Sbjct: 270 KRGEQQHLVQQTNARHILIRPDAITTESNAKQQLQNIRQRVLAGEADFGDEAKKHSDDPG 329

Query: 227 HDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKR-DLGGEIAL 284
                G   +       P F+        N  + P+ +  G   + +  +R D   +   
Sbjct: 330 SAKLGGNLGWNNLGVYDPVFEQTLTDLDVNEISEPFQSNFGWHIVQLLGRRTDDQTDAMK 389

Query: 285 KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           +          K  +    ++++LR  A + 
Sbjct: 390 RQQAMRILQQRKFGEEVENWIRELRDEAYVK 420


>gi|62178657|ref|YP_215074.1| peptidyl-prolyl cis-trans isomerase SurA [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|75505914|sp|Q57TG8|SURA_SALCH RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|62126290|gb|AAX63993.1| peptidyl-prolyl cis-trans isomerase, survival protein [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
          Length = 428

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 42/311 (13%), Positives = 113/311 (36%), Gaps = 18/311 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +L+   ++   S+ +  +  ++   +N  V+ + D+   +  +KL              L
Sbjct: 7   LLLGIAMIANTSFAAPQVVDKVAAIVNNGVVLESDVDGLMQSVKLNAGQAGQQLPDDATL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ +  Q  +K G+      ++      A+   ++ +   S L   G+  +
Sbjct: 67  RHQILERLIMDQIILQMGQKMGVKITDEQLDQAIANIAKQNNMTMDQMRSRLAYDGLNYS 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP--ANKQKMKNITVREYLIRTVLFSIPDN 190
            ++  +  + I  +V  N+   +   L  E+   A +   +N    E  +R +L ++P+N
Sbjct: 127 TYRNQIRKEMIISEVRNNEVRRRITVLPQEVDALAKQIGTQNDASTELNLRHILIALPEN 186

Query: 191 KLQNQGFVQKRIKDAE-ESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
               Q    +R  ++  E              +++    +  G+  +    +L   F   
Sbjct: 187 PTSEQVNDAQRQAESIVEEARNGADFGKLAITYSADQQALKGGQMGWGRIQELPGIFAQA 246

Query: 250 -LKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKHEAEY 304
                + +   P  +  G   + + D R     +        ++  + +P   ++     
Sbjct: 247 LSTAKKGDIVGPIRSGVGFHILKVNDLRGQSQSISVTEVHARHILLKPSPIMNDQQARLK 306

Query: 305 VKKLRSNAIIH 315
           ++++   A I 
Sbjct: 307 LEEI--AADIK 315



 Score = 84.3 bits (206), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 43/287 (14%), Positives = 89/287 (31%), Gaps = 21/287 (7%)

Query: 47  NGEV---ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVN 103
           N EV   IT   + + +  L  Q          +  L    +   E   S    D+    
Sbjct: 143 NNEVRRRITV--LPQEVDALAKQIGTQNDASTELN-LRHILIALPENPTSEQVNDAQRQA 199

Query: 104 YFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND-----------F 152
              V+ ARN     +   ++   Q         +  IQ +     +              
Sbjct: 200 ESIVEEARNGADFGKLAITYSADQQALKGGQMGWGRIQELPGIFAQALSTAKKGDIVGPI 259

Query: 153 MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRL 212
               G   +++   + + ++I+V E   R +L         +Q    K  + A + +   
Sbjct: 260 RSGVGFHILKVNDLRGQSQSISVTEVHARHILLKPSPIMN-DQQARLKLEEIAADIKSGK 318

Query: 213 PKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYI 270
                  ++++         G   +       P F++ L K      + P  +  G   I
Sbjct: 319 TTFAAAAKEYSQDPGSANQGGDLGWATPDIFDPAFRDALTKLHKGQISAPVHSSFGWHLI 378

Query: 271 AICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            + D R +   + A K          K  +  A ++++ R++A +  
Sbjct: 379 ELLDTRKVDKTDAAQKDRAYRMLMNRKFSEEAATWMQEQRASAYVKI 425


>gi|257465500|ref|ZP_05629871.1| peptidyl-prolyl cis-trans isomerase SurA [Actinobacillus minor 202]
 gi|257451160|gb|EEV25203.1| peptidyl-prolyl cis-trans isomerase SurA [Actinobacillus minor 202]
          Length = 317

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 57/316 (18%), Positives = 105/316 (33%), Gaps = 15/316 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +K  +   +L+ F     +S    A   R+  T++G +I +  +++    L  +      
Sbjct: 1   MKFTSAKSLLVAFVATLGLSQSLLAAEERVIATVDGNMIMESQVTRA---LGKKANTEAN 57

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            K A++ +I E L ++ I++SG+  D   V+    + A   GL+       LD QGI  N
Sbjct: 58  RKAALENIIDEMLVQKAIQQSGVKVDYRRVDQAIEEIAVRNGLTYGQLLDALDYQGITLN 117

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITV---------REYLIRTV 183
            ++Q +A Q +   V              ++ A  Q +                    + 
Sbjct: 118 QYRQQIAQQMMMEAVRHQSIGKSIQVNPEDVRAQAQALMAKDKAAGKLKSVSGTEPRISH 177

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQY-LLESD 241
           +       L +     K      + +          +  +         G   +  L+  
Sbjct: 178 ILIKTTPVLNDAQAKAKLNSIIADIKAGKTTFEEAAKANSVDYVSAADGGDLGFNFLDIY 237

Query: 242 LHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKH 300
                    K  Q   T P+ +Q G   + + D R         A     Q    + E  
Sbjct: 238 DPAFANAAAKAKQGQITAPFKSQFGWHILKVTDYRQGDRTEDAYAQKAYEQLANQQAEAA 297

Query: 301 EAEYVKKLRSNAIIHY 316
             ++VK LR  A I Y
Sbjct: 298 SKDWVKALRKTANIQY 313


>gi|89075561|ref|ZP_01161966.1| putative survival protein SurA [Photobacterium sp. SKA34]
 gi|89048701|gb|EAR54273.1| putative survival protein SurA [Photobacterium sp. SKA34]
          Length = 433

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 40/314 (12%), Positives = 117/314 (37%), Gaps = 15/314 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALL--------K 64
           +K      + ++   +   S  +     ++  T+N  VI   D++  +  +        +
Sbjct: 1   MKTWKYSVLSLMMMGMSATSMAAPQELDQVVMTVNDGVILQSDVNAMLKTVHLNAAEEHQ 60

Query: 65  LQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
               N  L +  + +LI+E L+ Q+ ++ GI  D + ++      A+   +S +     L
Sbjct: 61  QLPPNNILRQQVMDKLILENLQLQQAQQLGIRIDDSQLDKAIADVAKQRNMSVDQLRQSL 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
              GI    F++ +    +  +        +   L  E+ +  ++M   T +        
Sbjct: 121 ANAGISYAMFREQMRNDMLASEARNIIVRKRVNVLPQEVESLAKQMAKQTQQNVQYNISQ 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEES---RLRLPKDCNKLEKFASKIHDVSIGKAQYLLESD 241
             I  ++  ++    K  ++AE+      +         +++     +  G+  ++ +++
Sbjct: 181 IQIRVDEDADKAARDKAKQEAEDIVAQLKKGANFSQLAYRYSKGPKALKGGEWGWMGKAE 240

Query: 242 LHPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKI 297
           +   F + ++ + +N    P+ +  G   + I D +    +        ++  + +    
Sbjct: 241 MPTVFADQIQNNGKNAIIGPFRSGVGFHILKINDVKGMPSVSVVEVKARHILIKPSMILS 300

Query: 298 EKHEAEYVKKLRSN 311
           +      ++K+R +
Sbjct: 301 DAAAKAELEKIRQS 314



 Score = 82.8 bits (202), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 26/272 (9%), Positives = 83/272 (30%), Gaps = 7/272 (2%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQEL-IVETLKKQEIEKSGITFDSNTVNYFFVQH 109
           +   ++      +  Q        I+  ++ + E   K   +K+    +          +
Sbjct: 154 VLPQEVESLAKQMAKQTQQNVQYNISQIQIRVDEDADKAARDKAKQEAEDIVAQLKKGAN 213

Query: 110 ARNTGLSAEDFSSFLD--KQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANK 167
                         L   + G         +    I  +            +   I    
Sbjct: 214 FSQLAYRYSKGPKALKGGEWGWMGKAEMPTVFADQIQNNGKNAIIGPFRSGVGFHILKIN 273

Query: 168 QKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK-DCNKLEKFASKI 226
                 +V    ++     I  + + +    +  ++   +S +   +      + ++   
Sbjct: 274 DVKGMPSVSVVEVKARHILIKPSMILSDAAAKAELEKIRQSIISGKQTFSAAAKAYSEDP 333

Query: 227 -HDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIA 283
              V+ G+  + + +   P F++ ++    +  + P+ +  G   + +  +R +   + A
Sbjct: 334 GSAVNGGQLGWQVPNMYAPAFKDKVETLPVDKISEPFKSSFGWHIVEVEGRRKVDRTDAA 393

Query: 284 LKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           +K   +      K  +    ++++LR+ A I 
Sbjct: 394 MKNRAAQIIFNRKFNEEAQTWLQELRAGAYIE 425


>gi|117617860|ref|YP_855486.1| peptidylprolyl cis-trans isomerase SurA [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117559267|gb|ABK36215.1| peptidylprolyl cis-trans isomerase SurA [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 432

 Score =  128 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 31/310 (10%), Positives = 100/310 (32%), Gaps = 15/310 (4%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--- 70
           K L +     +F  +   ++ +  +  ++   +N +V+        +  +K         
Sbjct: 3   KTLISLLTAGLFGAMSQGAFAAPELMDKVLAVVNKDVVLASQQEALVQKVKASAQESGQS 62

Query: 71  -----ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLD 125
                 L K A+  LI E+L+ Q  ++ G+      +       A +  ++ +   + L 
Sbjct: 63  LPDDATLRKQALDRLIQESLQLQLADRQGLKISDTQLEQAIQSIAADNKMTLDQLRAQLA 122

Query: 126 KQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLF 185
           ++G+    +++ +  + +  +V +N    +    E E+      +     ++        
Sbjct: 123 REGLTYAQYREEVRREILMNEVRRNQVRRRINISEQEVKQVVDILAKQGQQQQQYHVGHI 182

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDL 242
            +      +   +       E     L +  +        +S    +  G   ++   ++
Sbjct: 183 QVALPDNPSAEQLNAAKSKIERILAALKQGADFRKMAIAESSGPKALEGGDWGWMSPQEM 242

Query: 243 HPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIE 298
                + +    + +   P  +  G+  I + D +    +        ++  + +    E
Sbjct: 243 PTLMAEAVQGTKKGDIVGPLRSGAGLHIIKVFDTKGQQQVVQTEVRARHILIKPSIILSE 302

Query: 299 KHEAEYVKKL 308
           +     +  +
Sbjct: 303 EKAKGMLDGI 312



 Score = 86.3 bits (211), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 34/291 (11%), Positives = 82/291 (28%), Gaps = 25/291 (8%)

Query: 50  VITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITF------------ 97
            I   ++ +R  + +   I+ +  K  V  L  +  ++Q+     I              
Sbjct: 138 EILMNEV-RRNQVRRRINISEQEVKQVVDILAKQGQQQQQYHVGHIQVALPDNPSAEQLN 196

Query: 98  ----DSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFM 153
                   +     Q A    ++  + S     +G              +   V      
Sbjct: 197 AAKSKIERILAALKQGADFRKMAIAESSGPKALEGGDWGWMSPQEMPTLMAEAVQGTKKG 256

Query: 154 LKYGNLEM-----EIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEES 208
              G L        I     K +   V+  +    +   P   L  +           + 
Sbjct: 257 DIVGPLRSGAGLHIIKVFDTKGQQQVVQTEVRARHILIKPSIILSEEKAKGMLDGILHDI 316

Query: 209 RLRLPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKG 266
           +       +  EK++      V  G+  +   +   P+F++++ +      + P+ T  G
Sbjct: 317 KSGKASFASLAEKYSEDPGSAVQGGELGWSDPNVYVPEFRDMVNRLQPGQISEPFRTTHG 376

Query: 267 VEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
              + + ++R        +           +  +    ++ +LR  A I  
Sbjct: 377 WHIVQLEERRSQDATNKAQEQRAYQLIYNRRFTEESQAWLDELRDEAYIQI 427


>gi|30248886|ref|NP_840956.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Nitrosomonas
           europaea ATCC 19718]
 gi|81722212|sp|Q82W17|SURA_NITEU RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|30138503|emb|CAD84793.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Nitrosomonas
           europaea ATCC 19718]
          Length = 448

 Score =  128 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 51/323 (15%), Positives = 118/323 (36%), Gaps = 22/323 (6%)

Query: 11  DFIKLLTTYFVLIIFCIVPIVSYKSWAMSS-----RIRTTINGEVITDGDISKRIALLKL 65
            F K    Y V        + +  S++        RI   +N EVIT  +I++ +     
Sbjct: 11  KFRKYWLIYAVFATMLAADVFAQSSYSREDIKPIDRIVAVVNEEVITQQEINEVLQNTVQ 70

Query: 66  QKINGE--------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSA 117
           Q             LEK  ++ LI++ ++ Q  ++ G+T   N ++    +  ++  L+ 
Sbjct: 71  QLQRQNTQLPRMEILEKQLLERLILKRIQLQRAKEIGLTVSDNDLDQTLRRIIQDNHLTM 130

Query: 118 EDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVRE 177
           ++F   L ++G   N F++ +  + +   + + +   +    E EI    Q   N     
Sbjct: 131 DEFRQVLLQEGTDMNRFREEIRGEILMSRLKEQEVNSRVNVTENEIDNFLQNQANSPAGN 190

Query: 178 YLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKA 234
              R     +  ++  ++  ++ R K AE +   L +  +      +F+     +  G+ 
Sbjct: 191 EEYRIAHILVQISEQMDEAQIEARHKRAETAYESLRQGADFVRVSAEFSDAPDAMQGGEL 250

Query: 235 QYLLESDL-HPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLG-----GEIALKAYL 288
            +     L  P  + L+       T    +  G   + + ++R         E     ++
Sbjct: 251 GWRPLGQLGSPFTEMLVNMQPGEVTPVVRSPVGFHILKLLERRQQEQKVTIIEQTHAQHI 310

Query: 289 SAQNTPTKIEKHEAEYVKKLRSN 311
             + +    E+   + + +L   
Sbjct: 311 LIKVSELVSEEDAHQLINQLMER 333



 Score =  100 bits (247), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/280 (12%), Positives = 81/280 (28%), Gaps = 10/280 (3%)

Query: 46  INGEV-ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           +N  V +T+ +I   +   +     G  E      L+  + +  E +       + T   
Sbjct: 165 VNSRVNVTENEIDNFLQN-QANSPAGNEEYRIAHILVQISEQMDEAQIEARHKRAETAYE 223

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND------FMLKYGN 158
              Q A    +SAE   +    QG                  +V          +     
Sbjct: 224 SLRQGADFVRVSAEFSDAPDAMQGGELGWRPLGQLGSPFTEMLVNMQPGEVTPVVRSPVG 283

Query: 159 LEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK 218
             +     +++ +               I  ++L ++    + I    E         + 
Sbjct: 284 FHILKLLERRQQEQKVTIIEQTHAQHILIKVSELVSEEDAHQLINQLMERIHNGADFMDV 343

Query: 219 LEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKRD 277
            +  +      + G   ++   D  P+F+  +        + P  T  G   I + ++R 
Sbjct: 344 AKAHSEDASASAGGDLGWVSPGDTVPEFEQAMNALLPGQVSPPVRTPFGWHLIKVIERRS 403

Query: 278 LGGEIALKAY-LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                  +           K +    E++++LR  A + Y
Sbjct: 404 QDVSERQQREAARHTIHARKADAIVQEWLQQLRDQAYVEY 443


>gi|253988050|ref|YP_003039406.1| peptidyl-prolyl cis-trans isomerase SurA [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253779500|emb|CAQ82661.1| chaperone SurA precursor (peptidyl-prolyl cis-trans isomerase)
           [Photorhabdus asymbiotica]
          Length = 433

 Score =  128 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/304 (11%), Positives = 100/304 (32%), Gaps = 16/304 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI--------NGEL 72
           +++        ++ +     +I   +N  V+ + DI+  +  +K               L
Sbjct: 7   LILGLMFSVSTAFAAPQQMDKIAAVVNNGVVLESDINSLLQSVKRDAQHAGQQIPDEHTL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ +  Q  ++ GIT    T++      A    ++ +     +   G+  +
Sbjct: 67  RHQILERLIMDNILLQMAKQMGITIPDQTLDSTIANIAAQNHITRDQMKHRIVADGMSFD 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            ++  +  + +  +V  N+   +   L  EI    +++ N    +  +      IP  + 
Sbjct: 127 TYRNQIRKEMLIAEVRNNEVRRRVTILPQEIDTLAKQISNQNANDSELNISHILIPLPEN 186

Query: 193 QNQGFVQKRI---KDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
            +Q  ++K                        +++    +  G   +    +L   F   
Sbjct: 187 PDQTQMEKATAVVHKIMSELKNGVDFGKLAIAYSADPQALKGGNMGWSKLQELPTLFAAQ 246

Query: 250 -LKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKHEAEY 304
                +     P  +  G   + + D R     +        ++  + +P   ++     
Sbjct: 247 LQSAQKGAIVGPIRSGVGFHILKVNDIRGGNATIAVTEVHARHILLRISPVMTDEQARAK 306

Query: 305 VKKL 308
           ++++
Sbjct: 307 LQQI 310



 Score = 84.7 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 40/305 (13%), Positives = 89/305 (29%), Gaps = 18/305 (5%)

Query: 28  VPIVSYKSWAMSSRIRTTI-NGEV-----ITDGDISKRIALLKLQKINGELEKIAVQELI 81
           +   +Y++      +   + N EV     I   +I      +  Q  N     I+   LI
Sbjct: 123 MSFDTYRNQIRKEMLIAEVRNNEVRRRVTILPQEIDTLAKQISNQNANDSELNIS-HILI 181

Query: 82  V-----ETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
                 +  + ++         S   N            +        +           
Sbjct: 182 PLPENPDQTQMEKATAVVHKIMSELKNGVDFGKLAIAYSADPQALKGGNMGWSKLQELPT 241

Query: 137 YLAIQSIWPD--VVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQN 194
             A Q        +        G   +++   +     I V E   R +L  I       
Sbjct: 242 LFAAQLQSAQKGAIVGPIRSGVGFHILKVNDIRGGNATIAVTEVHARHILLRISPVMTDE 301

Query: 195 QGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL-LKK 252
           Q    K  + A + R       +  ++F+      +  G   +       P F++  ++ 
Sbjct: 302 QA-RAKLQQIAGDIRSGKTDFADAAKEFSEDPGSALRGGDLGWSTPDIFDPAFRDALMRL 360

Query: 253 SQNNTTNPYVTQKGVEYIAICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
           ++   + P  +  G   I + D R +   ++A K          K  +    ++++ R++
Sbjct: 361 NKGEISQPIHSSFGWHLIQLLDTRKVDKTDVAQKDRAYRMLFNRKFTEEAQSWMQEQRAS 420

Query: 312 AIIHY 316
           A +  
Sbjct: 421 AYVKI 425


>gi|296134602|ref|YP_003641844.1| SurA domain protein [Thiomonas intermedia K12]
 gi|295794724|gb|ADG29514.1| SurA domain protein [Thiomonas intermedia K12]
          Length = 459

 Score =  128 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 40/297 (13%), Positives = 93/297 (31%), Gaps = 21/297 (7%)

Query: 31  VSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--------ELEKIAVQELIV 82
            ++ S   S  I   +  +VITD D+  R+   + Q            +L    + ++I 
Sbjct: 45  STFSSARTSDGIAAIVGNQVITDYDLQLRVEATRQQAQAAGATLPSAAQLRSQVLNQMID 104

Query: 83  ETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQS 142
           E    Q  E+ G+  + +T++    Q A N  L+  +  S ++K+G+G + ++  L  + 
Sbjct: 105 EVALAQYAEQIGMGVNQDTLDRAIAQVASNNKLTVPELRSAIEKEGMGWSTYRDQLKREI 164

Query: 143 IWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTV----LFSIPDNKLQNQGFV 198
           +   + +          E EI     K             +    L    +        V
Sbjct: 165 LISRLRERSMAQLPTVSESEIDEFLSKQDAAAASPQAAYDIAQIFLPVAQNATEAQVAAV 224

Query: 199 QKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNT 257
           +++I   +              + +        G       + L   F   +        
Sbjct: 225 KQKIDAIDAKLKAGADFAQLATQDSQGEGAKRGGDLGMRPANRLPTLFVDTVRNLQPGQI 284

Query: 258 TNPYVTQKGVEYIAICDK--RDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNA 312
           +    +  G   + +            A+++ +         +       +++R+ A
Sbjct: 285 SPVIRSAAGFHILKLLQVSGETAAPTTAMQSEVREIVLSASTDA------QRIRAKA 335



 Score = 60.5 bits (144), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 20/129 (15%), Positives = 41/129 (31%), Gaps = 3/129 (2%)

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQF-QN 248
             Q      +    A+  +    +   K  + +         G   ++L   L P     
Sbjct: 327 DAQRIRAKAELDSIAQAVQNGKVQFSEKARELSQDPATAAKGGALGWVLPGQLDPVLDAA 386

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL-SAQNTPTKIEKHEAEYVKK 307
           L + +  + + P V    V  + + D+     E + K  L        K  +   E V+ 
Sbjct: 387 LQRLNPGDVSAPIVMGNKVVLLQLVDRAVRPLEASQKRALAREVLQRQKAAEDFDELVRD 446

Query: 308 LRSNAIIHY 316
           +R+   +H 
Sbjct: 447 VRARTYVHI 455


>gi|254491890|ref|ZP_05105069.1| SurA N-terminal domain family [Methylophaga thiooxidans DMS010]
 gi|224463368|gb|EEF79638.1| SurA N-terminal domain family [Methylophaga thiooxydans DMS010]
          Length = 421

 Score =  128 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/318 (12%), Positives = 111/318 (34%), Gaps = 20/318 (6%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE---- 71
           +  Y +  +     +++        RI   +N EVI + ++ +    ++ Q    +    
Sbjct: 1   MIKYLMAALLLTTNVLA----QPLDRITAVVNDEVILESELMEMQQTVRQQLRQRDAAIP 56

Query: 72  ----LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
               L K  ++ LI++ L+ Q  E+ G+    + +N    Q A N  ++   F   L+  
Sbjct: 57  PSEVLNKQVLERLIMQRLQLQRAEQVGVRVGDDALNAALKQIANNNNMNLRQFRDVLEDD 116

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI 187
           G   ++F+  +  + I   + K+    +    E E+             E   +     +
Sbjct: 117 GYNFSNFRNTIREEMIITRLRKSQVEDRVVVSEREVDNFLTTQTIQEGGEVEYQLQHILV 176

Query: 188 PDNKLQNQGFV---QKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
              +  +   V   +++++  +       +       ++   + +  G+  +    +L  
Sbjct: 177 SMPEAASPEQVQEAEQQLQKVQALLDEGGEFSEVAAGYSDGQNALEGGELGWRKHGELPS 236

Query: 245 QF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLG---GEIALKAYLSAQNTPTKIEKH 300
            F + +        +    +  G   + + DK+       +  L +++  +       + 
Sbjct: 237 LFAEVVPDLEVGEVSQALRSGSGFHLVRVKDKKSQELHLVKQTLASHILIRANELTSAEQ 296

Query: 301 EAEYVKKLRSN-AIIHYY 317
             E +++LR   A    +
Sbjct: 297 AEERLQQLRQRIAKGENF 314



 Score = 91.3 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 17/137 (12%), Positives = 50/137 (36%), Gaps = 3/137 (2%)

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLESD 241
               I  N+L +    ++R++   +   +           +      +  G   +     
Sbjct: 282 SHILIRANELTSAEQAEERLQQLRQRIAKGENFAELARAHSDDTGSAIDGGSLGWTSPGV 341

Query: 242 LHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTKIEK 299
           + P+F+  +   +    ++ + ++ G   I + D+R+    +   +     Q    KI++
Sbjct: 342 MVPEFEEKMNALAIGEMSDVFESRFGWHLIKVYDRREQNMADEFKRNKAREQIRQRKIDE 401

Query: 300 HEAEYVKKLRSNAIIHY 316
               +++ +R  A + Y
Sbjct: 402 ELESWLRAMRDEAYVEY 418


>gi|149907522|ref|ZP_01896269.1| survival protein surA [Moritella sp. PE36]
 gi|149809192|gb|EDM69121.1| survival protein surA [Moritella sp. PE36]
          Length = 428

 Score =  128 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/314 (10%), Positives = 104/314 (33%), Gaps = 19/314 (6%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDIS--------KRIALLKLQK 67
           +    +  +  +    +         +   +N EVI   D++        +     +   
Sbjct: 1   MLKTLLSGVIVVTSWQAQAELTKLDEVIAIVNEEVILASDVNTLTRSVTARATKAGQTLP 60

Query: 68  INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
               L + A+ +LI+++L+ Q  +K G+   +  +       A+    + E     +   
Sbjct: 61  SQEVLTQQALDKLIIDSLQLQMAKKMGMRISNAQLEDTLNNIAKGDNQTVEQLRQSVVAD 120

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI 187
           G   N +K+ +  Q +  +V +     +    + ++      +     +    R     +
Sbjct: 121 GGDFNDYKEEIRTQILTNEVQRMQMRRRITISDQDVDNLIAIIDEQGQKNRQYRVNHIML 180

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPK---DCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
                 +   ++       + + +L       N     ++    +  G   ++  +++  
Sbjct: 181 RVPNEADNATMEALQTKIADIQTQLNAGEPFANLALALSAGPKALDGGDWGWMNINEMPT 240

Query: 245 QF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLG---GEIALKAYLSAQ----NTPTK 296
            F + +    + +   P  +  G+  I + D R +     +     ++  +     +  K
Sbjct: 241 LFAEAVTNAKKGDIIGPIRSGAGLHIIQVSDMRGVETVLTKEVNARHILIKPSVILSDDK 300

Query: 297 IEKHEAEYVKKLRS 310
            +    EY+ +++S
Sbjct: 301 AQSLLNEYLTRIKS 314



 Score = 75.9 bits (184), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 25/275 (9%), Positives = 71/275 (25%), Gaps = 11/275 (4%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGI-TFDSNTVNYFFVQH 109
           I+D D+   IA++  Q       +  V  +++    + +             +       
Sbjct: 151 ISDQDVDNLIAIIDEQGQKN--RQYRVNHIMLRVPNEADNATMEALQTKIADIQTQLNAG 208

Query: 110 ARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEM-----EIP 164
                L+    +      G                  V         G +        I 
Sbjct: 209 EPFANLALALSAGPKALDGGDWGWMNINEMPTLFAEAVTNAKKGDIIGPIRSGAGLHIIQ 268

Query: 165 ANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFAS 224
            +  +     + + +    +   P   L +        +     +    +     + ++ 
Sbjct: 269 VSDMRGVETVLTKEVNARHILIKPSVILSDDKAQSLLNEYLTRIKSGDAEFAELAKAYSD 328

Query: 225 KI-HDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKR-DLGGE 281
                V  G+  +   +   P F+       +   +  + +  G   + + D+R     +
Sbjct: 329 DTGSAVKGGELGWADPNIYVPAFKLALQDLKKGEISPTFRSSHGWHIVQLIDRRTQDTTD 388

Query: 282 IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            A +          +  +    ++ +L+  A I  
Sbjct: 389 KANRQKAWQLLYNRRAAEESQSWLNELKQEAYIRI 423


>gi|322420756|ref|YP_004199979.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter sp. M18]
 gi|320127143|gb|ADW14703.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter sp. M18]
          Length = 323

 Score =  128 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 50/324 (15%), Positives = 110/324 (33%), Gaps = 20/324 (6%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK- 67
           +S   KL+      +  C +P  S K    +      +NG VIT  ++ + +  L  Q  
Sbjct: 1   MSALKKLIPVTVAALALCALPGCSDKGQTGAP--VVKVNGSVITKPELDRAVKALLAQNK 58

Query: 68  -----INGELEKI---AVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAED 119
                   +++K    A+++L    L  QE +K  I  D         Q  R +  + E+
Sbjct: 59  VTQALPPEQMKKAADSALEQLTSAELLYQEGKKLEI-KDLEQQVEQKYQKNRTSFPTKEE 117

Query: 120 FSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNI-TVREY 178
           +   L   G+ +   ++ +  + +  + V   F  K    + E        K     +  
Sbjct: 118 YEKALKATGMTEAEVREMMRKEIVVNNFVDKQFSSKATCSDAEARKFYDDNKAKLFEKGE 177

Query: 179 LIRTVLFSIPDNKLQNQGFVQKRIKDAEESR---LRLPKDCNKLEKFASKIHDVSIGKAQ 235
            +R     +  ++       +K  + AE       +        +  ++     + G+  
Sbjct: 178 RLRARHILVSVDQKGGPEEKKKAREKAEALLKRVQKGEDFAAVAKVESTCPSRANGGELG 237

Query: 236 YLLESDLHPQFQNLLKKS--QNNTTNPYVTQKGVEYIAICDKRDLGGE--IALKAYLSAQ 291
              +  + P F+        +   +    T+ G   I + ++     +    +K  ++  
Sbjct: 238 VFGKGQMTPPFEKAAFALKGKGELSKVVETEFGYHIIKLEERIAPSNDRFEDVKFQIAQY 297

Query: 292 NTPTKIEKHEAEYVKKLRSNAIIH 315
               +  K  A ++ +LR  A I 
Sbjct: 298 LKKEQTRKAVAAFLAELRHKAKIE 321


>gi|145638627|ref|ZP_01794236.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittII]
 gi|145272222|gb|EDK12130.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittII]
          Length = 311

 Score =  128 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 51/321 (15%), Positives = 113/321 (35%), Gaps = 24/321 (7%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI 68
           +  F+  L ++ +  + C+  +          R+  T++G  + +  +       +    
Sbjct: 1   MKKFV--LRSFLLAALGCVAFV---SMAQAEERVVATVDGIPVLESQV-------RANMG 48

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
                + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QG
Sbjct: 49  KKGDRQSAIDKIIDDILVQKAVQESGVKIDPREIDHVVEDTAARNGLTYGQFLDALDYQG 108

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEI---------PANKQKMKNITVREYL 179
           I  N F+Q +A Q +   V              E+          A ++        +  
Sbjct: 109 ISLNAFRQQIANQMMMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVTGKEY 168

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQY-L 237
               +    +  L +    ++  K   +         +   K++       + G   Y  
Sbjct: 169 EVRHILLKLNPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAF 228

Query: 238 LESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTK 296
            E+      Q ++K  Q   + P+ T+ G   + +   RD              +   T+
Sbjct: 229 PETYAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGTRDGDLTSEAYTQKAYERLVNTQ 288

Query: 297 IEKHEAEYVKKLRSNAIIHYY 317
           ++    ++VK LR  A I Y+
Sbjct: 289 LQDATNDWVKALRKRANIQYF 309


>gi|148827655|ref|YP_001292408.1| thymidylate kinase [Haemophilus influenzae PittGG]
 gi|148718897|gb|ABR00025.1| thymidylate kinase [Haemophilus influenzae PittGG]
          Length = 311

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 57/316 (18%), Positives = 115/316 (36%), Gaps = 20/316 (6%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMS-SRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +        +   +  V++ S A +  R+  T++G  I +  +       +         
Sbjct: 1   MKKFVLRSFLLATLGCVAFTSMAQAAERVVATVDGIPILESQV-------RANMGKKGDR 53

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 54  QSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNT 113

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEI----------PANKQKMKNITVREYLIRTV 183
           F+Q +A Q +   V         G    E+             K   + +  +EY +R +
Sbjct: 114 FRQQIANQMVMGAVRNKAIQESIGVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 173

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQY-LLESDL 242
           L  +       Q   Q     ++    +       L+     +   + G   Y   E+  
Sbjct: 174 LLKLNPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPETYA 233

Query: 243 HPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKHE 301
               Q ++K  Q   + P+ T+ G   + +   RD              +   T+++   
Sbjct: 234 PQFAQIVVKSKQGVISAPFKTEFGWHILEVTGVRDGDLTAEAYTQKAYERLVNTQLQDAT 293

Query: 302 AEYVKKLRSNAIIHYY 317
            ++VK LR  A I Y+
Sbjct: 294 KDWVKALRKRANIQYF 309


>gi|197118895|ref|YP_002139322.1| PpiC-type peptidylprolyl cis-trans isomerase [Geobacter
           bemidjiensis Bem]
 gi|197088255|gb|ACH39526.1| peptidylprolyl cis-trans isomerase, PpiC-type [Geobacter
           bemidjiensis Bem]
          Length = 351

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/298 (14%), Positives = 95/298 (31%), Gaps = 17/298 (5%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI---------NGELEKIAVQELIVET 84
            + A  S     +NG  IT  D+ + + ++  Q             + E  A+++L    
Sbjct: 51  PAAAQKSPAVVRVNGTPITKLDVERAVKVMLAQNKVDQPIPPELQKQAESAALEQLTSAE 110

Query: 85  LKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIW 144
           L  QE  KS I      +     Q+ +     AE   +    +       +++   + + 
Sbjct: 111 LLYQEASKSKIPDLDKMIEQKVSQNRQKFKTEAELVEALSALEMTLP-DLEEFTRKEIVL 169

Query: 145 PDVVKNDFMLKYGNLEMEIPANKQKMKNI-TVREYLIRTVLFSIPDNKLQNQGFVQKRIK 203
              +   F  K    + E+        N    +   ++     +  ++       +K  +
Sbjct: 170 STYIAEHFQNKASVSDEEVKKFYDDNLNQYFKKPESVKASHILVGTDEKSTPEDKKKAKE 229

Query: 204 DAEESRLRLPKDCNKLEK---FASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTN 259
            AE    RL    +        ++       G         + P+F+    K      + 
Sbjct: 230 KAEALLKRLQAGEDFAAVAKGESTCPSASEGGDLGEFGRGQMVPEFEEAAFKLKPGEMSG 289

Query: 260 PYVTQKGVEYIAICDKRDLGGE--IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
              T+ G   I +  K++   E    +K  +       K ++  + ++ +L+  A I 
Sbjct: 290 VVETKFGYHIIKVTGKQEAAAEKLENVKETIVEFLKKQKEQQELSNFIDELKKKAKIE 347


>gi|319940878|ref|ZP_08015217.1| hypothetical protein HMPREF9464_00436 [Sutterella wadsworthensis
           3_1_45B]
 gi|319805760|gb|EFW02541.1| hypothetical protein HMPREF9464_00436 [Sutterella wadsworthensis
           3_1_45B]
          Length = 460

 Score =  127 bits (319), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 49/298 (16%), Positives = 98/298 (32%), Gaps = 18/298 (6%)

Query: 32  SYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVE 83
           +  +     RI   +N ++IT+ ++ +R+  + +              L    ++ LI E
Sbjct: 40  APAASGELDRIVAVVNNDIITEHELEQRVHTVAINLRRQNIQLPAMELLRAQVLERLISE 99

Query: 84  TLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSI 143
               Q   ++GI  D   VN    Q AR   LS E+    L   G+    F+  +  +  
Sbjct: 100 RAILQRARQTGIRVDDQMVNASVEQIARQNNLSIEELRQRLAADGVNFASFRNEIRDEIT 159

Query: 144 WPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIK 203
              + + +   K    E EI A   +   I   + +   V   +   +   +    K   
Sbjct: 160 TQRLREREVNEKIDISESEIDAYLAEQAGIKGDDKMEYHVEHILLPVETPAENDSVKTAA 219

Query: 204 DAEESRLR-LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPY 261
           ++   R R      +    F+     +  G   +   +DL   F + L   S   +    
Sbjct: 220 ESLAKRARDGENFSSLAASFSRADDAMKGGDLGWRSLNDLPATFAEALRANSTPGSVYVV 279

Query: 262 VTQKGVEYIAICDKRD--------LGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
            +Q+      + DKRD           E     ++    +    E      +  +++ 
Sbjct: 280 SSQRAWHVFKLEDKRDGVQAKLGGGPVEQTHARHILMFVSDITPEGDVIRRLNDIKNR 337



 Score = 94.7 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/282 (10%), Positives = 79/282 (28%), Gaps = 11/282 (3%)

Query: 46  INGEV-ITDGDISKRIALLKLQKINGELEKIAVQELI-------VETLKKQEIEKSGITF 97
           +N ++ I++ +I   +A     K + ++E      L+        +++K      +    
Sbjct: 168 VNEKIDISESEIDAYLAEQAGIKGDDKMEYHVEHILLPVETPAENDSVKTAAESLAKRAR 227

Query: 98  DSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYG 157
           D    +      +R           +     +     +   A  +     V +     + 
Sbjct: 228 DGENFSSLAASFSRADDAMKGGDLGWRSLNDLPATFAEALRANSTPGSVYVVSSQRAWHV 287

Query: 158 NLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCN 217
               +     Q        E      +     +       +++        +        
Sbjct: 288 FKLEDKRDGVQAKLGGGPVEQTHARHILMFVSDITPEGDVIRRLNDIKNRVQSGEADFAT 347

Query: 218 KLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKR 276
                +        G   +L   D  P+F+ ++ K      ++P  T  G   I + ++R
Sbjct: 348 MARLHSVDSTATRGGDLGWLQPGDTVPEFEGVMNKLKPGQISDPIRTPYGYHLIQVVERR 407

Query: 277 DLGGEIALKAYL--SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                   +  +         K+ +   E+ ++LR  A +  
Sbjct: 408 TEKDGNPERMRVAARQAIRQKKLAEASYEWERELRDQAFVEI 449


>gi|294338549|emb|CAZ86878.1| putative PpiC-type peptidyl-prolyl cis-trans isomerase, surA
           [Thiomonas sp. 3As]
          Length = 472

 Score =  127 bits (319), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/297 (13%), Positives = 93/297 (31%), Gaps = 21/297 (7%)

Query: 31  VSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--------ELEKIAVQELIV 82
            ++ S   S  I   +  +VITD D+  R+   + Q            +L    + ++I 
Sbjct: 58  STFSSARTSDGIAAIVGNQVITDYDLQLRVEATRQQAQAAGATLPSAAQLRSQVLNQMID 117

Query: 83  ETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQS 142
           E    Q  E+ G+  + +T++    Q A N  L+  +  S ++K+G+G + ++  L  + 
Sbjct: 118 EVALAQYAEQIGMGVNQDTLDRAIAQVASNNKLTVPELRSAIEKEGMGWSTYRDQLKREI 177

Query: 143 IWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTV----LFSIPDNKLQNQGFV 198
           +   + +          E EI     K             +    L    +        V
Sbjct: 178 LISRLRERSMAQLPTVSESEIDEFLSKQDAAAASPQAAYDIAQIFLPVAQNATEAQVAAV 237

Query: 199 QKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNT 257
           +++I   +              + +        G       + L   F   +        
Sbjct: 238 KQKIDAIDAKLKAGAAFAQLATQDSQGEGAKRGGDLGMRPANRLPTLFVDTVRNLQPGQI 297

Query: 258 TNPYVTQKGVEYIAICDK--RDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNA 312
           +    +  G   + +            A+++ +         +       +++R+ A
Sbjct: 298 SPVIRSAAGFHILKLLQVSGETAAPTTAMQSEVREIVLSASTDA------QRIRAKA 348



 Score = 60.5 bits (144), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 20/129 (15%), Positives = 41/129 (31%), Gaps = 3/129 (2%)

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQF-QN 248
             Q      +    A+  +    +   K  + +         G   ++L   L P     
Sbjct: 340 DAQRIRAKAELDSIAQAVQNGKVQFSEKARELSQDPATAAKGGALGWVLPGQLDPVLDAA 399

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL-SAQNTPTKIEKHEAEYVKK 307
           L + +  + + P V    V  + + D+     E + K  L        K  +   E V+ 
Sbjct: 400 LQRLNPGDVSAPIVMGNKVVLLQLVDRAVRPLEASQKRALAREVLQRQKAAEDFDELVRD 459

Query: 308 LRSNAIIHY 316
           +R+   +H 
Sbjct: 460 VRARTYVHI 468


>gi|114569774|ref|YP_756454.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Maricaulis maris
           MCS10]
 gi|114340236|gb|ABI65516.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Maricaulis maris
           MCS10]
          Length = 435

 Score =  127 bits (319), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 38/293 (12%), Positives = 95/293 (32%), Gaps = 19/293 (6%)

Query: 6   FTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMS-SRIRTTINGEVITDGDISKRIALLK 64
            T++   +       + ++  + P+ +  + A +   +   +N E IT  D+  R+ L+ 
Sbjct: 7   RTNMRLLMTCAKRIVLSLLAFVAPMCATNAHAQTTEGVAALVNDEPITTVDVRNRMRLII 66

Query: 65  LQKINGELEK--------IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLS 116
                 ++++         A++ L+ E L+ Q   +  I      +    +  A     +
Sbjct: 67  ASTGMSQIDEGTLSRIQDQAMRGLVDEHLQLQAASEYDIEVSDAEITNSLLDLADRNNTT 126

Query: 117 AEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVR 176
            +     L   G+  +  +  L  +  W  +V   +  +    E +I    +++     +
Sbjct: 127 IDVIIQDLQSSGVDVSTLRHQLEAEIAWQIIVNGRYGSRIRISEQQIELALERLAASASQ 186

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQY 236
               R             +    +R+        +         +F+      + G   +
Sbjct: 187 -PQFRIFEMLFEVPGPGQEEQTIQRVITVMNQLQQGATFPELARQFSDAPSAANGGDIGW 245

Query: 237 LLESDLHPQFQNLLKKSQNN---------TTNPYVTQKGVEYIAICDKRDLGG 280
           +  S L P+   ++ + +            +NP     G   IA+   RD   
Sbjct: 246 ITASQLQPEVAAIMPQMRGQYDQSGGRGALSNPIEVPGGFMVIALVGARDGTT 298


>gi|229846544|ref|ZP_04466652.1| stationary-phase survival protein SurA [Haemophilus influenzae
           7P49H1]
 gi|229810637|gb|EEP46355.1| stationary-phase survival protein SurA [Haemophilus influenzae
           7P49H1]
          Length = 311

 Score =  127 bits (319), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 55/316 (17%), Positives = 113/316 (35%), Gaps = 20/316 (6%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAM-SSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +        +   +  V++ S A    R+  T++G  + +  +       +         
Sbjct: 1   MKKFILKSFLLATLGCVAFASMAQAEERVVATVDGIPVLESQV-------RANMGKKGDR 53

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 54  QSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNT 113

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEI----------PANKQKMKNITVREYLIRTV 183
           F+Q +A Q +   V              E+             K   + +  +EY +R +
Sbjct: 114 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 173

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQY-LLESDL 242
           L  +       Q   Q     ++    +       L+     +   + G   Y   E+  
Sbjct: 174 LLKLNPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPETYA 233

Query: 243 HPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKHE 301
               Q ++K  Q   + P+ T+ G   + +   RD              +   T+++   
Sbjct: 234 PQFAQTVVKSKQGVVSAPFKTEFGWHILEVTGVRDGDLTAEAYTQKAYERLVNTQLQDAT 293

Query: 302 AEYVKKLRSNAIIHYY 317
            ++VK LR  A I Y+
Sbjct: 294 NDWVKALRKRANIQYF 309


>gi|220919568|ref|YP_002494872.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|219957422|gb|ACL67806.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 317

 Score =  127 bits (319), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 37/310 (11%), Positives = 88/310 (28%), Gaps = 19/310 (6%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL------QKIN 69
           +     L   C     +      +      +NGE I    +++ +   +       Q   
Sbjct: 8   ILIATALAAGCGRCGGARSGERPAPGAVAVVNGEPIAPDAVARELRDAQAGAEGQGQATG 67

Query: 70  GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
             L +  + +L+   L  Q+     I    + V   F++           F   L ++ +
Sbjct: 68  DVLRRRVLDDLVDRALLLQQARARSIVVGQDQVERAFLRLRAE--YPGTHFDDLLAQERL 125

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPD 189
                K  L  Q     + + +   +   ++ E+     +          +  +   +  
Sbjct: 126 SQAELKARLKDQLTVERLFEQEVFPQVQVVDAEVERYYAEHGAEFQEPERVHVLQIVV-- 183

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESD-LHPQFQN 248
                    ++  +  E+ R           + +      S G    +         F  
Sbjct: 184 ------ASREEAAQVREKLRRNPQTFAEVARRSSIAPEGKSGGDLGLIGRGAGFPEVFDT 237

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLG--GEIALKAYLSAQNTPTKIEKHEAEYVK 306
                 N  ++   +  G     + +K+          +A ++ +    K    +AEY++
Sbjct: 238 CFSLPVNVISDVTPSPYGFHLFKVVEKKPAQRRTLEQARAEIAEKLGREKRAGAQAEYLE 297

Query: 307 KLRSNAIIHY 316
            LR  A I  
Sbjct: 298 ALRKRAQIDI 307


>gi|330818272|ref|YP_004361977.1| Parvulin-like peptidyl-prolyl isomerase [Burkholderia gladioli
           BSR3]
 gi|327370665|gb|AEA62021.1| Parvulin-like peptidyl-prolyl isomerase [Burkholderia gladioli
           BSR3]
          Length = 451

 Score =  127 bits (319), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 42/338 (12%), Positives = 112/338 (33%), Gaps = 30/338 (8%)

Query: 6   FTSLSDFIKLLTTYFVLIIFCIVP-----IVSYKSWAMSSRIRTTINGEVITDGDISKRI 60
                 F  +++    ++    V       +      ++  +   +N  VIT  ++ +R+
Sbjct: 1   MKKSLRFAAIVSGLAAVMSLLSVTPAAAQALGSSGATLADEVVAVVNNGVITARELDQRV 60

Query: 61  ALLKLQKING--------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
            L+  +            EL    + +++VE ++ Q+ +  GI     TV     + A  
Sbjct: 61  GLISRRLQQQKVPVPPPDELRSQVLNQMVVERIQLQKAKDDGIEVSDATVQSTLQRLAAA 120

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN 172
            G++ + + + L+  G+  + F      + I   + + +   K    + E+ +     + 
Sbjct: 121 NGMTVDQYRAQLEALGVPWSTFSGDARNELILSRLREKEVDSKITVTDAEVASYIASQRG 180

Query: 173 I---TVREYLIRTVLFSIPDNKLQNQGFVQKRIKDA--EESRLRLPKDCNKLEKFASKIH 227
               + ++  +  +  + P N  Q+Q  + ++  D   +++              +    
Sbjct: 181 PNSGSQQDVRLEHIFVAAPQNAPQDQIDIAQKKADGLLKQALASGADFEKLARNSSEAKD 240

Query: 228 DVSIGKAQYLLESDLH-PQFQNLLKKSQNNTTN-PYVTQKGVEYIAICDKRDLGGE---- 281
             + G   +     L     Q + +      +        G E + + D+R   G     
Sbjct: 241 AKTGGDLGFKAPGSLPADVVQAVSQLRPGQVSPNLIRVPDGFEIVRLVDRRPASGTVGAS 300

Query: 282 ----IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
                    ++  +    K E    + +  +R+   I 
Sbjct: 301 PKIVQTHVRHILLRVGEGKSESQARQQLIDIRNQ--IE 336



 Score =  106 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 17/145 (11%), Positives = 53/145 (36%), Gaps = 2/145 (1%)

Query: 174 TVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGK 233
           + +          +   + +++   ++++ D            N    ++        G 
Sbjct: 300 SPKIVQTHVRHILLRVGEGKSESQARQQLIDIRNQIEAGGDFANFARTYSQDGSASQGGD 359

Query: 234 AQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL-SAQ 291
             ++   +  P+F+  + +      + P  T+ G   I +  +RD  G +  +  +    
Sbjct: 360 LGWISPGETVPEFERAMSQLQDGQISQPVRTEYGYHLIQVLGRRDAEGSVQKQMDIARQA 419

Query: 292 NTPTKIEKHEAEYVKKLRSNAIIHY 316
               K E+  A+++++LR ++ +  
Sbjct: 420 IGQRKAEQAYADWLRELRDSSYVQI 444


>gi|197124850|ref|YP_002136801.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Anaeromyxobacter sp.
           K]
 gi|196174699|gb|ACG75672.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Anaeromyxobacter sp.
           K]
          Length = 317

 Score =  127 bits (319), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 37/310 (11%), Positives = 88/310 (28%), Gaps = 19/310 (6%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL------QKIN 69
           +     L   C     +      +      +NGE I    +++ +   +       Q   
Sbjct: 8   ILIATALAAGCGRCGAARSGERPAPGAVAVVNGEPIAPDAVARELRDAQAGAEGQGQATG 67

Query: 70  GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
             L +  + +L+   L  Q+     I    + V   F++           F   L ++ +
Sbjct: 68  DVLRRRVLDDLVDRALLLQQARARSIVVGQDQVERAFLRLRAE--YPGTHFDDLLAQERL 125

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPD 189
                K  L  Q     + + +   +   ++ E+     +          +  +   +  
Sbjct: 126 SQAELKARLKDQLTVERLFEQEVFPQVQVVDAEVERYYAEHGAEFQEPERVHVLQIVV-- 183

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESD-LHPQFQN 248
                    ++  +  E+ R           + +      S G    +         F  
Sbjct: 184 ------ASREEATQVREKLRRNPQTFAEVARRSSIAPEGKSGGDLGLIGRGAGFPEVFDT 237

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLG--GEIALKAYLSAQNTPTKIEKHEAEYVK 306
                 N  ++   +  G     + +K+          +A ++ +    K    +AEY++
Sbjct: 238 CFSLPVNVISDVTPSPYGFHLFKVVEKKPAQRRTLEQARAEIAEKLGREKRAGAQAEYLE 297

Query: 307 KLRSNAIIHY 316
            LR  A I  
Sbjct: 298 ALRKRAQIDI 307


>gi|308051066|ref|YP_003914632.1| peptidylprolyl isomerase [Ferrimonas balearica DSM 9799]
 gi|307633256|gb|ADN77558.1| Peptidylprolyl isomerase [Ferrimonas balearica DSM 9799]
          Length = 428

 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/305 (11%), Positives = 95/305 (31%), Gaps = 14/305 (4%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK--------LQ 66
           +L    +  +  ++   +         +   +N  VI   +I +R+  +K          
Sbjct: 2   ILRQLLMGAMAALMFGQALAQPQPLDEVAVLVNDGVILKSEIDERMTSVKRGALQAGQQL 61

Query: 67  KINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDK 126
             +  L    +  LI E+L+ Q  E+ G+      ++      AR  G++ +     ++ 
Sbjct: 62  PSDAALRTQVIDRLIAESLQLQMAERMGLVISDIQLDQTLENMAREQGMTLQGLRQEIES 121

Query: 127 QGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
            G     +++ +  +     V +     +      EI    + +    +++         
Sbjct: 122 DGTNYAAYREQIRREITIGQVQRIQVQRRVQISPQEINTLVEMINEQGLQDAEFHVGHIL 181

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           I     +     + R     E               +S    +  G   ++  +++   F
Sbjct: 182 IDFGGDET--AARARADKVLELLEGGADFAQTALAASSGPKALEGGDWGFMNINEMPTLF 239

Query: 247 -QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK---AYLSAQNTPTKIEKHEA 302
            + +    + +   P  +  G   I I D R    +   +    ++  + +P   E    
Sbjct: 240 AEVVKDAKKGDIIGPIKSGAGFHIITIYDTRGQEVQEVAEVNARHILLKPSPILSEDMAK 299

Query: 303 EYVKK 307
             + +
Sbjct: 300 TLLDE 304



 Score = 82.8 bits (202), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 30/286 (10%), Positives = 71/286 (24%), Gaps = 22/286 (7%)

Query: 50  VITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDS---------- 99
            IT G + +     ++Q    E+  +   E+I E   +      G               
Sbjct: 136 EITIGQVQRIQVQRRVQISPQEINTLV--EMINEQGLQDAEFHVGHILIDFGGDETAARA 193

Query: 100 --NTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYG 157
             + V       A     +    S     +G                  V         G
Sbjct: 194 RADKVLELLEGGADFAQTALAASSGPKALEGGDWGFMNINEMPTLFAEVVKDAKKGDIIG 253

Query: 158 NLEM-----EIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRL 212
            ++       I     + + +     +    +   P   L          +   + +   
Sbjct: 254 PIKSGAGFHIITIYDTRGQEVQEVAEVNARHILLKPSPILSEDMAKTLLDEFMADVKDGK 313

Query: 213 PKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYI 270
                   + +         G   +   +   P F++   +      + P+ +  G   +
Sbjct: 314 ADFGELAREHSDDPGSAARGGDLGWADPNMYVPAFRDTLARLKVGEYSEPFRSSHGWHVV 373

Query: 271 AICDKRDLGG-EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            + D+R     + A            K  +    + +++R+ A I 
Sbjct: 374 QLLDRRVTDATDQANSDRAYQLLFRRKFGEQVNAWQEEMRAAAYIE 419


>gi|253700324|ref|YP_003021513.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter sp. M21]
 gi|251775174|gb|ACT17755.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter sp. M21]
          Length = 355

 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 43/298 (14%), Positives = 96/298 (32%), Gaps = 17/298 (5%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI---------NGELEKIAVQELIVET 84
            + A  S     +NG  IT  D+ + + ++  Q             + E  A+++L    
Sbjct: 55  PAAAQKSPAVVRVNGTPITQLDVERAVKVMLAQNKIDQPLPPELQKQAESAALEQLTAAE 114

Query: 85  LKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIW 144
           L  QE  KS I      +     Q+ +     AE   +    +       +++   + + 
Sbjct: 115 LLYQEASKSKIPDLDKMIEQKVSQNRQKFKTEAELVEALSALEMTLP-DLEEFTRKEIVL 173

Query: 145 PDVVKNDFMLKYGNLEMEIPANKQKM-KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIK 203
              +   F  K    + E+             +   ++     +  ++       +K  +
Sbjct: 174 STYIAEHFQTKASVSDEEVKKFYDDNLNTYFKKPESVKASHILVGTDEKATPEDRKKAKE 233

Query: 204 DAEESRLR---LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTN 259
            AE    R     +     +  ++       G        ++ PQF+    K      + 
Sbjct: 234 KAEALLKRLQAGEEFAALAKDESTCPSATQGGNLGEFGREEMVPQFEEAAFKLKPGEMSG 293

Query: 260 PYVTQKGVEYIAICDKRDLGGE--IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
              T+ G   I +  K++   E   ++K  +       K ++  + ++ KL+  A I 
Sbjct: 294 VVETKFGYHIIKVTGKQEAAAEKLESVKETIVEFLKKQKAQQELSSFIDKLKKEAKIE 351


>gi|307728470|ref|YP_003905694.1| SurA domain-containing protein [Burkholderia sp. CCGE1003]
 gi|307583005|gb|ADN56403.1| SurA domain protein [Burkholderia sp. CCGE1003]
          Length = 468

 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/314 (13%), Positives = 100/314 (31%), Gaps = 22/314 (7%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE-------- 71
           FV +       ++         I   +N  VIT  ++ +R+ L+  +             
Sbjct: 37  FVSVAPVQAQALAGNRGQTVDTIAAVVNNGVITRRELDERVGLIARRLNQQNAPVPPADQ 96

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L +  + ++++E ++ Q+ ++ GI  D   V     + A+   +S + + + ++ QG+  
Sbjct: 97  LRQQVLNQMVLERIQLQKAKEVGINIDDAAVQKTLERLAQANNMSLDTYRARIEAQGVPW 156

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN----KQKMKNITVREYLIRTVLFSI 187
             F      +     + + +   K    + E+       +      T   ++    L + 
Sbjct: 157 ATFTSDARTELTLSRLREKEVDSKVTVSDAEVANYIASQRGPNAGATSDLHMQHIFLKAP 216

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
            +    +    QK+ +                +  +        G   Y   S L P+F 
Sbjct: 217 LNAPQTDIEAAQKKAEALLAEAKGGANFEKLAKSNSQAPDAGKGGDMGYASPSKLPPEFV 276

Query: 248 NLLKKSQNNTTNP--YVTQKGVEYIAICDKRD--------LGGEIALKAYLSAQNTPTKI 297
                 +    NP    T  G E + + D+R                  ++  +      
Sbjct: 277 KAASSLRPGQVNPEVIRTNDGFEIVRLVDRRTGQGTSSDAPKLMQTHVRHILLRVGDGMS 336

Query: 298 EKHEAEYVKKLRSN 311
           E    + + +++  
Sbjct: 337 EPQARQKLLEIKRE 350



 Score =  102 bits (253), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 16/145 (11%), Positives = 50/145 (34%), Gaps = 2/145 (1%)

Query: 173 ITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIG 232
              +          +      ++   ++++ + +               ++        G
Sbjct: 315 DAPKLMQTHVRHILLRVGDGMSEPQARQKLLEIKREIAAGGDFAKFAHTYSQDGSSSQGG 374

Query: 233 KAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-AYLSA 290
              ++   +  P+F+  +        ++P  ++ G   I + ++R+  G IA +      
Sbjct: 375 DLGWISPGETVPEFERAMNTLQDGQISDPVRSEYGYHLIQVLERREAQGSIAQQMDLARQ 434

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIH 315
                K E+  A+++++LR  A + 
Sbjct: 435 AIGQRKAEQAYADWLRELRDTAYVE 459


>gi|187922682|ref|YP_001894324.1| SurA domain [Burkholderia phytofirmans PsJN]
 gi|187713876|gb|ACD15100.1| SurA domain [Burkholderia phytofirmans PsJN]
          Length = 453

 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/314 (12%), Positives = 99/314 (31%), Gaps = 22/314 (7%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE-------- 71
           F+ +       +   S      I   +N  VIT  ++ +R++L+  +             
Sbjct: 22  FLSVAPVQAQALGGSSGQTVDTIAAVVNNGVITRRELDERMSLITRRLNQQNAPVPPLDQ 81

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L +  + ++++E ++ Q+ ++  I  D  TV     + A    LS + + S ++ QG+  
Sbjct: 82  LRQQVLNQMVLERIQLQKAKEDNINIDDATVQKTLERLAAANNLSLDVYRSRIEAQGVPW 141

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI---- 187
           + F      +     + + +   K    + E+       +           +        
Sbjct: 142 STFTSDARTELTLSRLREKEVDSKVTVSDAEVANYIASQRGPNAGATSDLHLQHIFLKAP 201

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
            +    +    Q++ +                +  +        G   ++  S L P+  
Sbjct: 202 LNAPETDIEAAQQKAQALLAEAKGGANFDKLAKSNSQAPDASKGGDTGFVAPSKLPPEVV 261

Query: 248 NLLKKSQNNTTNP--YVTQKGVEYIAICDKRDLGGE--------IALKAYLSAQNTPTKI 297
             +   +    NP    T  G E + + D+R   G              ++  +      
Sbjct: 262 KAVSTMRPGEVNPDLIRTNDGFEIVRLVDRRAGQGTSSDAPKLVQTHVRHILLRVGDGMS 321

Query: 298 EKHEAEYVKKLRSN 311
           E    + + +++  
Sbjct: 322 EPQARQKLLEIKKE 335



 Score =  103 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 14/145 (9%), Positives = 50/145 (34%), Gaps = 2/145 (1%)

Query: 173 ITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIG 232
              +          +      ++   ++++ + ++              ++        G
Sbjct: 300 DAPKLVQTHVRHILLRVGDGMSEPQARQKLLEIKKEIAAGGDFAKFAHTYSQDGSSSQGG 359

Query: 233 KAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-AYLSA 290
              ++   +  P+F+  +        ++P  ++ G   I +  +R+  G ++ +      
Sbjct: 360 DLGWISPGETVPEFERAMNNLQDGQISDPVRSEYGYHLIQVLGRRESEGSVSQQMDLARQ 419

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIH 315
                K E+  A+++++LR  A + 
Sbjct: 420 AIGQRKAEQAYADWLRELRDTAYVE 444


>gi|157368971|ref|YP_001476960.1| peptidyl-prolyl cis-trans isomerase SurA [Serratia proteamaculans
           568]
 gi|157320735|gb|ABV39832.1| SurA domain [Serratia proteamaculans 568]
          Length = 432

 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 34/309 (11%), Positives = 105/309 (33%), Gaps = 16/309 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   +    ++ +     ++   ++  V+ + D+S  +  +KL              L
Sbjct: 7   LILGLVVCANTAFAAPQEVDKVAAVVDNGVVLESDVSTLLQSVKLNAQQAGQQLPDDKTL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ ++ Q  +K GI      ++      A    +S +   S L  +G+  N
Sbjct: 67  RHQILERLIMDNIQLQMAKKMGINVSDADLDKAIGNIAAQNKMSIDQMRSRLAYEGLNYN 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            ++  +  + +  +V  N+   +   L  E+ +   ++      +  +      IP  + 
Sbjct: 127 TYRSQIRKEMLISEVRNNEVRRRVTILPQEVDSLAAQVGAQNGSDTEMNISHILIPLPEN 186

Query: 193 QNQGFVQKRIKDAEES---RLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +Q  V      A++                 +++    +  G   +    ++   F + 
Sbjct: 187 PSQAQVDDAEALAKKLMGEINGGADFGKLAISYSADSQALKGGNMGWGKLQEIPTLFAER 246

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKHEAEY 304
           L+   + +   P  +  G   + + D R     +        ++  + +    +      
Sbjct: 247 LVNAKKGDVVGPIRSGVGFHILKVNDIRGANQSVSVTEVHARHILLKPSVVLTDDQARAK 306

Query: 305 VKKLRSNAI 313
           ++++     
Sbjct: 307 LQEVAEAIK 315



 Score = 87.4 bits (214), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 39/285 (13%), Positives = 87/285 (30%), Gaps = 17/285 (5%)

Query: 47  NGEV-----ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNT 101
           N EV     I   ++    A +  Q  +     I+   LI       + +       +  
Sbjct: 143 NNEVRRRVTILPQEVDSLAAQVGAQNGSDTEMNIS-HILIPLPENPSQAQVDDAEALAKK 201

Query: 102 VNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND-------FML 154
           +       A    L+    +     +G      K           +V             
Sbjct: 202 LMGEINGGADFGKLAISYSADSQALKGGNMGWGKLQEIPTLFAERLVNAKKGDVVGPIRS 261

Query: 155 KYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
             G   +++   +   ++++V E   R +L         +Q    K  + AE  +    K
Sbjct: 262 GVGFHILKVNDIRGANQSVSVTEVHARHILLKPSVVLTDDQA-RAKLQEVAEAIKSGRAK 320

Query: 215 DCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAI 272
             ++ ++ +      +  G   +       P F++  +K S+   + P  +  G   I +
Sbjct: 321 FADEAKQLSQDPGSALQGGDLGWASPDIYDPAFRDALMKLSKGEVSQPVHSSFGWHLIQL 380

Query: 273 CDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            D R +   + A K          K  +    ++++ R+ A +  
Sbjct: 381 LDTRQVDKTDAAQKDRAYRMLFNRKFAEEAQTWMQEQRAQAYVKI 425


>gi|298291093|ref|YP_003693032.1| SurA domain protein [Starkeya novella DSM 506]
 gi|296927604|gb|ADH88413.1| SurA domain protein [Starkeya novella DSM 506]
          Length = 326

 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 58/301 (19%), Positives = 117/301 (38%), Gaps = 5/301 (1%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQE 79
            V  +     + ++   A +  I   + G+ IT  D+++RI L +L +     +K A+++
Sbjct: 26  LVAGMVAACALAAFPGAASAQGILVMVQGQPITSFDVAQRIKLAQLTERLSLSQKQALED 85

Query: 80  LIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLA 139
           LI E LK    E+ G+T D + +   F + A  +G + +  +  L + G+     K  + 
Sbjct: 86  LIDERLKIITAERGGVTADKDEIEKMFARMANRSGRTPDQLTQALTQSGLDARMLKTKMR 145

Query: 140 IQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN---ITVREYLIRTVLFSIPDNKLQNQG 196
              +W   V+  +       + ++ A  Q          R          +   +  N  
Sbjct: 146 ADYVWNSYVRGRYSSAATVRDSDVFAALQTKGEDLTKAQRTTEYTIRQVVLVVGRTANPA 205

Query: 197 FVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-N 255
              +R+ +A   R                + +  +        +D+    + ++  +   
Sbjct: 206 QRSQRMAEANSLRKSFTSCDG-GVATVRGMREAVVRDPVIRTSADMSEGVRKVMDSTPVG 264

Query: 256 NTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
             T P VT+ G+E +AIC +R++ GE A K  + A     + E      + + R  A+I 
Sbjct: 265 QLTPPEVTRAGIEMVAICARREVVGESAQKREVRADLETKQFEAVSKRLLAEARKGAMIQ 324

Query: 316 Y 316
           Y
Sbjct: 325 Y 325


>gi|116750899|ref|YP_847586.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Syntrophobacter
           fumaroxidans MPOB]
 gi|116699963|gb|ABK19151.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Syntrophobacter
           fumaroxidans MPOB]
          Length = 326

 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 47/323 (14%), Positives = 109/323 (33%), Gaps = 21/323 (6%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI------ 68
            +    +L++FC++      +     RI   +NGE+I   ++ +R+ L++          
Sbjct: 2   RMAGCVLLVLFCVIAASGRCAADSLDRIVAVVNGEIILYSELQERLQLVQKSLPETRTND 61

Query: 69  ---NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLD 125
                 +E+  +Q++  E L +QE ++  IT     V+        +  +S     + L 
Sbjct: 62  PARKAAIERELLQQMTREKLTEQEAKRLKITVTKKDVDEAIAFVMADHNVSQAQMEARLK 121

Query: 126 KQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN----ITVREYLIR 181
           + G     F++ L        +++     K    E +I A   +           +   R
Sbjct: 122 ESGQSMEEFRKVLTKDLERDRLLERVLKSKILISEKQIDAFLSQSPPEVRVEPRGKEEYR 181

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESD 241
             +  +P +        +KR ++  E             +++        G   ++   +
Sbjct: 182 LGIIFLPASDGAEGKQAEKRAREIREKLKAGEDFAAMARQYSKGPAAQDGGDVGFVSLDE 241

Query: 242 LHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKR-------DLGGEIALKAYLSAQNT 293
           L P   +N+     N  ++      G     + D R              ++     Q  
Sbjct: 242 LAPFIAKNVKDLKINQPSDVVKGGDGYYIFLVTDVRRAEMQAAQNSPATNMRERARRQLY 301

Query: 294 PTKIEKHEAEYVKKLRSNAIIHY 316
             ++ +   E++K L S + +  
Sbjct: 302 QQEMARRFDEWIKDLESRSFVKI 324


>gi|145630363|ref|ZP_01786144.1| stationary-phase survival protein SurA [Haemophilus influenzae
           R3021]
 gi|144984098|gb|EDJ91535.1| stationary-phase survival protein SurA [Haemophilus influenzae
           R3021]
          Length = 311

 Score =  127 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 55/316 (17%), Positives = 113/316 (35%), Gaps = 20/316 (6%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAM-SSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +        +   +  V++ S A    R+  T++G  + +  +       +         
Sbjct: 1   MKKFVLRSFLLATLGCVAFTSMAQAEERVVATVDGIPVLESQV-------RANMGKKGDR 53

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 54  QSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNT 113

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEI----------PANKQKMKNITVREYLIRTV 183
           F+Q +A Q +   V              E+             K   + +  +EY +R +
Sbjct: 114 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 173

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQY-LLESDL 242
           L  +       Q   Q     ++    +       L+     +   + G   Y   E+  
Sbjct: 174 LLKLNPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPETYA 233

Query: 243 HPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKHE 301
               Q ++K  Q   + P+ T+ G   + +   RD              +   T+++   
Sbjct: 234 PQFAQTVMKSKQGVISAPFKTEFGWHILEVTGVRDGDLTAEAYTQKAYERLVNTQLQDAT 293

Query: 302 AEYVKKLRSNAIIHYY 317
            ++VK LR  A I Y+
Sbjct: 294 NDWVKALRKRANIQYF 309


>gi|114319362|ref|YP_741045.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|122070615|sp|Q0AC82|SURA_ALHEH RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|114225756|gb|ABI55555.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 433

 Score =  127 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 36/272 (13%), Positives = 92/272 (33%), Gaps = 11/272 (4%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALLKLQK--------INGELEKIAVQELIVETL 85
                  RI   ++ +V+   ++ + +A +  Q              ++  ++ LI + +
Sbjct: 26  ARAETLDRIVAVVDDQVVLASELERELATIANQLRSRGQRLPPRDVFQRQVLERLITQRV 85

Query: 86  KKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWP 145
           +    ++ GIT D  T++    + AR   ++   F   ++++G   N+F++ +  +    
Sbjct: 86  QLSRAQRVGITVDDATLDAAMQRMARQNNMTLGQFRQAVEQEGFEYNYFREGIREEIAIS 145

Query: 146 DVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDA 205
            + +     +      E+    + + +      L   ++ +            ++RI+  
Sbjct: 146 RLRQAQVEEQVTVTPQEVEEVLETLDDENQEYRLGHILVATPEAASTAQLEEARERIEQL 205

Query: 206 EESRLRLPKDCN-KLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK--SQNNTTNPYV 262
            E  +    D       F+     +  G   + L S L   F   + +       +    
Sbjct: 206 REQIIAGETDFEGAATAFSDAASAMEGGDLGWRLHSQLPSLFAEAIDEGLQAGEVSGVLQ 265

Query: 263 TQKGVEYIAICDKRDLGGEIALKAYLSAQNTP 294
              G   + + D+R  GGE   +         
Sbjct: 266 NSSGFHLVKLMDQRTQGGERVTETRARHILIR 297



 Score = 96.7 bits (238), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 22/155 (14%), Positives = 53/155 (34%), Gaps = 3/155 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +    Q+ +            +    D  +      + R++   E            E +
Sbjct: 273 VKLMDQRTQGGERVTETRARHILIRTDGDVITDEDARLRLRSLLERIEAGESFAELAEAY 332

Query: 223 ASKI-HDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGG 280
           +         G   +     L P+FQ  +    +   + P+ +  G   + + D+R+   
Sbjct: 333 SEDPGSAARGGDLGWTQPGQLVPEFQGAMDALEEGQISAPFASPFGWHIVQVTDRRERDV 392

Query: 281 E-IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
               L+  L+ Q    K+E+   +++++LR  A +
Sbjct: 393 SRERLRDQLAQQIHQRKVEEAFEQWIRRLRDEAYV 427


>gi|330448801|ref|ZP_08312448.1| peptidyl-prolyl cis-trans isomerase [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328492992|dbj|GAA06945.1| peptidyl-prolyl cis-trans isomerase [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 433

 Score =  127 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 40/314 (12%), Positives = 116/314 (36%), Gaps = 15/314 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALL--------K 64
           +K      + ++   +   S  +     ++  T+N  VI   D++  +  +        +
Sbjct: 1   MKKWKYSVLSLMMMGMSATSMAAPQELDQVVMTVNDGVILQSDVNAMLKTVHLNAAEEHQ 60

Query: 65  LQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
               N  L +  + +LI+E L+ Q+ ++ GI  D + ++      A+  G++ +     L
Sbjct: 61  QLPPNDILRQQVMDKLIMENLQIQQAKQLGIRIDDSQLDQAIADVAKQRGITVDQLRQTL 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            K GI    F++ +    +  +        +   L  E+ A  ++M   T +        
Sbjct: 121 AKAGISYPMFREQMRNDMLASEARTVIVRKRVNILPQEVDALAKQMAKQTQQNVQYNISQ 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEES---RLRLPKDCNKLEKFASKIHDVSIGKAQYLLESD 241
             I  ++   +    K  ++AE+      +         +++     +  G+  ++ + +
Sbjct: 181 IQIRVDEDAEKAARDKAKQEAEDIVAQLKKGADFSQLAYRYSKGPKALKGGEWGWMSKEE 240

Query: 242 LHPQFQNLLKKSQNN-TTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKI 297
           +   F + ++ +  +    P+ +  G   + I D +    +        ++  + +    
Sbjct: 241 MPTIFADQIQNNGKDAIIGPFRSGVGYHILKINDVKGMPSVSVVEVKARHILIKPSVILS 300

Query: 298 EKHEAEYVKKLRSN 311
           +    + ++++R  
Sbjct: 301 DAAAKKELEQIRQR 314



 Score = 84.0 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/286 (9%), Positives = 84/286 (29%), Gaps = 7/286 (2%)

Query: 37  AMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQEL-IVETLKKQEIEKSGI 95
           A  +R         I   ++      +  Q        I+  ++ + E  +K   +K+  
Sbjct: 140 ASEARTVIVRKRVNILPQEVDALAKQMAKQTQQNVQYNISQIQIRVDEDAEKAARDKAKQ 199

Query: 96  TFDSNTVNYFFVQHARNTGLSAEDFSSFLD--KQGIGDNHFKQYLAIQSIWPDVVKNDFM 153
             +                         L   + G         +    I  +       
Sbjct: 200 EAEDIVAQLKKGADFSQLAYRYSKGPKALKGGEWGWMSKEEMPTIFADQIQNNGKDAIIG 259

Query: 154 LKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP 213
                +   I          +V    ++     I  + + +    +K ++   +  +   
Sbjct: 260 PFRSGVGYHILKINDVKGMPSVSVVEVKARHILIKPSVILSDAAAKKELEQIRQRIISGK 319

Query: 214 K-DCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYI 270
           +      + ++       + G+  + +     P F++ ++    +  + P+ +  G   +
Sbjct: 320 QSFAAAAKAYSQDPGSAANGGELGWQVPDMYAPAFKDKVETLPVDKISEPFKSAFGWHIV 379

Query: 271 AICDKRDLG-GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            +  +R +   + A+K   +      K  +    ++++LR+ A I 
Sbjct: 380 EVEGRRKVDRTDAAMKNRAAQILFNRKFNEEAQTWLQELRAGAYIE 425


>gi|148825262|ref|YP_001290015.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittEE]
 gi|148715422|gb|ABQ97632.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittEE]
          Length = 311

 Score =  127 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 55/316 (17%), Positives = 113/316 (35%), Gaps = 20/316 (6%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAM-SSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +        +   +  V++ S A    R+  T++G  + +  +       +         
Sbjct: 1   MKKFILKSFLLATLGCVAFTSMAQAEERVVATVDGIPVLESQV-------RANMGKKGDR 53

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 54  QSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNA 113

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEI----------PANKQKMKNITVREYLIRTV 183
           F+Q +A Q +   V              E+             K   + +  +EY +R +
Sbjct: 114 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 173

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQY-LLESDL 242
           L  +       Q   Q     ++    +       L+     +   + G   Y   E+  
Sbjct: 174 LLKLNPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPETYA 233

Query: 243 HPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKHE 301
               Q ++K  Q   + P+ T+ G   + +   RD              +   T+++   
Sbjct: 234 PQFAQTVVKSKQGVISAPFKTEFGWHILEVTGVRDGDLTAEAYTQKAYERLVNTQLQDAT 293

Query: 302 AEYVKKLRSNAIIHYY 317
            ++VK LR  A I Y+
Sbjct: 294 NDWVKALRKRANIQYF 309


>gi|83648743|ref|YP_437178.1| parvulin-like peptidyl-prolyl isomerase [Hahella chejuensis KCTC
           2396]
 gi|122070647|sp|Q2S9C1|SURA_HAHCH RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|83636786|gb|ABC32753.1| Parvulin-like peptidyl-prolyl isomerase [Hahella chejuensis KCTC
           2396]
          Length = 434

 Score =  127 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 36/290 (12%), Positives = 105/290 (36%), Gaps = 15/290 (5%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVETL 85
                  R+   +N +++   ++  R + +K +    +        L +  + +L++E++
Sbjct: 29  AQVQELDRVVAVVNDDIVLYSELQDRASRIKDKLRQQKTPLPPEAVLHEKVLDQLVLESI 88

Query: 86  KKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWP 145
           + Q  ++ GI    + +N      A+  G++ + F   L ++G+     ++ +  + I  
Sbjct: 89  QMQMADRGGIRVSDSQLNQTMQNIAKQNGMTLDQFQQALSEEGVTYQSAREQIRREMIIS 148

Query: 146 DVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDA 205
            V +     +    E E+    +       R          I   +  +    ++     
Sbjct: 149 RVQQRSVDSRVRVTEKEVNDFLKSASAKEQRAEEYHLAHILIALPENPSDAQRKEAESKV 208

Query: 206 EESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPY 261
           E+ R +L +  +       ++        G   +     +   F ++  K +   T+ P 
Sbjct: 209 EKIRSQLDQGVDFKQLAITYSDASTATQGGDLGWRKPDQVPSLFADVAPKLAPGQTSEPI 268

Query: 262 VTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPT---KIEKHEAEYVKKL 308
               GV ++A+ +KR    ++  ++ +          + E    + ++++
Sbjct: 269 RNSSGVHFVAMLEKRGGVSKVVEQSKVRHILVQQNELRDEIAAKKLIEEI 318



 Score = 87.8 bits (215), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 17/145 (11%), Positives = 56/145 (38%), Gaps = 3/145 (2%)

Query: 174 TVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIG 232
           +      +     +  N+L+++   +K I++               + ++       + G
Sbjct: 287 SKVVEQSKVRHILVQQNELRDEIAAKKLIEEIYGKVQAGEDFAELAKAYSDDAVSAAAGG 346

Query: 233 KAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSA 290
              ++   D+ P+F  +++++     + P+ +  G   + + D+R+   G+  + +    
Sbjct: 347 SLDWVNPGDMVPEFDQMMRETPVGAVSKPFQSTFGWHILQVQDRREADIGDRLMASQARQ 406

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIH 315
                K E+    ++ ++R  A + 
Sbjct: 407 VLHRRKYEEELQNWLSEIRDEAFVQ 431


>gi|255066985|ref|ZP_05318840.1| SurA/PPIASE domain protein [Neisseria sicca ATCC 29256]
 gi|255048810|gb|EET44274.1| SurA/PPIASE domain protein [Neisseria sicca ATCC 29256]
          Length = 331

 Score =  127 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 42/286 (14%), Positives = 86/286 (30%), Gaps = 17/286 (5%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKL------QKINGELEKIAVQELIVETLKKQEIEK 92
           S  I    + EVIT   ++  IA  +       Q    EL +  + +L+ ++L  Q  ++
Sbjct: 54  SDGIAAIADNEVITQRQLAHAIAEARQHLPKGTQISEDELRQQVLAQLVNQSLIIQAGKR 113

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
             I      ++    Q       SA+      D          + +  Q++      +  
Sbjct: 114 RNIQATDAEIDAVIAQTPSLKNPSAQTRREIADT------IIMEKVRQQAVMQ---NSRV 164

Query: 153 MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRL 212
                N  +E    +                   I  +        +  I+         
Sbjct: 165 SDAEVNSFIERARQQGVALPEGEPMRQYSAQHILIKADNDNAAAGAESTIRKIYAQARSG 224

Query: 213 PKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIA 271
                   +++      S G   +  +  +   F+  + K      + P  TQ G   I 
Sbjct: 225 ADFAGLARQYSQDGSANSGGDLGWFADGMMVAPFEEAVHKLKPGQISPPVRTQFGWHIIK 284

Query: 272 ICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           + D RD    E   +  +    +  K ++  A  ++ L S A ++ 
Sbjct: 285 LNDVRDAGTPEERQRNAVRQYMSGQKAQQATANLLRDLHSGAYVNI 330


>gi|209519024|ref|ZP_03267832.1| SurA domain protein [Burkholderia sp. H160]
 gi|209500536|gb|EEA00584.1| SurA domain protein [Burkholderia sp. H160]
          Length = 478

 Score =  127 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 43/341 (12%), Positives = 108/341 (31%), Gaps = 38/341 (11%)

Query: 9   LSDFIKLLTTYFVLIIFC-------IVPIVSYKSWA--------MSSRIRTTINGEVITD 53
           +  F+ ++    +  +          +P+ S ++ A            I   +N  VIT 
Sbjct: 20  IGVFVAIMKQLRLATLAAGLVAAASFLPVASVQAQALGGNGGGQTVDTIAAVVNNGVITQ 79

Query: 54  GDISKRIALLKLQKINGE--------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
            ++ +R  L+  +             L +  + ++++E ++ Q+ ++ GIT D   V   
Sbjct: 80  RELDERAGLIAHRLNQQNAPVPPMDQLRQQVLTQMVLERIQLQKAKEDGITIDDTAVERT 139

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA 165
             + A+   ++   + + ++ QG+    F      +     + + +   K    + E+  
Sbjct: 140 LERLAQANNMTLAMYRARIEAQGVPWTTFTNDARTELTLSRLREKEVDSKITVTDAEVAN 199

Query: 166 NKQKMKNITVREYLIRTVLFSIP----DNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK 221
                +     +     +         +    +    QK+ +                + 
Sbjct: 200 YIASQRGPGAGQTNDLHMQHIFVKAPLNAPETDIEAAQKKAEGLLAEAKGGADFEKLAKN 259

Query: 222 FASKIHD-VSIGKAQYLLESDLHPQFQNLLKKSQNNTTNP--YVTQKGVEYIAICDKRDL 278
            +       + G   +L  S L P+F       +    NP    T  G E + + ++R  
Sbjct: 260 NSQAPDASKNGGDLGFLAPSKLPPEFVKAASGLRPGEINPDLIRTNDGFEIVRLVERRAG 319

Query: 279 GGE--------IALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
            G              ++  +      E    + +  +RS 
Sbjct: 320 QGNSSDAPKLVQTHVRHILLRVGDGLSEPQARQKLLDIRSQ 360



 Score =  103 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 20/155 (12%), Positives = 52/155 (33%), Gaps = 2/155 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
                Q   +   +          +      ++   ++++ D         +       +
Sbjct: 315 ERRAGQGNSSDAPKLVQTHVRHILLRVGDGLSEPQARQKLLDIRSQIAAGGEFEKFARTY 374

Query: 223 ASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
           +        G   ++   +  P+F+  +     N  ++P  ++ G   I +  +RD  G 
Sbjct: 375 SQDGSSSQGGDLGWISPGETVPEFERAMNSLQDNQISDPVRSEYGYHLIQVLGRRDAEGS 434

Query: 282 IALK-AYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           IA +           K E+  A+++++LR  A + 
Sbjct: 435 IAQQMDLARQAIGQRKAEQAYADWLRELRDTAYVE 469


>gi|145632724|ref|ZP_01788458.1| thymidylate kinase [Haemophilus influenzae 3655]
 gi|145634545|ref|ZP_01790254.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittAA]
 gi|229844382|ref|ZP_04464522.1| stationary-phase survival protein SurA [Haemophilus influenzae
           6P18H1]
 gi|144986919|gb|EDJ93471.1| thymidylate kinase [Haemophilus influenzae 3655]
 gi|145268090|gb|EDK08085.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittAA]
 gi|229812631|gb|EEP48320.1| stationary-phase survival protein SurA [Haemophilus influenzae
           6P18H1]
          Length = 311

 Score =  127 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 55/316 (17%), Positives = 113/316 (35%), Gaps = 20/316 (6%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAM-SSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +        +   +  V++ S A    R+  T++G  + +  +       +         
Sbjct: 1   MKKFILKSFLLATLGCVAFASMAQAEERVVATVDGIPVLESQV-------RANMGKKGDR 53

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 54  QSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNA 113

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEI----------PANKQKMKNITVREYLIRTV 183
           F+Q +A Q +   V              E+             K   + +  +EY +R +
Sbjct: 114 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 173

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQY-LLESDL 242
           L  +       Q   Q     ++    +       L+     +   + G   Y   E+  
Sbjct: 174 LLKLNPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPETYA 233

Query: 243 HPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKHE 301
               Q ++K  Q   + P+ T+ G   + +   RD              +   T+++   
Sbjct: 234 PQFAQTVVKSKQGVISAPFKTEFGWHILEVTGVRDGDLTAEAYTQKAYERLVNTQLQDAT 293

Query: 302 AEYVKKLRSNAIIHYY 317
            ++VK LR  A I Y+
Sbjct: 294 NDWVKALRKRANIQYF 309


>gi|261867180|ref|YP_003255102.1| SurA [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261412512|gb|ACX81883.1| SurA [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 310

 Score =  127 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 41/314 (13%), Positives = 99/314 (31%), Gaps = 19/314 (6%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWA-MSSRIRTTINGEVITDGDISKRIALLKLQKINGELEK 74
           +      ++F  +      +      ++  T+NG  I +  +   I             +
Sbjct: 1   MKMNLKSVLFAAIGFFVLAAHVHAEEKVVATVNGIPILESQVQSAI------NKKTNDRQ 54

Query: 75  IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF 134
            A+ ++I + L  Q +++S +  ++  ++      A   GL+       LD QGI    +
Sbjct: 55  AALNKVIDDILVDQAVKESDVKVNNAQIDQIIEGIAAQNGLTFGQLLDALDYQGISYRAY 114

Query: 135 KQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA---------NKQKMKNITVREYLIRTVLF 185
           +Q +A Q +  +V  +           ++             +               + 
Sbjct: 115 RQQIAQQVMMSEVRNHAISQSVDVSREQVEVLAKKMLDEAKAKGSVAQISDTQYEVRHIL 174

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQY-LLESDLH 243
              +  L +     +  +   +  +      +   K++       + G   Y   E  + 
Sbjct: 175 LKLNPLLNDAQAKAQLEQIRADIIVGKTTFADAALKYSKDYLSGANGGSLGYAFPEMYVG 234

Query: 244 PQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKHEA 302
           P  Q +        + P+ T+ G   + + + R               Q    +++    
Sbjct: 235 PFNQAVRTTKPGVISAPFKTEFGWHILEVTNTRQADRTEDAYRQKAYEQIVNQQLQDSAL 294

Query: 303 EYVKKLRSNAIIHY 316
           ++V+ LR  A I Y
Sbjct: 295 DWVQALRKRADIKY 308


>gi|88859123|ref|ZP_01133764.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Pseudoalteromonas
           tunicata D2]
 gi|88819349|gb|EAR29163.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Pseudoalteromonas
           tunicata D2]
          Length = 430

 Score =  127 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 42/317 (13%), Positives = 106/317 (33%), Gaps = 19/317 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK----- 67
           +KL T  F ++    + + +        ++  T+N  V+   +I   I  +K +      
Sbjct: 1   MKLKTLVFTVLCTLGLNLPAVAKEVQIDKVVATVNEGVVLQSEIDTIINRVKSRALTDGQ 60

Query: 68  ---INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
               +  L   A++ LI + L  Q  E+ G+      ++   +  A+  G +  D    +
Sbjct: 61  SLPTDDALRLQAIERLINQELLMQMSERMGLQISDAQLDQTLMMMAKEQGGTLADLRKTI 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI---R 181
           +  G     +++ + ++     V++++   +      EI      ++             
Sbjct: 121 ESSGESYQAYREEMRVEMTTQQVLRSNVERRIYISLQEIENLLTILEQQGQTNEEYDIGH 180

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESD 241
            ++    D   Q     + R +   +      +        +     +  G+  ++  ++
Sbjct: 181 ILIDLPADGNAQEIEDAKVRAEKVIKLLNEGSEFKRIAIASSGGSKALEGGQLGWMSINE 240

Query: 242 LHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK---AYLSAQ----NT 293
           +   F + +  K       P  +  G   I + D R       ++    ++  Q     +
Sbjct: 241 MPTLFAEAVKGKKAGEIVGPLRSGAGFHIIKVQDIRGRQVVETVEVRSRHILIQPSIILS 300

Query: 294 PTKIEKHEAEYVKKLRS 310
             K     A +VK L+ 
Sbjct: 301 EEKARSMLAGFVKDLKE 317



 Score = 75.5 bits (183), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 33/274 (12%), Positives = 77/274 (28%), Gaps = 9/274 (3%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I+  +I   + +L+ Q    E E      LI         E       +  V     + +
Sbjct: 154 ISLQEIENLLTILEQQGQTNE-EYDIGHILIDLPADGNAQEIEDAKVRAEKVIKLLNEGS 212

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEM-----EIPA 165
               ++          +G                  V         G L        I  
Sbjct: 213 EFKRIAIASSGGSKALEGGQLGWMSINEMPTLFAEAVKGKKAGEIVGPLRSGAGFHIIKV 272

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK 225
              + + +     +    +   P   L  +          ++ +          ++++  
Sbjct: 273 QDIRGRQVVETVEVRSRHILIQPSIILSEEKARSMLAGFVKDLKEGKADFATLAKEYSED 332

Query: 226 I-HDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDL-GGEI 282
               +  G+  +   S   P F++ L    ++  + P+ +  G   + + DKR     E+
Sbjct: 333 QGSALKGGEYDWTDPSTYVPAFRDTLLSLEKDQLSEPFRSNYGWHIVQLLDKRIADKTEL 392

Query: 283 ALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           A +          K ++    + +++R  A I  
Sbjct: 393 AKRNRAQQMLFNRKFKEESFAWQREMREQAHIEI 426


>gi|319898023|ref|YP_004136220.1| survival protein sura homolog [Haemophilus influenzae F3031]
 gi|317433529|emb|CBY81912.1| survival protein SurA homolog [Haemophilus influenzae F3031]
          Length = 311

 Score =  127 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 55/316 (17%), Positives = 113/316 (35%), Gaps = 20/316 (6%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAM-SSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +        +   +  V++ S A    R+  T++G  + +  +       +         
Sbjct: 1   MKKFILKSFLLATLGCVAFASMAQAEERVVATVDGIPVLESQV-------RANMGKKGDR 53

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 54  QSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNA 113

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEI----------PANKQKMKNITVREYLIRTV 183
           F+Q +A Q +   V              E+             K   + +  +EY +R +
Sbjct: 114 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 173

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQY-LLESDL 242
           L  +       Q   Q     ++    +       L+     +   + G   Y   E+  
Sbjct: 174 LLKLNPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPETYA 233

Query: 243 HPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKHE 301
               Q ++K  Q   + P+ T+ G   + +   RD              +   T+++   
Sbjct: 234 PQFAQTVMKSKQGVISAPFKTEFGWHILEVTGVRDGDLTAEAYTQKAYERLVNTQLQDAT 293

Query: 302 AEYVKKLRSNAIIHYY 317
            ++VK LR  A I Y+
Sbjct: 294 KDWVKALRKRANIQYF 309


>gi|313669248|ref|YP_004049532.1| peptidyl-prolyl cis-trans isomerase [Neisseria lactamica ST-640]
 gi|313006710|emb|CBN88180.1| putative peptidyl-prolyl cis-trans isomerase [Neisseria lactamica
           020-06]
          Length = 359

 Score =  127 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 37/286 (12%), Positives = 78/286 (27%), Gaps = 17/286 (5%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKLQKING------ELEKIAVQELIVETLKKQEIEK 92
           S  I    + EVIT   +++ +A  K     G       L +  + +L+ ++L  Q  ++
Sbjct: 82  SDGIAAVADNEVITRRRLAQAVADAKANLPKGVQISDTALTEQVLMQLVNQSLIVQAGKR 141

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
                +                       +   +        K           V + + 
Sbjct: 142 R----NIQATEAEIDAVVAQNPALKNLSPAQRRELADNIIAEKVREQAVMQNSRVSEAEV 197

Query: 153 MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRL 212
                    E    +             R     I  +        +  I+   +     
Sbjct: 198 DRFI-----EQAQKQGITLPEGEPLRQYRAQHILIKADGENAAVGAESTIRKIYDQARNG 252

Query: 213 PKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIA 271
                   +++      + G   +  +  +   F+  +        + P  TQ G   I 
Sbjct: 253 TDFSGLARQYSQDAGAGNGGDLGWFSDGVMVAPFEAAVHALKPGQVSAPVRTQFGWHIIK 312

Query: 272 ICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           + + RD    E  ++  +       K E+  AE ++ L S A I  
Sbjct: 313 LNEVRDAGTPEERIRNSVRQYIFQQKAEQATAELLRDLHSGAYIDI 358


>gi|328952685|ref|YP_004370019.1| SurA domain protein [Desulfobacca acetoxidans DSM 11109]
 gi|328453009|gb|AEB08838.1| SurA domain protein [Desulfobacca acetoxidans DSM 11109]
          Length = 316

 Score =  127 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 53/313 (16%), Positives = 109/313 (34%), Gaps = 11/313 (3%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ-------K 67
            L    +      +      +  +   I   +N EVIT  ++ + +  ++         K
Sbjct: 2   RLIASLLFCACLAILPDGMAAAKIVDEIVAQVNDEVITLSELEQAMKYIQANPAAGAKVK 61

Query: 68  INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF-SSFLDK 126
            N    + A++ LI   L K+E ++ GIT     +        +  G + ++  S  L K
Sbjct: 62  NNQAFRRQALEMLIDRKLAKEEAKRYGITVPEKEIKKTVDDIKQKYGFTDDETLSKALAK 121

Query: 127 QGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTV-LF 185
            G+     +Q L  Q     ++ +    K    + EI    ++          I+ + L 
Sbjct: 122 DGMTMEQLRQQLIEQIQQDRLMLSTVRSKVKVSDAEIQQFYEQRYRQADNRVHIKIINLP 181

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ 245
               +  + Q  V+   +       R       +E ++    +V  G   Y+ +SD+ P+
Sbjct: 182 VAAGSSAEEQEEVRALAERILIQARRGESFDKLMETYSKSTPNVPGGDLGYIRQSDIDPR 241

Query: 246 FQNLLKKSQNNTTNPYVTQKGVEYIAICDKR--DLGGEIALKAYLSAQNTPTKIEKHEAE 303
           F   L   +     P     G + I + D +          +  +       ++ K  +E
Sbjct: 242 FFEFLSNLRPGEIVPLRAPFGFQIIKMVDAKVGKAKSLSEARGEIEQILIREQMAKLFSE 301

Query: 304 YVKKLRSNAIIHY 316
           Y++ +R  A I  
Sbjct: 302 YLQSIRQKAHIKI 314


>gi|313200363|ref|YP_004039021.1| sura domain-containing protein [Methylovorus sp. MP688]
 gi|312439679|gb|ADQ83785.1| SurA domain protein [Methylovorus sp. MP688]
          Length = 438

 Score =  127 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 40/315 (12%), Positives = 110/315 (34%), Gaps = 20/315 (6%)

Query: 16  LTTYFVLIIFCIVPIVSYKSW----AMSSRIRTTINGEVITDGDISKRIALLKLQKING- 70
           L     L    ++P V+  +         RI   ++  V+T+ +++ RI ++  Q     
Sbjct: 7   LMAGLFLWAGALLPHVAIAAQDGSVNKIDRIVAVVDQGVVTEKELNDRIEIVSAQLEKQG 66

Query: 71  -------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSF 123
                   LEK  ++ LI + L+ Q   ++G+  D + ++   ++ A    +   +F   
Sbjct: 67  NQLPPRNVLEKQILERLINDRLQLQYAAQTGLRVDDDQLDKTIMRIAEQNKMGVPEFKEA 126

Query: 124 LDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTV 183
           L  +GI    F++ +  + +   + + +   +    E E+        +           
Sbjct: 127 LAAEGIVYKKFREDIRNEILLARLREREVDNRVNVTESEVDNFLTTQSSRQDSSDEYEIS 186

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKL---EKFASKIHDVSIGKAQYLLES 240
              I   +  +   +++  + AE++  +L    +      + +   + +  GK  +   +
Sbjct: 187 HILIRAPEDGSPEDLKRLREKAEDALKKLQAGEDFGQVSARVSDAPNALEGGKLGWKTAA 246

Query: 241 DLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPT 295
            +   F + L        +    +  G   + + D+R        +     ++  + +  
Sbjct: 247 QVPALFLEALKPMQVGQLSGILRSPNGFHILKLTDRRGGNTSTMVQQTHTRHILIKTSEV 306

Query: 296 KIEKHEAEYVKKLRS 310
             E      +  ++ 
Sbjct: 307 LSETEAKRKIDGIKQ 321



 Score = 99.7 bits (246), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 16/144 (11%), Positives = 53/144 (36%), Gaps = 2/144 (1%)

Query: 174 TVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGK 233
           +       T    I  +++ ++   +++I   ++            +++++     + G 
Sbjct: 288 STMVQQTHTRHILIKTSEVLSETEAKRKIDGIKQLIDNGEDFGEAAKRYSNDGSAANGGD 347

Query: 234 AQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLSAQ 291
             ++   D  PQF+  +        ++   +  G   I + ++R+       +      +
Sbjct: 348 LGWVNPGDTVPQFEKAMNALQPGQISDAVRSPFGWHLIQVLERRNQDMTREAERMKARQE 407

Query: 292 NTPTKIEKHEAEYVKKLRSNAIIH 315
               K ++   ++V++LR  A + 
Sbjct: 408 IRQRKADEAYQDWVRELRDRAYVE 431


>gi|254251452|ref|ZP_04944770.1| Parvulin-like peptidyl-prolyl isomerase [Burkholderia dolosa
           AUO158]
 gi|124894061|gb|EAY67941.1| Parvulin-like peptidyl-prolyl isomerase [Burkholderia dolosa
           AUO158]
          Length = 454

 Score =  127 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 41/306 (13%), Positives = 99/306 (32%), Gaps = 24/306 (7%)

Query: 32  SYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVE 83
             +   ++  +   +N +VIT  ++ +R++L+  +             L    + ++++E
Sbjct: 34  GSQGAQLADEVVAVVNNDVITGRELDQRVSLIARRLQQQNAPVPPADQLRAQVLNQMVLE 93

Query: 84  TLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSI 143
            ++ Q+ +  GI  D  TV     + A+  G++ + + + L+ QG+  N F      + +
Sbjct: 94  RIQVQKAKDDGIRIDDATVQATLQRLAQANGMTLDQYRARLEAQGVPWNIFTNDARTELM 153

Query: 144 WPDVVKNDFMLKYGNLEMEIPAN----KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQ 199
              + + +   K    + E+       +                + +  +         Q
Sbjct: 154 LSKLREREVDSKITVSDAEVANYIASQRGPNAAQQQDLRFQHIFIKAPTNAPQTEIEAAQ 213

Query: 200 KRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTN 259
           K+ +   +  +            +        G   +     L P       K +    N
Sbjct: 214 KKAEALLQQAMSGADFEKLARNNSEANDAKKGGDLGFKSPGALPPDVVQAASKLRPGQVN 273

Query: 260 P--YVTQKGVEYIAICDKRDLGGEIALK--------AYLSAQNTPTKIEKHEAEYVKKLR 309
           P       G E + + D+R   G  A           ++  +    K E    + +  +R
Sbjct: 274 PTLIRVPDGFEIVRLVDRRPSQGATAAAPKIVQTHVRHILIRVGEGKSEGQARQELLDIR 333

Query: 310 SNAIIH 315
               I 
Sbjct: 334 KQ--IE 337



 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/285 (10%), Positives = 87/285 (30%), Gaps = 18/285 (6%)

Query: 48  GEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFV 107
              IT  D ++    +  Q+     ++  +       +K            +       +
Sbjct: 163 DSKITVSD-AEVANYIASQRGPNAAQQQDL-RFQHIFIKAPTNAPQTEIEAAQKKAEALL 220

Query: 108 QHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN--------------DFM 153
           Q A +     +   +  +           + +  ++ PDVV+                  
Sbjct: 221 QQAMSGADFEKLARNNSEANDAKKGGDLGFKSPGALPPDVVQAASKLRPGQVNPTLIRVP 280

Query: 154 LKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP 213
             +  + +      Q       +          I   + +++G  ++ + D  +      
Sbjct: 281 DGFEIVRLVDRRPSQGATAAAPKIVQTHVRHILIRVGEGKSEGQARQELLDIRKQIEAGG 340

Query: 214 KDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAI 272
                   ++        G   ++   +  P+F+  +        + P  T+ G   I +
Sbjct: 341 DFAKFARTYSQDGSASQGGDLGWISPGETVPEFERAMNSLQDGQISQPVRTEYGYHLIQV 400

Query: 273 CDKRDLGGEIALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            D+R+  G +  +  +        K E+  A+++++LR ++ + Y
Sbjct: 401 LDRREAEGSVQQQMDIARQAIGQRKAEQAYADWLRELRDSSYVQY 445


>gi|323493622|ref|ZP_08098743.1| survival protein SurA [Vibrio brasiliensis LMG 20546]
 gi|323312145|gb|EGA65288.1| survival protein SurA [Vibrio brasiliensis LMG 20546]
          Length = 432

 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 39/313 (12%), Positives = 110/313 (35%), Gaps = 12/313 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--- 69
           ++      + +        ++        I   +N  V+   DI   +  LK        
Sbjct: 1   MRFWKHALLALCATSTLNTAHAEPVALDNIAVIVNSGVVLQSDIDTSLKTLKANAKKSGQ 60

Query: 70  -----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +   ++LIV+T+++QE ++ G+  D N +N    + ARN   + E  S+ +
Sbjct: 61  SLPSEQVLREQVTEKLIVDTIQQQEAQRIGVRIDDNRLNEAIEEIARNNQQTVEQLSASI 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            ++G+    F++ +  +    +        +   L  E+      +   T      +   
Sbjct: 121 AQEGLSYAEFREQVRKEIAASEARNALVRRRINILPAEVDNLANILAKETNATVQYKIGH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +  N   ++  ++K+ +   E              ++     +  G   ++ + ++  
Sbjct: 181 IQLRVNDGDDKSAIEKQAQQLVEKLKEGADFSTMAYTYSKGPKALQGGDWGWMRKEEMPT 240

Query: 245 QFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F + +  +++ +   P+ +  G   + I D +    +        ++  + T    ++ 
Sbjct: 241 IFADQINLQNKGSIIGPFRSGVGFHILKIEDVKGLETVAVTEVNARHILIKPTVILSDEG 300

Query: 301 EAEYVKKLRSNAI 313
             + +K++     
Sbjct: 301 VQKDLKEITQRIK 313



 Score = 78.6 bits (191), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/269 (11%), Positives = 79/269 (29%), Gaps = 4/269 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     +L  +       KI   +L V     +   +         +        
Sbjct: 154 ILPAEVDNLANILAKETNATVQYKIGHIQLRVNDGDDKSAIEKQAQQLVEKLKEGADFST 213

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +        +   I   +   
Sbjct: 214 MAYTYSKGPKALQGGDWGWMRKEEMPTIFADQINLQNKGSIIGPFRSGVGFHILKIEDVK 273

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK-LEKFASKI-HD 228
              TV    +      I    + +   VQK +K+  +          +  ++++      
Sbjct: 274 GLETVAVTEVNARHILIKPTVILSDEGVQKDLKEITQRIKSGKATFAEMAQQYSQDPGSA 333

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ +        + P+ T  G   + + D+R++   + ALK 
Sbjct: 334 AQDGELGYQTSEIYVPEFKHQVDTLPVGQISEPFKTVHGWHIVEVLDRREVDRTDSALKN 393

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
                    K  +  + +++++R++A + 
Sbjct: 394 KAYRILFNRKFNEEASAWLQEIRASAYVE 422


>gi|27379215|ref|NP_770744.1| hypothetical protein bll4104 [Bradyrhizobium japonicum USDA 110]
 gi|27352366|dbj|BAC49369.1| bll4104 [Bradyrhizobium japonicum USDA 110]
          Length = 313

 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 53/283 (18%), Positives = 112/283 (39%), Gaps = 2/283 (0%)

Query: 36  WAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGI 95
            + +  I   +NG+ ITD DI +R  L  L        +  + ELI + +K +E +K G+
Sbjct: 28  PSRAQNIVVMVNGDPITDFDIDQRSKLDLLTTQKTPSRQEVINELIDDRVKLKEGKKYGV 87

Query: 96  TFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLK 155
               + +N  F   A+   ++ +  +  L+ +G+     K  +  + +W  +V+  F  K
Sbjct: 88  DPGVSDINQSFEGMAQRMRITTDQLTKSLEVKGVRPETLKARMKSEMVWTSLVRGRFKEK 147

Query: 156 YGNLEMEIPANKQKMKNITVREY-LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
               E ++    Q      ++       +   +      +    Q+      E       
Sbjct: 148 LMVGERDVAQAVQAQAGDKLQIEGTEYKMQPIVLIVPRGSSPAFQETRMKEAEQYRSRVA 207

Query: 215 DCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAIC 273
            C +         + +I ++     ++L    + +L  +   + T P VT+ G+E + +C
Sbjct: 208 SCEEANSLFRSTPNATIRESVTKTTAELPEALRKVLDDTPIGHLTAPEVTKAGIEMVVLC 267

Query: 274 DKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            ++    +   K  +  +    K EK +  Y+ +LR  A+I Y
Sbjct: 268 SRKPTMIDTPKKREVREKMYQEKYEKTQKAYLDELRKAAMIEY 310


>gi|315648234|ref|ZP_07901335.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Paenibacillus vortex
           V453]
 gi|315276880|gb|EFU40223.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Paenibacillus vortex
           V453]
          Length = 399

 Score =  126 bits (316), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 45/303 (14%), Positives = 95/303 (31%), Gaps = 25/303 (8%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEK 74
           ++ +  +     +V IV   +    +     +N   IT   +   +             K
Sbjct: 96  MIASLVLAAALIVVLIVPPFAKGSGNEAVAKVNDVKITKDTLYNELV--------EAGGK 147

Query: 75  IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF 134
             V  +I E L KQE+ K  IT     VN        +   S + F+  L + G+     
Sbjct: 148 QTVNSMITEELIKQELAKQSITVTDAEVNEEVDALKASF-PSEDQFNMALQQSGMTLEDL 206

Query: 135 KQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQN 194
           K     Q     ++      K    + EI     + K        +R             
Sbjct: 207 KGQTKTQVELKKLM----GDKIKVTDEEIKTIYDQNKESFATPEQVRASHIL-------- 254

Query: 195 QGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-S 253
               ++   +  +            ++        + G   +    ++ P F+    K  
Sbjct: 255 -VETKEEADEIVKQLKDGADFAAIAKEKNQDATKDTGGDLDFFGRGEMDPAFEEAAFKLK 313

Query: 254 QNNTTNPYVTQKGVEYIAICDKRDLGGE--IALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
           ++  ++P  +  G   I + D+++         K  +  Q    K+ +  + Y+++L+  
Sbjct: 314 KDEISDPVKSSFGYHIIKLTDRKEATNPTLEDKKVEIRKQLENQKVYQESSAYIQELKDK 373

Query: 312 AII 314
           A I
Sbjct: 374 ATI 376


>gi|239831518|ref|ZP_04679847.1| Chaperone surA precursor [Ochrobactrum intermedium LMG 3301]
 gi|239823785|gb|EEQ95353.1| Chaperone surA precursor [Ochrobactrum intermedium LMG 3301]
          Length = 336

 Score =  126 bits (316), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 73/318 (22%), Positives = 131/318 (41%), Gaps = 8/318 (2%)

Query: 4   KVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALL 63
           K+  +   F  +L+    L     V      +    S ++  ++G  IT+ DI  R+A L
Sbjct: 17  KMMIARPLFASMLSAAVCLTTLGTVA-APAFAAGAGSEVKVIVSGNAITNSDIQHRVAFL 75

Query: 64  KLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSF 123
           KLQ+  G L ++A QEL  E LK+ E++  GI      V+  +   A    +S    +  
Sbjct: 76  KLQRKGGNLAQVAKQELTDEMLKRIEMKSRGIDISDRQVDEAYAGFATRNKMSLAQLNQL 135

Query: 124 LDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTV 183
           +++ G+  +HFK+Y+ +Q  W  +V   F       E E      K           R  
Sbjct: 136 MNQSGVTPDHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKDGGKKPVATEYRLQ 195

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLH 243
                    +    +  + K    +     ++C+   + A  I DV++     ++E  L 
Sbjct: 196 QVIFVVPASKRSPALLAKRKQEANALRSRFQNCDATRQQAKGILDVTVRDLGRIIEQQLP 255

Query: 244 PQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ------NTPTK 296
            ++ + +   S   TT P  T+KGVE++A+C  R +  +   +   S +          K
Sbjct: 256 NEWSKAIKSTSVGGTTPPQETEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKK 315

Query: 297 IEKHEAEYVKKLRSNAII 314
            E+   +Y+ +LR  A I
Sbjct: 316 AEQLSEKYLGELREKAKI 333


>gi|307249622|ref|ZP_07531608.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306858320|gb|EFM90390.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
          Length = 316

 Score =  126 bits (315), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 46/316 (14%), Positives = 105/316 (33%), Gaps = 15/316 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +KL++   +L+       +S  + A+  R+   ++G  + +  + +    L  +  +   
Sbjct: 1   MKLISAKSLLVALVTAIGISQTATAIEERVVALVDGVPVMESQVQRA---LGKKANSEAN 57

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            K A++++I + L ++ ++++G+  +   V+      A   G++       LD QGI   
Sbjct: 58  HKAALEQIIDDLLVQKAVKEAGVKVNYAKVDQVIEDIAARNGITYGQLLDALDYQGITLE 117

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVRE--------YLIRTVL 184
            ++Q +A Q     V              ++ A  +++                  R   
Sbjct: 118 QYRQQIAQQMAMEQVRHISIGKSIQVDPKDVHAYAKELLEKDKANGKLKNVTGVQHRVSH 177

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK--FASKIHDVSIGKAQYLLESDL 242
             I    + N    + ++               +  K      +     G   Y      
Sbjct: 178 ILIKTTPVLNDIQAKAKLAQIVADIKAGKTTFEEAAKANSVDYLSAADGGDLGYNFLDIY 237

Query: 243 HPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKH 300
            P F +      Q   T P+ +Q G   + +   +               Q    + ++ 
Sbjct: 238 DPAFAKAASTAKQEQITAPFKSQFGWHILKVTGTQQGDRTEDAYNQRAYEQLVDKQAQEA 297

Query: 301 EAEYVKKLRSNAIIHY 316
             ++VK LR  A + Y
Sbjct: 298 AKDWVKALRKTADVQY 313


>gi|34499685|ref|NP_903900.1| survival protein surA [Chromobacterium violaceum ATCC 12472]
 gi|81711632|sp|Q7NQB0|SURA_CHRVO RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|34105536|gb|AAQ61890.1| survival protein surA precursor [Chromobacterium violaceum ATCC
           12472]
          Length = 429

 Score =  126 bits (315), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 45/314 (14%), Positives = 109/314 (34%), Gaps = 15/314 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMS-SRIRTTINGEVITDGDISKRIALLKLQK---- 67
           +K      ++       + +  +      RI   +N  VIT  ++  R+     Q     
Sbjct: 1   MKKTLLALLIASVMQSALAAPATPVREVDRIVAVVNKNVITWQELQARVNEAIKQLEAQK 60

Query: 68  ----INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSF 123
                   LE+  ++++I E ++ Q     G+  +   V+      A+   LS     + 
Sbjct: 61  VAPPPREVLERQVLEQMITEEVQLQYAASGGLRIEDAAVDQAVANLAKQNKLSEAGLKAQ 120

Query: 124 LDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTV 183
           L K GI  +  +  +  +     +  ++   +    + E+    +  ++    EY + ++
Sbjct: 121 LAKDGITLDRLRADIRRELTISRLRDSEVASRVNVSDSEVDQAMKSAQSANRTEYHLASI 180

Query: 184 LFSIPDNKLQNQG-FVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDL 242
           L ++P+     Q   + +++  A+               ++   + +  G   +   + L
Sbjct: 181 LVAVPERADAKQIDQLSQKVHKAQADLAAGQPFAKVSAAYSDAPNALKGGDMGWRSATSL 240

Query: 243 HPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKI 297
             +F Q L +      T+   TQ+G     + DKR     +  E     ++  +      
Sbjct: 241 PQEFVQLLEQMKVGADTDVIRTQQGFFIFKLVDKRSGGAPMMVEQYHPRHILIRTNEAVS 300

Query: 298 EKHEAEYVKKLRSN 311
           E      + ++R  
Sbjct: 301 EADAKARIDQVRDR 314



 Score =  107 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 34/286 (11%), Positives = 87/286 (30%), Gaps = 19/286 (6%)

Query: 40  SRIRTTINGEVITDGDISKRIALLKLQKING--------ELEKIAVQELIVETLKKQEIE 91
           S + + +N   ++D ++ + +   +               + + A  + I +  +K    
Sbjct: 147 SEVASRVN---VSDSEVDQAMKSAQSANRTEYHLASILVAVPERADAKQIDQLSQKVHKA 203

Query: 92  KSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
           ++ +                   L   D           +              DV++  
Sbjct: 204 QADLAAGQPFAKVSAAYSDAPNALKGGDMGWRSATSLPQEFVQLLEQMKVGADTDVIRTQ 263

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
                           ++     +           I  N+  ++   + RI    +  +R
Sbjct: 264 QGFFI------FKLVDKRSGGAPMMVEQYHPRHILIRTNEAVSEADAKARIDQVRDRIMR 317

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYI 270
             K  +  + ++    +   G   ++   DL P+F+  +        + P  T  G   I
Sbjct: 318 GAKFADMAKLYSEDGSNAKGGDLGWVNMGDLVPEFEKAMVSLPIGQVSQPVRTPFGWHLI 377

Query: 271 AICDKRDLGGEIALKA-YLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            +  KR+       +   +  Q    K+E+   ++V++LR +A + 
Sbjct: 378 LVEGKRNQDVSSDHEKMAVKQQIRARKMEQAYTDWVRQLRDSAFVE 423


>gi|261364046|ref|ZP_05976929.1| SurA/PPIASE domain protein [Neisseria mucosa ATCC 25996]
 gi|288568080|gb|EFC89640.1| SurA/PPIASE domain protein [Neisseria mucosa ATCC 25996]
          Length = 328

 Score =  126 bits (315), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 40/286 (13%), Positives = 79/286 (27%), Gaps = 17/286 (5%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLK------LQKINGELEKIAVQELIVETLKKQEIEK 92
           S  I    + EVIT   +++ +   +       Q  + EL +  + +LI ++L  Q  ++
Sbjct: 51  SDGIAAIADNEVITRRQLAQAVERARRTIPKGTQIGDNELREQVLAQLINQSLIVQAGKR 110

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
                +    N                 +S   +        K           V   + 
Sbjct: 111 ----KNIQADNAEIEAVIAANPSLKTPSASIRREIADSIIAEKVRQQAVMQHSRVSDAEV 166

Query: 153 MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRL 212
                    E    +                   I  +        +  I+         
Sbjct: 167 ARAI-----EQAKQQGIALPEGEPLRQYNAQHILIKADNENAAAGAESTIRKIYAQARSG 221

Query: 213 PKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIA 271
                   +++      S G   +  +  + P F+  + K      + P  TQ G   I 
Sbjct: 222 ADFAGLARQYSQDGSASSGGNLGWFADGMMVPPFEEAVHKLKPGQVSPPVRTQFGWHIIK 281

Query: 272 ICDKRDLGGEIALK-AYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           + D RD G     +   +    +  K E+ E   +++L   A I  
Sbjct: 282 LNDVRDAGTPEERQHNTIRQYLSRQKAEQAEINLLRELHEGAHIDI 327


>gi|186475166|ref|YP_001856636.1| SurA domain-containing protein [Burkholderia phymatum STM815]
 gi|184191625|gb|ACC69590.1| SurA domain protein [Burkholderia phymatum STM815]
          Length = 463

 Score =  126 bits (315), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 44/321 (13%), Positives = 103/321 (32%), Gaps = 25/321 (7%)

Query: 18  TYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING------- 70
           +  +        +    S      I   +N  VIT  ++  R+ L+  +           
Sbjct: 21  SILLAGPAHAQALNGSGSAQTVDTIAAVVNNGVITQRELDMRVGLITKRLNQQHAPIPPA 80

Query: 71  -ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
            +L +  + ++++E ++ Q+  + GIT D  TV     + A+   L  + + + ++ QG+
Sbjct: 81  DQLRQQVLNQMVLERIQLQKAREDGITVDDATVQRTLERLAQANNLQLDMYRARIEAQGV 140

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNIT----VREYLIRTVLF 185
               F      + I   + + +   K    + E+       +  T       +L    L 
Sbjct: 141 PWTTFMGDAKTELILSRLREKEVDSKVTVSDAEVANYIASQRGPTAGLASDLHLEHIFLK 200

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ 245
           +  +    +    Q +     +  L+        +  +        G   +   S L  +
Sbjct: 201 APLNASQTDIEAAQAKANALLQEALKGDNFGKLAKSNSQAPDASKGGDLGFQAPSRLPAE 260

Query: 246 FQNLLKKSQNNTTNP--YVTQKGVEYIAICDKRDLGGEIALK---------AYLSAQNTP 294
           F       +    NP    T  G E + + ++R   G  +            ++  +   
Sbjct: 261 FVTAAATLRPGQVNPSVIRTNDGFEIVRLVERRSGQGSASADSTKLVQTHVRHILLRVGD 320

Query: 295 TKIEKHEAEYVKKLRSNAIIH 315
              E    + + ++R    I 
Sbjct: 321 GMSEPQARQKLLEIRQE--IE 339



 Score =  102 bits (252), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 19/139 (13%), Positives = 49/139 (35%), Gaps = 2/139 (1%)

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLE 239
               +     + +      QK ++  +E              ++        G   ++  
Sbjct: 310 HVRHILLRVGDGMSEPQARQKLLEIRQEIEAGQGDFDKFARTYSQDGSASQGGDLGWISP 369

Query: 240 SDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-AYLSAQNTPTKI 297
            +  P+F+  +     N  + P  ++ G   I +  +R+  G ++ +           K 
Sbjct: 370 GETVPEFERAMNSLQDNQISQPVRSEYGYHLIQVLGRREAEGSVSQQMDLARQAIGQRKA 429

Query: 298 EKHEAEYVKKLRSNAIIHY 316
           E+  A+++++LR  A + Y
Sbjct: 430 EQAYADWLRELRDTAYVDY 448


>gi|307132630|ref|YP_003884646.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Dickeya dadantii
           3937]
 gi|306530159|gb|ADN00090.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Dickeya dadantii
           3937]
          Length = 430

 Score =  126 bits (315), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 37/309 (11%), Positives = 105/309 (33%), Gaps = 16/309 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   +   +++ +    ++I   ++  V+ + DI+  +  +KL              L
Sbjct: 7   LVLGLALSANMAFAAPQEVNKIAAVVDNSVVLESDINSLLQSVKLNAQEAGQQLPDDATL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ +  Q  +K G+      ++      A    +S +   S L  +G+  +
Sbjct: 67  RHQILERLIMDNIILQMAQKMGVQVTDEQLDRSIANIAAQNRMSVDQLRSRLAAEGVSFD 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            ++  +    I  +V  ++   +   L  E+ +  Q++ +       +      IP  + 
Sbjct: 127 TYRSQIRKDMIIAEVRNSEVRRRVTVLPQEVDSLAQQIASQGASGPEVNLSQILIPLPEN 186

Query: 193 QNQGFVQKRIKDAE---ESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
             Q  V K    A    +   +          +++    +  G+  +    +L   F + 
Sbjct: 187 PTQDQVDKAESLANRLVKEASQGADFGKLAITYSADPQALKGGQMGWGRPQELPSLFAER 246

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKHEAEY 304
           L    +     P  +  G   + + D R     +        ++  + +    +      
Sbjct: 247 LTNPQKGQVIGPIRSGVGFHILRVNDTRGGDQSVSVTEVHARHILLRTSVVMNDAQARAR 306

Query: 305 VKKLRSNAI 313
           ++ + S   
Sbjct: 307 LEDIASQIK 315



 Score = 85.1 bits (208), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 35/309 (11%), Positives = 86/309 (27%), Gaps = 26/309 (8%)

Query: 28  VPIVSYKSWAMSSRIRTTI-NGEV-----ITDGDISKRIALLKLQKINGELEKIAVQELI 81
           V   +Y+S      I   + N EV     +   ++      +  Q  +G         L 
Sbjct: 123 VSFDTYRSQIRKDMIIAEVRNSEVRRRVTVLPQEVDSLAQQIASQGASGPEVN-----LS 177

Query: 82  VETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQ 141
              +   E         + ++    V+ A       +   ++             +   Q
Sbjct: 178 QILIPLPENPTQDQVDKAESLANRLVKEASQGADFGKLAITYSADPQALKGGQMGWGRPQ 237

Query: 142 SIWPDVVKND-----------FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
            +     +                  G   + +   +   ++++V E   R +L      
Sbjct: 238 ELPSLFAERLTNPQKGQVIGPIRSGVGFHILRVNDTRGGDQSVSVTEVHARHILLRTSVV 297

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL 249
               Q   +     ++    +L    N  ++ +         G   +       P F++ 
Sbjct: 298 MNDAQARARLEDIASQIKSGKLSFT-NAAKQLSQDPGTANQGGDLGWSSPDMYDPSFRDA 356

Query: 250 -LKKSQNNTTNPYVTQKGVEYIAICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKK 307
             +  +   + P  +  G   I + D R +   + A K          K  +    ++++
Sbjct: 357 LTQLKKGEISAPVHSSFGWHLIQLLDTRQVDKTDAAQKDRAYRMLFNRKFAEEAQTWMQE 416

Query: 308 LRSNAIIHY 316
            R+ A +  
Sbjct: 417 KRAAAYVKI 425


>gi|209693973|ref|YP_002261901.1| chaperone SurA precursor [Aliivibrio salmonicida LFI1238]
 gi|208007924|emb|CAQ78055.1| chaperone SurA precursor [Aliivibrio salmonicida LFI1238]
          Length = 436

 Score =  126 bits (315), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 35/317 (11%), Positives = 107/317 (33%), Gaps = 16/317 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +K     F+  +  ++ I  + +     R+   ++  V+   DI   +  +K+       
Sbjct: 1   MKNWKIPFISSLLLMLTINVHAAPVELDRVIAIVDEGVVLQSDIETSLKTVKINAQEKGQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++T++ Q+ EK GI  D   +       A++  ++        
Sbjct: 61  PLPEENVLREQVLEKLILDTIQSQQAEKMGIRIDDTRLEEALNNIAKDNKMTLAQLQQKA 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
             QG+    F++ +  +    +        +   L  E+ +    +   T      +   
Sbjct: 121 ASQGLAYADFREQIRKEIAASEARNAQVRRRINILPQEVESLALLLSEETQATVQYKISH 180

Query: 185 FSIPDN--KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDL 242
             +  +      +  ++K+  +  E   +          ++     +  G   ++ + ++
Sbjct: 181 IQLRTDGATQAEKEALEKQALELTERLKQGADFATMAYTYSKGPKALQGGDWGWMRKEEM 240

Query: 243 HPQFQNLLKKSQN-NTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIE 298
              F + +      +   P+ +  G   I I D +    +        ++  + +    +
Sbjct: 241 PTIFADQITGQGKSSIIGPFRSGVGFHIIKIDDVKGLETVAVTEVNARHILVKTSVIMSD 300

Query: 299 KHEAEYVKKLRSNAIIH 315
           +     + ++   + I 
Sbjct: 301 EGAERLLNQI--TSDIE 315



 Score = 73.2 bits (177), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 14/142 (9%), Positives = 46/142 (32%), Gaps = 4/142 (2%)

Query: 178 YLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQY 236
              R +L                  +   +            ++++       + G+  +
Sbjct: 285 VNARHILVKTSVIMSDEGAER-LLNQITSDIESGKETFAAMAQRYSQDPGSAAANGELGF 343

Query: 237 LLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTP 294
                  P+F++ ++       + P+ T  G     + ++R +   + A+K         
Sbjct: 344 QTPDLYVPEFKHQVEILPVGQISKPFKTVHGWHIAEVLERRQVDRTDAAMKNKAYRILMN 403

Query: 295 TKIEKHEAEYVKKLRSNAIIHY 316
            K  +    +++++R++A +  
Sbjct: 404 RKFNEESGAWLQEIRASAYVEI 425


>gi|260775523|ref|ZP_05884420.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio coralliilyticus
           ATCC BAA-450]
 gi|260608704|gb|EEX34869.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio coralliilyticus
           ATCC BAA-450]
          Length = 431

 Score =  126 bits (315), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 34/313 (10%), Positives = 109/313 (34%), Gaps = 12/313 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +KL     + +I                ++   +N  V+   DI   +  ++        
Sbjct: 1   MKLWKQTLLGLIAASQLSFVQAEPVELDKVAVIVNSGVVLQSDIETSLKTIRANAKKNNQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +   ++LIV+T+++QE E+ G+  D N +N    + A+N   + +  ++ +
Sbjct: 61  SLPDEATLREQVTEKLIVDTIQQQEAERIGVRIDDNRLNEAIDEIAKNNNQTLQQLNTSI 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            ++G+    F++ +  +    +        +   L  E+      +   T      +   
Sbjct: 121 AEEGLSYAQFREQVRKEIAANEARNALVRRRINILPAEVDNLANILAKETNATVQYKIGH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +  N   ++  ++++     +   +          ++     +  G   ++ + ++  
Sbjct: 181 IQLRVNDGDDKAAIEEKANQIVKELNQGSDFSTMAYTYSKGPKALQGGDWGWMRKEEMPT 240

Query: 245 QFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F + +  +++ +   P+ +  G   + I D +    +        ++  + T    ++ 
Sbjct: 241 IFADQINLQNKGSIIGPFRSGVGFHILKIEDVKGLETVAVTEVNARHILIKPTVILSDEG 300

Query: 301 EAEYVKKLRSNAI 313
             + +  +     
Sbjct: 301 VQKELLDITRRIQ 313



 Score = 75.5 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 33/269 (12%), Positives = 78/269 (28%), Gaps = 4/269 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     +L  +       KI   +L V     +   +         +N       
Sbjct: 154 ILPAEVDNLANILAKETNATVQYKIGHIQLRVNDGDDKAAIEEKANQIVKELNQGSDFST 213

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +        +   I   +   
Sbjct: 214 MAYTYSKGPKALQGGDWGWMRKEEMPTIFADQINLQNKGSIIGPFRSGVGFHILKIEDVK 273

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK-LEKFASKI-HD 228
              TV    +      I    + +   VQK + D             +  ++++      
Sbjct: 274 GLETVAVTEVNARHILIKPTVILSDEGVQKELLDITRRIQSGKATFAEMAQQYSQDPGSA 333

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  Y       P+F++ +        + P+ T  G   + + D+R++   + ALK 
Sbjct: 334 AQQGELGYQTSDLYVPEFKHQVDTLPVGQISEPFKTVHGWHIVEVMDRREVDRTDSALKN 393

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
                    K  +  + +++++R++A + 
Sbjct: 394 KAYRIIFNRKFNEEASAWLQEIRASAFVE 422


>gi|78222152|ref|YP_383899.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter
           metallireducens GS-15]
 gi|78193407|gb|ABB31174.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter
           metallireducens GS-15]
          Length = 330

 Score =  126 bits (315), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 44/327 (13%), Positives = 104/327 (31%), Gaps = 17/327 (5%)

Query: 5   VFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK 64
           +  + S    L     +  +  +   VS      + ++   +NG  I +  +   +A L 
Sbjct: 1   MRLNRSLTFGLFLLGVMFTLHLLQTPVSADEVNKTGKVVARVNGVPIYENALQSHLAALA 60

Query: 65  LQKI-----------NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNT 113
            +             N   +K A+  LI   L +Q   +  +T     V+    +     
Sbjct: 61  NKGRASGFARDPAKMNDYQKKKALYSLIDAELLRQASNQQQVTDLDAKVSKRLQEVKGKF 120

Query: 114 GLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNI 173
                   +   + G   + F   L     + + + +  ++     + EI    +     
Sbjct: 121 PDEEAFLKNLQAR-GKTLDIFVAELRDGIRYDEYLTSKKVIGVPVPDEEIQKFYRDNPTS 179

Query: 174 T--VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI 231
                +  +R +L     +  +     +K+  +     +R        ++ ++     S 
Sbjct: 180 FSVPEQIKVRHILIEPDGSTAEAVAKAEKKAGEIRNRVVRDKDFAAVAKEVSACSTASSG 239

Query: 232 GKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLG--GEIALKAYL 288
           G   Y+    +  +F +       N  + P  T+ G   + + DK+ +       ++ ++
Sbjct: 240 GDLGYVSRGTMPAEFDKVAFSLKLNEVSEPVRTKFGFHIMEVLDKKPVTVRPYSEVREFI 299

Query: 289 SAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           S        EK    +  +LR  A I 
Sbjct: 300 SRYLQRFDDEKRLNAHTLELRKKATIE 326


>gi|170699177|ref|ZP_02890230.1| SurA domain [Burkholderia ambifaria IOP40-10]
 gi|170135902|gb|EDT04177.1| SurA  domain [Burkholderia ambifaria IOP40-10]
          Length = 452

 Score =  126 bits (315), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 40/299 (13%), Positives = 100/299 (33%), Gaps = 22/299 (7%)

Query: 35  SWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVETLK 86
              ++  +   +N +VIT  ++ +R+ L+  +             L    + ++++E ++
Sbjct: 35  GAQLADEVVAVVNNDVITGRELDQRVGLIARRLQQQNAPVPPADQLRAQVLNQMVLERIQ 94

Query: 87  KQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPD 146
            Q+ +  GI  D  TV     + A+  G++ E + + L+ QG+  + F      + +   
Sbjct: 95  VQKAKDDGIRIDDATVQSTLQRLAQANGMTLEQYRARLEAQGVPWSVFTSDARTELMLSK 154

Query: 147 VVKNDFMLKYGNLEMEIPANKQKMK----NITVREYLIRTVLFSIPDNKLQNQGFVQKRI 202
           + + +   K    + E+       +    +           + +  +         QK+ 
Sbjct: 155 LREREVDGKITVSDAEVVNYIASQRGPSASQQQDLRFQHIFIKAPTNAPQAEIEVAQKKA 214

Query: 203 KDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNP-- 260
           +   +            +  +        G   +     L P+  +   K +    NP  
Sbjct: 215 EALLQQATFGADFEKLAKNNSEANDAKKGGDLGFKAPGALPPEVVDAASKLRPGQVNPTL 274

Query: 261 YVTQKGVEYIAICDKRDLGGEIALK--------AYLSAQNTPTKIEKHEAEYVKKLRSN 311
                G E + + D+R   G  A           ++  +    K E    + ++ +R  
Sbjct: 275 IRVPDGFEIVRLVDRRQSQGTSAAAPKIVQTHVRHILLRVGEGKSEGQARQQLQDIRRQ 333



 Score =  108 bits (270), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 31/287 (10%), Positives = 91/287 (31%), Gaps = 19/287 (6%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           ++G+ IT  D ++ +  +  Q+     ++  +       +K            +      
Sbjct: 160 VDGK-ITVSD-AEVVNYIASQRGPSASQQQDL-RFQHIFIKAPTNAPQAEIEVAQKKAEA 216

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN--------------D 151
            +Q A       +   +  +           + A  ++ P+VV                 
Sbjct: 217 LLQQATFGADFEKLAKNNSEANDAKKGGDLGFKAPGALPPEVVDAASKLRPGQVNPTLIR 276

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
               +  + +      Q       +          +   + +++G  +++++D       
Sbjct: 277 VPDGFEIVRLVDRRQSQGTSAAAPKIVQTHVRHILLRVGEGKSEGQARQQLQDIRRQVEA 336

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYI 270
                     ++        G   ++   +  P+F+  +        + P  T+ G   I
Sbjct: 337 GGDFAKFARTYSQDGSASQGGDLGWISPGETVPEFERAMNNLQDGQISQPVRTEYGYHLI 396

Query: 271 AICDKRDLGGEIALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            + D+R+  G +  +  +        K E+  A+++++LR ++ + Y
Sbjct: 397 QVIDRRESEGSVQQQMDIARQAIGQRKAEQAYADWLRELRDSSYVQY 443


>gi|303245475|ref|ZP_07331759.1| SurA domain protein [Desulfovibrio fructosovorans JJ]
 gi|302493324|gb|EFL53186.1| SurA domain protein [Desulfovibrio fructosovorans JJ]
          Length = 339

 Score =  125 bits (314), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 45/305 (14%), Positives = 102/305 (33%), Gaps = 25/305 (8%)

Query: 35  SWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN----------GELEKIAVQELIVET 84
           +  +  R+   +NG++IT  D+  R+A L  +              EL +  ++ +I + 
Sbjct: 33  ATQLVDRVVAVVNGKLITLFDLDSRVAELVQRTQGISFAPGDPRAEELRRQVLESMINDI 92

Query: 85  LKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIW 144
           L +QE  +  I      ++    +  +   L+   F + L K+G+    F++ +   ++ 
Sbjct: 93  LIEQEAARLKINVSETELDSQIDELKKKNNLTQAQFQAELAKEGLTLKEFRKRMREDNMK 152

Query: 145 PDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKD 204
             ++      K    + EI    +K K        I     S   + +      ++  + 
Sbjct: 153 KRLLGFMVHRKVLVTDDEIRDYYEKHKATLSTTKSILGPKVSGNISFIMVP-TKKQAEEL 211

Query: 205 AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDL-HPQFQNLLKKSQNNTTNPYVT 263
            ++         +   KF+        G    +   DL  P    L        + P + 
Sbjct: 212 RQKIGAGTITFADAARKFSIGPGRDQGGDLGDVQVKDLAPPLRDALTAVPAGQVSQPVML 271

Query: 264 QKGVEYIAICDKRDL-------------GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRS 310
                 + +   ++                  +++  +       K +K   +Y+  LRS
Sbjct: 272 DGKAVLLKLRTGKNAAPAKTPQPAPSAGPSFESVRNQIQEMLYKQKFDKLFQDYMDNLRS 331

Query: 311 NAIIH 315
            A+I 
Sbjct: 332 KAVIE 336


>gi|323524758|ref|YP_004226911.1| SurA domain-containing protein [Burkholderia sp. CCGE1001]
 gi|323381760|gb|ADX53851.1| SurA domain protein [Burkholderia sp. CCGE1001]
          Length = 468

 Score =  125 bits (314), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 43/316 (13%), Positives = 101/316 (31%), Gaps = 22/316 (6%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE-------- 71
           FV +       ++         I   +N  VIT  ++ +R+ L+  +             
Sbjct: 37  FVSVAPVQAQALAGNRGQTVDTIAAVVNNGVITRRELDERVNLITRRLNQQNAPIPPADQ 96

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L +  + ++++E ++ Q+ ++ GI  D   V     + A+   LS + + + ++ QG+  
Sbjct: 97  LRQQVLNQMVLERIQLQKAKEDGINVDDAAVQKTLERLAQANNLSLDVYRARIEAQGVPW 156

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN----KQKMKNITVREYLIRTVLFSI 187
             F      +     + + +   K    + E+       +      T   ++    L + 
Sbjct: 157 ATFTSDARTELTLSRLREKEVDSKVTVSDAEVANYIASQRGPNAGATSDLHMEHIFLKAP 216

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
            +    +    QK+ +                +  +        G   Y   S L P+F 
Sbjct: 217 LNAPQTDIEAAQKKAEALLAEAKGGANFGKLAKSNSQAPDAAKGGDMGYAAPSKLPPEFV 276

Query: 248 NLLKKSQNNTTNP--YVTQKGVEYIAICDKRDLGGE--------IALKAYLSAQNTPTKI 297
                 +    NP    T  G E + + D+R   G              ++  +      
Sbjct: 277 KAASALRPGEVNPEVIRTNDGFEVVRLVDRRAGQGTSSDAPKLVQTHVRHILLRVGDGMS 336

Query: 298 EKHEAEYVKKLRSNAI 313
           E    + + +++    
Sbjct: 337 EPQARQKLLEIKKEIQ 352



 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 16/145 (11%), Positives = 51/145 (35%), Gaps = 2/145 (1%)

Query: 173 ITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIG 232
              +          +      ++   ++++ + ++              ++        G
Sbjct: 315 DAPKLVQTHVRHILLRVGDGMSEPQARQKLLEIKKEIQAGGDFAKFAHTYSQDGSSSQGG 374

Query: 233 KAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-AYLSA 290
              ++   +  P+F+  +        ++P  ++ G   I + ++R+  G IA +      
Sbjct: 375 DLGWISPGETVPEFERAMNTLQDGQISDPVRSEYGYHLIQVLERREAQGSIAQQMDLARQ 434

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIH 315
                K E+  A+++++LR  A + 
Sbjct: 435 AIGQRKAEQAYADWLRELRDTAYVE 459


>gi|94266120|ref|ZP_01289835.1| PpiC-type peptidyl-prolyl cis-trans isomerase [delta
           proteobacterium MLMS-1]
 gi|93453317|gb|EAT03757.1| PpiC-type peptidyl-prolyl cis-trans isomerase [delta
           proteobacterium MLMS-1]
          Length = 335

 Score =  125 bits (314), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 41/294 (13%), Positives = 108/294 (36%), Gaps = 19/294 (6%)

Query: 40  SRIRTTINGEVITDGDISKRIALLKLQKING-----------ELEKIAVQELIVETLKKQ 88
            R+   +NGE+IT  ++ + +A ++ Q +             E  +  +  +I   L +Q
Sbjct: 38  DRVVAEVNGEIITMSELEREMAGVEQQVLQQAPAADREQALTEARQQVLSGMIDRLLARQ 97

Query: 89  EIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVV 148
           + ++ GI      V+    Q   +  ++ E+  + + +      ++++ L  Q +   ++
Sbjct: 98  QADRLGIRVGEREVDEAIAQILADNRITMEELEAEIARHHGSMENYRRDLQTQILQSRLL 157

Query: 149 KNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEES 208
             +   +    E  I    Q+             +L    +    +    ++  + AEE 
Sbjct: 158 SQEVRERVVIPERRIKEYYQQHHQEQTSPEEAYHILQIGFNWPPGDDEAREQARRQAEEI 217

Query: 209 RLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQ 264
             +  +  +      +++      + G      + +L     +++ +      +    T 
Sbjct: 218 HRQARQGADFRELARRYSDLPSARNDGDLGVFQKDELAGIMLEHIPELEPGEISTILETA 277

Query: 265 KGVEYIAIC----DKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
            G ++  +     + R  G    LK  +  +     +E+  +++VK+LR N  I
Sbjct: 278 AGYQFFKLLSNQGELRATGSYEELKGKIREKLYQQALEEQFSKWVKELRENDYI 331


>gi|219870954|ref|YP_002475329.1| peptidyl-prolyl cis-trans isomerase SurA [Haemophilus parasuis
           SH0165]
 gi|219691158|gb|ACL32381.1| peptidyl-prolyl cis-trans isomerase SurA [Haemophilus parasuis
           SH0165]
          Length = 312

 Score =  125 bits (314), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 53/315 (16%), Positives = 110/315 (34%), Gaps = 15/315 (4%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEK 74
           +  T    +      + ++ S     R+  T++G  I    + +    L  +       K
Sbjct: 1   MKFTQVKSLFIAGFALFAFSSANAEERVVATVDGYPIMQSQVKQA---LGKKANTEANRK 57

Query: 75  IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF 134
            A++ +I + + ++ I++SGI  D   V+      A   G++       LD QGI  + +
Sbjct: 58  AALETIIDDFVVQRAIKESGIKVDYAYVDQMMEDVAAQNGITYGQLLDALDYQGISLSQY 117

Query: 135 KQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVRE----------YLIRTVL 184
           +Q LA Q +   V +            ++ +  + M +               Y I  +L
Sbjct: 118 RQQLAHQLLMEQVRQQSIGNSIQVDPKDVQSLAKDMLDKAKTNGTLETVSATEYRISHIL 177

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
                     Q   +     A+    ++  +          I  +  G   +        
Sbjct: 178 IKTTPILNDMQAKAKLLSITADIKSGKITFEEAAKINSVDYISGIDGGDLGFNFLDAYDS 237

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICD-KRDLGGEIALKAYLSAQNTPTKIEKHEA 302
            F N+  K   +  ++P+ +Q G   + + D +R    E A       Q    +++    
Sbjct: 238 TFANIASKSKIDVISSPFKSQFGWHILKVTDTRRGDRTEDAYLQKAYEQLIDKQVQVASK 297

Query: 303 EYVKKLRSNAIIHYY 317
           +++K LRS   I Y+
Sbjct: 298 DWIKVLRSKLDIKYF 312


>gi|270263924|ref|ZP_06192192.1| chaperone SurA, precursor [Serratia odorifera 4Rx13]
 gi|270042117|gb|EFA15213.1| chaperone SurA, precursor [Serratia odorifera 4Rx13]
          Length = 432

 Score =  125 bits (314), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 34/309 (11%), Positives = 105/309 (33%), Gaps = 16/309 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   +    ++ +     ++   ++  V+ + D++  +  +KL              L
Sbjct: 7   LILGLVVCANTAFAAPQEVDKVAAVVDNGVVLESDVNSLLQSVKLNAQQAGQQLPDDATL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ ++ Q  +K GI      ++      A    +S +   S L  +G+  N
Sbjct: 67  RHQILERLIMDNIQLQMAKKMGIAVSDADLDKAIGNIAAQNKMSIDQMRSRLAYEGLNYN 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            ++  +  + +  +V  N+   +   L  E+ A  +++      +  +      IP  + 
Sbjct: 127 TYRSQIRKEMLISEVRNNEVRRRVTILPQEVDALAKQVGAQNGSDTEMNISHILIPLPEN 186

Query: 193 QNQGFVQKRIKDAEES---RLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +Q  V +    A++                 +++    +  G   +    ++   F + 
Sbjct: 187 PSQQQVDEAEALAKKLMGEINGGADFGKLAISYSADSQALKGGNMGWGKLQEIPTLFAER 246

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKHEAEY 304
           L    + +   P  +  G   + + D R     +        ++  + +    +      
Sbjct: 247 LASAKKGDVVGPIRSGVGFHILKVNDIRGANQSVSVTEVHARHILLKPSVVLTDDQARAK 306

Query: 305 VKKLRSNAI 313
           ++ +     
Sbjct: 307 LQAVAEAIK 315



 Score = 87.0 bits (213), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 36/285 (12%), Positives = 84/285 (29%), Gaps = 17/285 (5%)

Query: 47  NGEV-----ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNT 101
           N EV     I   ++      +  Q  +     I+   LI       + +       +  
Sbjct: 143 NNEVRRRVTILPQEVDALAKQVGAQNGSDTEMNIS-HILIPLPENPSQQQVDEAEALAKK 201

Query: 102 VNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND-------FML 154
           +       A    L+    +     +G      K           +              
Sbjct: 202 LMGEINGGADFGKLAISYSADSQALKGGNMGWGKLQEIPTLFAERLASAKKGDVVGPIRS 261

Query: 155 KYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
             G   +++   +   ++++V E   R +L         +Q    K    AE  +    K
Sbjct: 262 GVGFHILKVNDIRGANQSVSVTEVHARHILLKPSVVLTDDQA-RAKLQAVAEAIKSGNAK 320

Query: 215 DCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAI 272
             ++ ++ +      +  G   +       P F++  +K ++   + P  +  G   I +
Sbjct: 321 FADEAKQLSQDPGSALQGGDLGWASPDIYDPAFRDALMKLNKGEVSKPVHSSFGWHLIQL 380

Query: 273 CDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            D R +   + A K          K  +    ++++ R+ A +  
Sbjct: 381 LDTRQVDKTDAAQKDRAYRMLFNRKFAEEAQTWMQEQRAQAYVKI 425


>gi|293391019|ref|ZP_06635353.1| chaperone/peptidyl-prolyl cis-trans isomerase SurA [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951553|gb|EFE01672.1| chaperone/peptidyl-prolyl cis-trans isomerase SurA [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 310

 Score =  125 bits (314), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 41/314 (13%), Positives = 98/314 (31%), Gaps = 19/314 (6%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWA-MSSRIRTTINGEVITDGDISKRIALLKLQKINGELEK 74
           +      ++F  +      +      ++  T+NG  I +  +   I             +
Sbjct: 1   MKMNLKFVLFAAIGFFVLAAHVHAEEKVVATVNGIPILESQVQSAI------NKKTNDRQ 54

Query: 75  IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF 134
            A+ ++I + L  Q +++S +  ++  ++      A   GL+       LD QGI    +
Sbjct: 55  AALNKVIDDILVDQAVKESDVKVNNAQIDQIIEGIAAQNGLTFGQLLDALDYQGISYRAY 114

Query: 135 KQYLAIQSIWPDVVKNDFMLKYGNLEMEI---------PANKQKMKNITVREYLIRTVLF 185
           +Q +A Q +  +V  +           ++          A  +               + 
Sbjct: 115 RQQIAQQVMMSEVRNHAISQSVDVSREQVEALAKKMLDEAKAKGSVAQISDTQYEVRHIL 174

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQY-LLESDLH 243
              +  L +     +  +   +         +   K++       + G   Y   E  + 
Sbjct: 175 LKLNPLLNDAQAKAQLEQIRADIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPEMYVG 234

Query: 244 PQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKHEA 302
           P  Q +        + P+ T+ G   + + + R               Q    +++    
Sbjct: 235 PFNQAVRTTKPGVISAPFRTEFGWHILEVTNTRQADRTEDAYRQKAYEQIVNQQLQDSAR 294

Query: 303 EYVKKLRSNAIIHY 316
           ++V+ LR    I Y
Sbjct: 295 DWVQALRKRVDIKY 308


>gi|261400512|ref|ZP_05986637.1| SurA/PPIASE domain protein [Neisseria lactamica ATCC 23970]
 gi|269209772|gb|EEZ76227.1| SurA/PPIASE domain protein [Neisseria lactamica ATCC 23970]
          Length = 358

 Score =  125 bits (314), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 38/286 (13%), Positives = 78/286 (27%), Gaps = 17/286 (5%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKLQKIN------GELEKIAVQELIVETLKKQEIEK 92
           S  I    + EVIT   +++ +A  K            EL    + +L+ ++L  Q  ++
Sbjct: 81  SDGIAAVADNEVITRRRLAQAVADAKANLPKDVQIGDEELTGQVLMQLVNQSLIVQAGKR 140

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
                +           A          +    +        K           V + + 
Sbjct: 141 R----NIQASEAEIDAAAAQNPQLKHLSAEQRRELADSIIAEKVRQQAVMQNSRVSEAEV 196

Query: 153 MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRL 212
                    E    +             R     I  +        +  I+   +     
Sbjct: 197 DRFI-----EQAQKQGITLPEGEPLRQYRAQHILIKADGENAAVGAESTIRKIYDQARNG 251

Query: 213 PKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIA 271
                   +++      + G   +  +  +   F+  +        + P  TQ G   I 
Sbjct: 252 TDFSGLARQYSQDAGAGNGGDLGWFSDGVMVAPFEAAVHALKPGQVSAPVRTQFGWHIIK 311

Query: 272 ICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           + + RD    E  ++  +       K E+  AE ++ L S A I  
Sbjct: 312 LNEVRDAGTPEERIRNSVRQYIFQQKAEQATAELLRDLHSGAYIDI 357


>gi|226946688|ref|YP_002801761.1| peptidyl-prolyl cis-trans isomerase SurA [Azotobacter vinelandii
           DJ]
 gi|226721615|gb|ACO80786.1| Peptidyl-prolyl cis-trans isomerase SurA [Azotobacter vinelandii
           DJ]
          Length = 432

 Score =  125 bits (313), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 41/287 (14%), Positives = 100/287 (34%), Gaps = 15/287 (5%)

Query: 40  SRIRTTINGEVITDGDISKRIALLKL--------QKINGELEKIAVQELIVETLKKQEIE 91
            RI   I+ +V+    + +R+  ++              +L    ++ LI+E+++ Q   
Sbjct: 33  DRIVAIIDNDVVMQTQLDRRLREVEQTIAKRGAQLPPRDQLVSQVLERLILESIQLQMGS 92

Query: 92  KSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
           ++GI      +       A+  GL+ E F + L + G+  +  ++ +  + I   V +  
Sbjct: 93  RAGIRIGDEELAQAMATIAQRNGLTLEQFQAALARDGLSFDEAREQVRREMIISRVRQRV 152

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
              +    + E+                 R    +IP         +Q   +   E   +
Sbjct: 153 VADRIQISDHEVQNFLASDLGKLQLSEEFRLANITIPLPDGAPPEQIQAAEQQVLEIYRQ 212

Query: 212 LPKDCNKLE---KFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGV 267
           L    +  +     ++    +  G+  +   + L P F NL+ +      T P  T  G 
Sbjct: 213 LSDGADFAQLAITRSAGETALEGGEIGWRRAAQLPPPFDNLVSQLPVGGVTEPVRTPGGY 272

Query: 268 EYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
             I + +KR       +     ++  + +  + +      ++++   
Sbjct: 273 IIIKLLEKRGGSAQIRDEVHVRHILIKPSEIRTDIDARRLIERIHER 319



 Score = 91.3 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 16/138 (11%), Positives = 51/138 (36%), Gaps = 3/138 (2%)

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLE 239
                 I  ++++     ++ I+   E  L         + F+      ++ G   ++  
Sbjct: 292 HVRHILIKPSEIRTDIDARRLIERIHERILNGEDFAELAKSFSEDPGSALNGGDLNWIDP 351

Query: 240 SDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKI 297
           + L P+F+ ++ K+     + P+ +  G   + +  +R       ++           K 
Sbjct: 352 NALVPEFREMMAKTPAGELSPPFKSPFGWHVLEVLGRRATDSSTQVREQQAMNVLRNRKY 411

Query: 298 EKHEAEYVKKLRSNAIIH 315
           ++    +++++R  A + 
Sbjct: 412 DEELQSWLRQIRDEAYVE 429


>gi|238028597|ref|YP_002912828.1| Parvulin-like peptidyl-prolyl isomerase [Burkholderia glumae BGR1]
 gi|237877791|gb|ACR30124.1| Parvulin-like peptidyl-prolyl isomerase [Burkholderia glumae BGR1]
          Length = 451

 Score =  125 bits (313), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 39/334 (11%), Positives = 103/334 (30%), Gaps = 28/334 (8%)

Query: 6   FTSLSDFIKLLTTYFVLIIFCIVP-----IVSYKSWAMSSRIRTTINGEVITDGDISKRI 60
                 F  +++     +    V       +      ++  +   +N +VIT  ++ +R+
Sbjct: 1   MKKTLRFAAIVSGLVAAMSLLSVTPAVAQALGSNGATLADEVVAVVNNDVITGRELDQRV 60

Query: 61  ALLKLQKING--------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
            L+  +            EL    + ++++E ++ Q+ ++ GI  D   V     + A  
Sbjct: 61  DLIARRLRQQKAPVPPIDELRMQVLNQMVLERIQVQKAKEDGIVVDDAMVQATLQRLAAA 120

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN 172
             +S + + + L+ +G+  N F      + +   + + +   K    + E+ +     + 
Sbjct: 121 NNMSLDQYRARLEAEGVPWNIFVSDARTELMLSRLREKEVDSKITVSDAEVASYIASQRG 180

Query: 173 ITVREYLIRTVLFSIPDNKLQNQG-----FVQKRIKDAEESRLRLPKDCNKLEKFASKIH 227
                     +                    +K     +++           +  +    
Sbjct: 181 PNAGSQQDLRLEHIFVAAPQNAPETQIDAARKKAEGLLKQALAPGADFERLAKNNSEAKD 240

Query: 228 DVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNP--YVTQKGVEYIAICDKRDLGGEIALK 285
             S G   +     L       + + +    NP       G E + + D+R   G  A  
Sbjct: 241 AKSGGDLGFKPPGSLPADVVQAVAQLRPGQVNPALIRVPDGFEIVRLVDRRPAQGTSAAS 300

Query: 286 --------AYLSAQNTPTKIEKHEAEYVKKLRSN 311
                    ++  +    K E    + +  +R+ 
Sbjct: 301 PKIVQTHVRHILLRVGEGKSEAQARQQLIDIRNK 334



 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 19/168 (11%), Positives = 57/168 (33%), Gaps = 2/168 (1%)

Query: 151 DFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRL 210
                +  + +      Q     + +          +   + +++   ++++ D      
Sbjct: 277 RVPDGFEIVRLVDRRPAQGTSAASPKIVQTHVRHILLRVGEGKSEAQARQQLIDIRNKVE 336

Query: 211 RLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEY 269
                 +    ++        G   ++   +  P+F+  +        +NP  T+ G   
Sbjct: 337 AGGDFASFARTYSQDGSASQGGDLGWISPGETVPEFERAMNSLQDGQISNPVRTEYGYHL 396

Query: 270 IAICDKRDLGGEIALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           I +  +RD  G I  +  +        K E+  A+++++LR ++ +  
Sbjct: 397 IQVLGRRDAEGSIQQQMDIARQAIGQRKAEQAYADWLRELRDSSYVQI 444


>gi|134296902|ref|YP_001120637.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Burkholderia
           vietnamiensis G4]
 gi|134140059|gb|ABO55802.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Burkholderia
           vietnamiensis G4]
          Length = 452

 Score =  125 bits (313), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 41/302 (13%), Positives = 99/302 (32%), Gaps = 22/302 (7%)

Query: 32  SYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVE 83
             +   ++  +   +N +VIT  ++ +R+ L+  +             L    + ++++E
Sbjct: 32  GSQGAQLTDEVVAVVNNDVITGRELDQRVGLIARRLQQQNAPVPPAEQLRAQVLNQMVLE 91

Query: 84  TLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSI 143
            ++ Q+ +  GI  D  TV     + A+  G++ + + + L+ QG+  + F      + +
Sbjct: 92  RIQVQKAKDDGIRIDDATVQSTLQRLAQANGMTLDQYRARLEAQGVPWSVFTSDARTELM 151

Query: 144 WPDVVKNDFMLKYGNLEMEIPAN----KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQ 199
              + + +   K    + E+       +    +           + +  +    +    Q
Sbjct: 152 LSKLREREVDGKITVSDAEVANYIASQRGPNASQQQDLRFQHIFIKAPTNAPQADIEAAQ 211

Query: 200 KRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTN 259
           K+ +   +               +        G   +   S L P       K +    N
Sbjct: 212 KKAEALLQQATSGADFEKLARNNSEANDAKKGGDLGFKAPSTLPPDVVAAASKLRPGQVN 271

Query: 260 P--YVTQKGVEYIAICDKRDLGGEIALK--------AYLSAQNTPTKIEKHEAEYVKKLR 309
           P       G E I + D+R   G  A           ++  +    K E    + +  +R
Sbjct: 272 PTLIRVPDGFEIIRLVDRRQSQGASAAAPKIVQTHVRHILLRVGEGKSENQARQQLLDIR 331

Query: 310 SN 311
             
Sbjct: 332 KQ 333



 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/287 (10%), Positives = 90/287 (31%), Gaps = 19/287 (6%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           ++G+ IT  D ++    +  Q+     ++  +       +K            +      
Sbjct: 160 VDGK-ITVSD-AEVANYIASQRGPNASQQQDL-RFQHIFIKAPTNAPQADIEAAQKKAEA 216

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN--------------D 151
            +Q A +     +   +  +           + A  ++ PDVV                 
Sbjct: 217 LLQQATSGADFEKLARNNSEANDAKKGGDLGFKAPSTLPPDVVAAASKLRPGQVNPTLIR 276

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
               +  + +      Q       +          +   + +++   ++++ D  +    
Sbjct: 277 VPDGFEIIRLVDRRQSQGASAAAPKIVQTHVRHILLRVGEGKSENQARQQLLDIRKQVEA 336

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYI 270
                     ++        G   ++   +  P+F+  +        + P  T+ G   I
Sbjct: 337 GGDFAKFARTYSQDGSASQGGDLGWISPGETVPEFERAMNNLQDGQISQPVRTEYGYHLI 396

Query: 271 AICDKRDLGGEIALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            + D+R+  G +  +  +        K E+  A+++++LR ++ + Y
Sbjct: 397 QVIDRREAEGSVQQQMDIARQAIGQRKAEQAYADWLRELRDSSYVQY 443


>gi|148264947|ref|YP_001231653.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter
           uraniireducens Rf4]
 gi|146398447|gb|ABQ27080.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter
           uraniireducens Rf4]
          Length = 341

 Score =  125 bits (313), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 43/288 (14%), Positives = 93/288 (32%), Gaps = 16/288 (5%)

Query: 43  RTTINGEVITDGDISKRIALLKLQKIN---------GELEKIAVQELIVETLKKQEIEKS 93
              +N  +IT  D+ + + +L  Q             + E+ A+ +LI   L  Q  +K+
Sbjct: 53  VAKVNDTIITRLDLDRAVKVLVSQNRLPQPLPPESLKQAEEAALDQLISAELLYQAGQKT 112

Query: 94  GITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFM 153
            I      V     Q+      SA++F   L    + +   K++     +  + ++ +  
Sbjct: 113 EIRDLEKQVEEKVSQNKAKF-PSADEFEKALKSVEMTEKDLKEFTRKDVVISNFIEKNIA 171

Query: 154 LKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEES---RL 210
            K    E +         +   +E  ++                 +K  + AE       
Sbjct: 172 EKTKVTEADAKKFYDDNPDKFKQEPSVKASHILCGVEASATAEEKKKAKEKAEALLKKIK 231

Query: 211 RLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEY 269
                    +  ++       G   +  +  +   F+           ++   TQ G   
Sbjct: 232 AGEDFATLAKSESTCPSSKQGGDLGFFSKGQMVAPFEKAAFALKPGEVSDVVETQFGYHI 291

Query: 270 IAICDKRDLGG--EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           I + +K++ G      +K  +       KI+K   E + +L+  A I 
Sbjct: 292 IKLTEKKEGGTIKFDEVKEKIENYLKNLKIQKAIGECLVELKGKAKIE 339


>gi|225874673|ref|YP_002756132.1| peptidylprolyl cis-trans isomerase SurA, putative [Acidobacterium
           capsulatum ATCC 51196]
 gi|225793602|gb|ACO33692.1| peptidylprolyl cis-trans isomerase SurA, putative [Acidobacterium
           capsulatum ATCC 51196]
          Length = 588

 Score =  125 bits (313), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 47/296 (15%), Positives = 96/296 (32%), Gaps = 14/296 (4%)

Query: 35  SWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL--------EKIAVQELIVETLK 86
              +  +I   ++ +VI   D  +    LK Q     +        +K  ++ LI + L 
Sbjct: 57  PGTVVEQIVARVDDQVIDTSDYERAEQDLKQQAQQQNMSQAELDREKKDLLRNLIDQQLL 116

Query: 87  KQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPD 146
             + ++ GIT +   V        +N   S       ++ QG+    FKQ +    I   
Sbjct: 117 LAKGKQLGITGEDQLVERLDAIRKQNHLDSMTALQQAVESQGLSWQDFKQQIRNNIITQT 176

Query: 147 VVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTV---LFSIPDNKLQNQGFVQKRIK 203
           V++            EI     + K    R   +R     + +   +        +K+  
Sbjct: 177 VIRQKVAPTIRISPDEIQKYYDQHKKEFDRPEEVRLSEILIPTPNPDDAAQVAEAKKKAD 236

Query: 204 DAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYV 262
             E             +  ++       G      +  L P+ +N      +   T P  
Sbjct: 237 GIEAQLKAGGDFAKLAKSDSTGPTAPQGGDLGDFQKGQLAPELENATFPLKKGQFTEPIQ 296

Query: 263 TQKGVEYIAICDKRDLG--GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           T++G   + +   +D G      ++  +       K++     Y+ KLR+ + I  
Sbjct: 297 TKQGWIILEVTHHQDAGLAPMNQVETQIENAVGYNKMQPALRAYLTKLRNESYIDI 352


>gi|32034721|ref|ZP_00134852.1| COG0760: Parvulin-like peptidyl-prolyl isomerase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126207884|ref|YP_001053109.1| peptidyl-prolyl cis-trans isomerase SurA [Actinobacillus
           pleuropneumoniae L20]
 gi|126096676|gb|ABN73504.1| peptidyl-prolyl cis-trans isomerase SurA [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
          Length = 316

 Score =  125 bits (313), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 46/316 (14%), Positives = 106/316 (33%), Gaps = 15/316 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +KL++   +L+       +S  + A+  R+   ++G  + +  + +    L  +  +   
Sbjct: 1   MKLISAKSLLVALVTAIGISQTAIAIEERVVALVDGVPVMESQVQRA---LGKKANSEAN 57

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            K A++++I + L ++ ++++G+  + + V+      A   G++       LD QGI   
Sbjct: 58  HKAALEQIIDDLLVQKAVKEAGVKVNYSKVDQVIEDIAARNGITYGQLLDALDYQGITLE 117

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVRE--------YLIRTVL 184
            ++Q +A Q     V              ++ A  +++                  R   
Sbjct: 118 QYRQQIAQQMAMEQVRHISIGKSIQVDPKDVHAYAKELLEKDKANGKLKNVTGVQHRVSH 177

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK--FASKIHDVSIGKAQYLLESDL 242
             I    + N    + ++               +  K      +     G   Y      
Sbjct: 178 ILIKTTPVLNDIQAKAKLAQIVADIKAGKTTFEEAAKANSVDYLSAADGGDLGYNFLDIY 237

Query: 243 HPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKH 300
            P F +      Q   T P+ +Q G   + +   +               Q    + ++ 
Sbjct: 238 DPAFAKAASTAKQEQITAPFKSQFGWHILKVTGTQQGDRTEDAYNQRAYEQLVDKQAQEA 297

Query: 301 EAEYVKKLRSNAIIHY 316
             ++VK LR  A + Y
Sbjct: 298 AKDWVKALRKTADVQY 313


>gi|302039584|ref|YP_003799906.1| putative peptidylprolyl isomerase [Candidatus Nitrospira defluvii]
 gi|300607648|emb|CBK43981.1| putative Peptidylprolyl isomerase [Candidatus Nitrospira defluvii]
          Length = 344

 Score =  125 bits (313), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 33/302 (10%), Positives = 86/302 (28%), Gaps = 3/302 (0%)

Query: 18  TYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAV 77
                +    V I + ++  +  RI   +N ++I   ++ + +   + +       +   
Sbjct: 41  ALIFCLCLLFVLISNAEAAKLEDRIVAVVNSDLIMLSELKRDLLPEQDRLRKLYKGEDLE 100

Query: 78  QELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQY 137
           + L                      N       +    + E+     +     D +  + 
Sbjct: 101 RRLKTAEAMGVTKMIERKLQLQAAKNKGVDVSDQEVVQAVEEMKKQGEAIDSADPNTARS 160

Query: 138 LAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGF 197
           +  Q     VV  +        + E+    Q+ ++        +     I          
Sbjct: 161 IREQLTLMRVVDREVRGLIMVADSEMKRYYQEHQDRFAYPEEYQLSQILIKPRTPDGLSA 220

Query: 198 VQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL-LKKSQNN 256
              R +    +  +     +   +F+        G+   + + +L P  +          
Sbjct: 221 AHGRAEALLATLKQGEPFEDLALRFSDGADASRGGRLGLVRQGELIPALEQALTSVDVGK 280

Query: 257 TTNPYVTQKGVEYIAICDKRDLG--GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
            T    T +G+  + + DK+         +KA + +     K E     ++  L++ A I
Sbjct: 281 ITGIVETAEGLHIVRVDDKKPRQFRPFEQVKAEIQSLVFQQKTEDQYQIWMADLKNKAYI 340

Query: 315 HY 316
             
Sbjct: 341 EI 342


>gi|227821473|ref|YP_002825443.1| putative survival protein SurA, probable peptidyl-prolyl cis-trans
           isomerase protein [Sinorhizobium fredii NGR234]
 gi|227340472|gb|ACP24690.1| putative survival protein SurA, probable peptidyl-prolyl cis-trans
           isomerase protein [Sinorhizobium fredii NGR234]
          Length = 312

 Score =  125 bits (313), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 85/311 (27%), Positives = 144/311 (46%), Gaps = 7/311 (2%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI 68
           +   I ++     L +  ++ I S  +   +S ++  +N  VIT GDI+KR+A L+LQ+ 
Sbjct: 1   MGGKISIVRALSALAVAGVLSIASGAAVQAASGVKVIVNSTVITSGDIAKRVAFLRLQRQ 60

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
            G   + A ++L+ E LK+ EI +   +  +  V+  + + A    LS E     LD+ G
Sbjct: 61  GGGAAE-AEKQLVDEVLKRAEIARVQQSVSTQEVDAAYARFAAGNKLSTEQLGKILDQSG 119

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIP 188
           +G  HFKQY+A+Q  WP VV   +         ++     +                   
Sbjct: 120 VGIEHFKQYIAVQMSWPRVVNFRYGSASRLSGGDLVKRMMEGGGNKPVTTEYFLQQVIFV 179

Query: 189 DNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN 248
             + +      KR  +A  SR + P      + FA+   DVSI     +L   L   ++ 
Sbjct: 180 IPESKRGAITAKRQAEANASRSQFPGCETS-KAFAANYRDVSIRSLGRVLAQQLPEDWKP 238

Query: 249 LLKKS-QNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKI----EKHEAE 303
           L++K+    TT   VT+KGVEY+AIC KR +  + A +    A++   K     + +  +
Sbjct: 239 LVEKAGDGTTTGTRVTEKGVEYLAICKKRQVNDDAAAEVVFRAEDIGKKKAGGEDPNSEK 298

Query: 304 YVKKLRSNAII 314
           Y+++LRS A I
Sbjct: 299 YLEELRSKAQI 309


>gi|330830997|ref|YP_004393949.1| peptidylprolyl cis-trans isomerase SurA [Aeromonas veronii B565]
 gi|328806133|gb|AEB51332.1| Peptidylprolyl cis-trans isomerase SurA [Aeromonas veronii B565]
          Length = 434

 Score =  125 bits (313), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 32/310 (10%), Positives = 99/310 (31%), Gaps = 15/310 (4%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--- 70
           K L       +F  +   +  +  +  ++   +N +V+        +  +KL        
Sbjct: 5   KTLIALLTAGMFGAMSQAALAAPELMDKVLAVVNKDVVLSSQQDALVNKVKLSAQESGQS 64

Query: 71  -----ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLD 125
                 L K A+  LI E+L+ Q  E+ G+      +       A +  ++ +   + L 
Sbjct: 65  LPDDATLRKQALDRLIQESLQLQLAERQGLKISDTQLEQAIQGIAADNKMTLDQLRAQLA 124

Query: 126 KQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLF 185
           ++G+    +++ +  + +  +V +N    +    E E+    + +K    ++        
Sbjct: 125 REGMTYAQYREEVRREILMNEVRRNQVRRRINISEQEVKQVVEILKKQGQQQNEYHVGHI 184

Query: 186 SIPDNKLQNQGFVQKRIKDAE---ESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDL 242
            I          +       E    +  +           ++    +  G   ++   ++
Sbjct: 185 QIALPDNPTAAQLDAAKSKIERILAALKQGADFRKLAIAESNGPKALEGGDWGWMSPQEM 244

Query: 243 HPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIE 298
                + +    + +   P  +  G+  + + D +    +        ++  + +    E
Sbjct: 245 PTLMAEAVQGAKKGDIVGPLRSGAGLHIVKVFDTKGQQQVMQTEVKARHILIKPSIILSE 304

Query: 299 KHEAEYVKKL 308
           +     +  +
Sbjct: 305 EKAKGMLDGI 314



 Score = 88.2 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/274 (11%), Positives = 84/274 (30%), Gaps = 9/274 (3%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I++ ++ + + +LK Q      E       I         +          +     Q A
Sbjct: 157 ISEQEVKQVVEILKKQGQQQN-EYHVGHIQIALPDNPTAAQLDAAKSKIERILAALKQGA 215

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
               L+  + +     +G              +   V         G L      +  K+
Sbjct: 216 DFRKLAIAESNGPKALEGGDWGWMSPQEMPTLMAEAVQGAKKGDIVGPLRSGAGLHIVKV 275

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEE-----SRLRLPKDCNKLEKFASK 225
            +   ++ +++T + +       +    +++ K   +      +       +  EK++  
Sbjct: 276 FDTKGQQQVMQTEVKARHILIKPSIILSEEKAKGMLDGILHDIKSGKASFASMAEKYSED 335

Query: 226 I-HDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIA 283
               V  G+  +   +   P+F++++ +      + P+ T  G   + + D+R       
Sbjct: 336 PGSAVQGGELGWSDPNVYVPEFRDMVNRLQPGQISAPFRTSHGWHIVQVEDRRSQDATDK 395

Query: 284 LKAY-LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            +           +  +    ++ +LR  A I  
Sbjct: 396 AQEQRAYQLIYNRRFVEESQAWLDELRDEAYIQI 429


>gi|167854677|ref|ZP_02477457.1| bifunctional heptose 7-phosphate kinase/heptose 1-phosphate
           adenyltransferase [Haemophilus parasuis 29755]
 gi|167854214|gb|EDS25448.1| bifunctional heptose 7-phosphate kinase/heptose 1-phosphate
           adenyltransferase [Haemophilus parasuis 29755]
          Length = 312

 Score =  125 bits (313), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 54/315 (17%), Positives = 111/315 (35%), Gaps = 15/315 (4%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEK 74
           +  T    +      + ++ S     R+  T++G  I    + +    L  +       K
Sbjct: 1   MKFTQVKSLFIAGFALFAFSSANAEERVVATVDGYPIMQSQVKQA---LGKKANTEANRK 57

Query: 75  IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF 134
            A++ +I + + ++ I++SGI  D   V+      A   G++       LD QGI  + +
Sbjct: 58  AALETIIDDFVVQRAIKESGIKVDYAYVDQMMEDVAAQNGITYGQLLDALDYQGISLSQY 117

Query: 135 KQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITV----------REYLIRTVL 184
           +Q LA Q +   V +            ++ +  + M +              EY I  +L
Sbjct: 118 RQQLAHQLLMEQVRQQSIGNSIQVDPKDVQSLAKDMLDKAKINGTLETVSATEYRISHIL 177

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
                     Q   +     A+    ++  +          I  +  G   +        
Sbjct: 178 IKTTPILNDMQAKAKLLSITADIKSGKITFEEAAKINSVDYISGIDGGDLGFNFLDAYDS 237

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICD-KRDLGGEIALKAYLSAQNTPTKIEKHEA 302
            F N+  K   +  ++P+ +Q G   + + D +R    E A       Q    +++    
Sbjct: 238 TFANIASKSKIDVISSPFKSQFGWHILKVTDTRRGDRTEDAYLQRAYEQLIDKQVQVASK 297

Query: 303 EYVKKLRSNAIIHYY 317
           +++K LRS   I Y+
Sbjct: 298 DWIKVLRSKLDIKYF 312


>gi|238786686|ref|ZP_04630487.1| Chaperone surA [Yersinia frederiksenii ATCC 33641]
 gi|238725054|gb|EEQ16693.1| Chaperone surA [Yersinia frederiksenii ATCC 33641]
          Length = 434

 Score =  125 bits (313), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 38/296 (12%), Positives = 107/296 (36%), Gaps = 16/296 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   +    ++ +     ++   ++  V+   D+   +  +KL            G L
Sbjct: 7   LILGLVVCANTAFAAPQEVDKVAAVVDNGVVLQSDVDGLLQSVKLNAQQAGQQVPDDGTL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ +  Q  +K GIT     ++      A    ++ +   S L   G+  N
Sbjct: 67  RHQVLERLIMDNILLQMAKKMGITVSDEALDKAIADIAAQNRMTPDQMRSRLAADGLNYN 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            +++ +  + +  +V  N+   +   L  E+ +  +++ N T  +  +      IP  + 
Sbjct: 127 TYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQIGNQTSGDAELNLSHILIPLPEN 186

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +Q  V +    A +    +    +        ++    +  G+  +    +L   F + 
Sbjct: 187 PSQQQVDQAEDLANKLVSDIKGGADFGKLAIANSADSQALKGGQMGWGKLQELPSLFAER 246

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKH 300
           L   ++ +   P  +  G   + + D R     +        ++  + +P   ++ 
Sbjct: 247 LQSANKGDVVGPIRSGVGFHILKVNDIRGADKTVSVTEIHARHILLKPSPVMTDEQ 302



 Score = 81.6 bits (199), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 17/142 (11%), Positives = 45/142 (31%), Gaps = 3/142 (2%)

Query: 178 YLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQY 236
            +    +   P   + ++    K    A + +          ++ +      +  G   +
Sbjct: 284 EIHARHILLKPSPVMTDEQARAKLSAAAADIKSGKSSFATIAKEISQDPGSAMQGGDLGW 343

Query: 237 LLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDL-GGEIALKAYLSAQNTP 294
                  P F++ + K  +   + P  +  G   I + D R +   + A K         
Sbjct: 344 ASPDIYDPAFRDAVMKLQKGEISAPVHSSFGWHLIQVIDNRQVDKTDAAQKDRAYRMLFS 403

Query: 295 TKIEKHEAEYVKKLRSNAIIHY 316
            K  +    ++++ R+ A +  
Sbjct: 404 RKFAEEAQTWMQEQRAAAYVKI 425


>gi|241203946|ref|YP_002975042.1| peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240857836|gb|ACS55503.1| putative peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 314

 Score =  125 bits (313), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 78/290 (26%), Positives = 139/290 (47%), Gaps = 10/290 (3%)

Query: 35  SWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSG 94
           S   +S ++  +NG  IT GD++KR A L+LQ    +  K A ++LI E LK+QE+ +  
Sbjct: 26  SALAASEVKAVVNGTAITSGDVAKRQAFLRLQHTKADA-KAAEEQLIDEALKRQEVTRVH 84

Query: 95  ITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFML 154
           ++     V+  F + +    LS E  S  LD+ G+G +HFK ++A+Q  WP VV   +  
Sbjct: 85  MSVSQQDVDASFARFSSGNKLSPEQMSQILDRAGVGVDHFKGFIAVQMSWPRVVNARYGS 144

Query: 155 KYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
                  ++ +   +                     + +      KR  +AE SR + P 
Sbjct: 145 TSRLSNYDLVSRMMQNNKQKPVTTEYMLQQVIFVIPQAKRGAITGKRKGEAEASRSKFPG 204

Query: 215 DCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICD 274
             ++ + FA+ + DVS+     +L  ++ P ++ L+++++ NTT   VT KGVEY+AIC 
Sbjct: 205 C-DQAKVFAATMRDVSVRDLGRMLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEYLAICS 263

Query: 275 KRDLGGEIALKAYLSAQNTPTKI--------EKHEAEYVKKLRSNAIIHY 316
           +R +  + A +     ++              ++  +Y+ +LR  A I Y
Sbjct: 264 QRQVSDDQAAEMVFRQEDLDKSKGGKDASPENENSKKYLDELRKKAQIAY 313


>gi|190149693|ref|YP_001968218.1| peptidyl-prolyl cis-trans isomerase SurA [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|303252643|ref|ZP_07338806.1| survival SurA-like protein [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|307247402|ref|ZP_07529449.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307256445|ref|ZP_07538227.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|307263001|ref|ZP_07544623.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|189914824|gb|ACE61076.1| peptidyl-prolyl cis-trans isomerase SurA [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|302648611|gb|EFL78804.1| survival SurA-like protein [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|306856099|gb|EFM88255.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306865075|gb|EFM96976.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306871627|gb|EFN03349.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 316

 Score =  125 bits (313), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 46/316 (14%), Positives = 105/316 (33%), Gaps = 15/316 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +KL++   +L+       +S  + A+  R+   ++G  + +  + +    L  +  +   
Sbjct: 1   MKLISAKSLLVALVTAIGISQTAIAIEERVVALVDGVPVMESQVQRA---LGKKANSEAN 57

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            K A++++I + L ++ ++++G+  +   V+      A   G++       LD QGI   
Sbjct: 58  HKAALEQIIDDLLVQKAVKEAGVKVNYAKVDQVIEDIAARNGITYGQLLDALDYQGITLE 117

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVRE--------YLIRTVL 184
            ++Q +A Q     V              ++ A  +++                  R   
Sbjct: 118 QYRQQIAQQMAMEQVRHISIGKSIQVDPKDVHAYAKELLEKDKANGKLKNVTGVQHRVSH 177

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK--FASKIHDVSIGKAQYLLESDL 242
             I    + N    + ++               +  K      +     G   Y      
Sbjct: 178 ILIKTTPVLNDIQAKAKLAQIVADIKAGKTTFEEAAKANSVDYLSAADGGDLGYNFLDIY 237

Query: 243 HPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKH 300
            P F +      Q   T P+ +Q G   + +   +               Q    + ++ 
Sbjct: 238 DPAFAKAASTAKQEQITAPFKSQFGWHILKVTGTQQGDRTEDAYNQRAYEQLVDKQAQEA 297

Query: 301 EAEYVKKLRSNAIIHY 316
             ++VK LR  A + Y
Sbjct: 298 AKDWVKALRKTADVQY 313


>gi|170691413|ref|ZP_02882578.1| SurA domain [Burkholderia graminis C4D1M]
 gi|170143618|gb|EDT11781.1| SurA  domain [Burkholderia graminis C4D1M]
          Length = 453

 Score =  125 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 43/304 (14%), Positives = 100/304 (32%), Gaps = 22/304 (7%)

Query: 30  IVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELI 81
            ++         I   +N  VIT  ++ +R++L+  +             L +  + +++
Sbjct: 32  ALAGNRGQTVDTIAAVVNNGVITRRELEERVSLITRRLNQQNAPIPPADQLRQQVLNQMV 91

Query: 82  VETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQ 141
           +E ++ Q+ ++ GI  D   V     + A+   LS + + + ++ QG+    F      +
Sbjct: 92  LERIQLQKAKEDGINIDDAAVQKTLERLAQANNLSLDVYRARIEAQGVPWTTFTSDARTE 151

Query: 142 SIWPDVVKNDFMLKYGNLEMEIPAN----KQKMKNITVREYLIRTVLFSIPDNKLQNQGF 197
                + + +   K    + E+       +      T   +L   +L +  +    +   
Sbjct: 152 LTLSRLREKEVDSKVTVSDAEVANYIASQRGPNAGATSDLHLEHILLKAPLNAPQPDIEA 211

Query: 198 VQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNT 257
            QK+ +                +  +        G   Y   S L P+F       +   
Sbjct: 212 AQKKAEALLAEAKGGANFEKLAKSNSQAPDASKGGDMGYAAPSKLPPEFVKAASALRPGQ 271

Query: 258 TNP--YVTQKGVEYIAICDKRDLGGE--------IALKAYLSAQNTPTKIEKHEAEYVKK 307
            NP    T  G E + + D+R   G              ++  +      E    + + +
Sbjct: 272 VNPEVIRTSDGFEVVRLVDRRAGQGTSSDAPKLVQTHVRHILLRVGDGMSEPQARQKLLE 331

Query: 308 LRSN 311
           +R  
Sbjct: 332 IRKE 335



 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 16/145 (11%), Positives = 50/145 (34%), Gaps = 2/145 (1%)

Query: 173 ITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIG 232
              +          +      ++   ++++ +  +              ++        G
Sbjct: 300 DAPKLVQTHVRHILLRVGDGMSEPQARQKLLEIRKEIAAGGDFSKFASTYSQDGSSSQGG 359

Query: 233 KAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-AYLSA 290
              ++   +  P+F+  +        ++P  ++ G   I + ++R+  G IA +      
Sbjct: 360 DLGWISPGETVPEFERAMNSLQDGQISDPVRSEYGYHLIQVLERREAQGSIAQQMDLARQ 419

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIH 315
                K E+  A+++++LR  A + 
Sbjct: 420 AIGQRKAEQAYADWLRELRDTAYVE 444


>gi|258405810|ref|YP_003198552.1| SurA domain-containing protein [Desulfohalobium retbaense DSM 5692]
 gi|257798037|gb|ACV68974.1| SurA domain protein [Desulfohalobium retbaense DSM 5692]
          Length = 311

 Score =  125 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 51/304 (16%), Positives = 111/304 (36%), Gaps = 22/304 (7%)

Query: 27  IVPIVSYKSWAMSSRIRTTINGEVITDGDISKR----IALLKLQKIN-------GELEKI 75
               V      +  RI   +NGE+IT  +++++    +   + Q+          E++K 
Sbjct: 14  FCSAVPATGEQVVDRIVAVVNGEIITLFELNQKADPVVERFRSQQPGSLTEDRIEEIKKR 73

Query: 76  AVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFK 135
            +Q ++   L +QE E+  +  +   V     +     G   E     L  +G+  + F+
Sbjct: 74  VLQTMVDNMLLRQEAERLEMEIEDAEVQDRIEEMKTQRGWDDERLDQMLANEGLDRSSFE 133

Query: 136 QYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQ 195
           + +    +   +V      K      EI    +  +    +E  +   L ++P       
Sbjct: 134 KNIREDLMRRRLVGAMVRRKVVVTNEEIQTFYKDNQEQFAQEKKVDLRLLAVPS------ 187

Query: 196 GFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL-LKKSQ 254
             V K  +  +             ++F+        G   ++  +DL PQ++ +    S 
Sbjct: 188 --VDKAKQLRQRITDGDLDFAQAAKQFSQGPAAGQGGDLGWVKWADLAPQWKEVLRSTSP 245

Query: 255 NNTTNPYVTQKGVEYIAICD--KRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNA 312
            + T P+  Q     + + D  K  +    A++  ++      K EK    Y+++LR  A
Sbjct: 246 GSMTEPFSLQGQTAILYLEDMQKGQVQPLSAVRDRIADTLRGPKFEKQLETYLQRLRDKA 305

Query: 313 IIHY 316
           ++  
Sbjct: 306 VVDI 309


>gi|254283287|ref|ZP_04958255.1| chaperone SurA [gamma proteobacterium NOR51-B]
 gi|219679490|gb|EED35839.1| chaperone SurA [gamma proteobacterium NOR51-B]
          Length = 435

 Score =  125 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 46/323 (14%), Positives = 108/323 (33%), Gaps = 12/323 (3%)

Query: 1   MTSKVFTSLSD-FIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKR 59
           MT+   T LS   I  + T  + +        +     +  +I   ++ ++I   ++ +R
Sbjct: 1   MTATNITFLSRALITTVLTSGMFLNAITAHAQAGDQVQILEQIVAIVDDDIILASELRER 60

Query: 60  IALLKLQKI--------NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHAR 111
           +  LK+              L +  +  LI+E+++ Q  E+ GI      ++    + A 
Sbjct: 61  LDTLKVNIERQGAEMPAEDILVRETLDRLILESIQLQMGERYGIRIPDTQLDEALRRVAS 120

Query: 112 NTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMK 171
           N GL+   F   L+ +G      ++ +  +     V + +        + EI    +   
Sbjct: 121 NNGLTLAQFRGALEAEGRSYAEMRESVRKEMTIQRVQQGNVSRNINISDAEIDNYLETEA 180

Query: 172 NITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFA-SKIHDVS 230
              + E   R     IP N   ++     +    + +   +          + ++ +   
Sbjct: 181 GQELTEPQYRVFQALIPVNSTDSEAERASKEAFVDSALSAILDGQAFESAVSVTQPYAFQ 240

Query: 231 IGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDK--RDLGGEIALKAYL 288
            G   +   SD+   F  ++       T    +  G   + + D   R+         ++
Sbjct: 241 GGDLGWRKLSDIPSMFTAIVPTLDRGETGKVESGSGFHLVHVADVRGRERVIAQTKVRHI 300

Query: 289 SAQNTPTKIEKHEAEYVKKLRSN 311
             + +  + E    +    LR  
Sbjct: 301 LVKPSEVRTEAETEQLAADLRQR 323



 Score = 94.4 bits (232), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/269 (9%), Positives = 85/269 (31%), Gaps = 4/269 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I+D +I   +     Q++     +   Q LI       E E++      ++     +   
Sbjct: 167 ISDAEIDNYLETEAGQELTEPQYR-VFQALIPVNSTDSEAERASKEAFVDSALSAILDGQ 225

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                 +           +G        ++ +     +      K  +       +   +
Sbjct: 226 AFESAVSVTQPYAFQGGDLGWRKLSDIPSMFTAIVPTLDRGETGKVESGSGFHLVHVADV 285

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDV 229
           +         +     +  ++++ +   ++   D  +  L         ++++  I    
Sbjct: 286 RGRERVIAQTKVRHILVKPSEVRTEAETEQLAADLRQRLLDGADFAELAKEYSEDIGSAQ 345

Query: 230 SIGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAY 287
             G   +     + P+F+  + +   ++   P  +Q G   + +  +RD    +   +  
Sbjct: 346 EGGDLGWTSAGQMVPEFEQAMAETEVDDIAPPVRSQFGWHVLEVTGRRDKDVSDEMRRNQ 405

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           ++      K ++    +++K+R+ A +  
Sbjct: 406 VANYLHDAKYQEELDAWLRKIRTEAFVDI 434


>gi|149377958|ref|ZP_01895684.1| Parvulin-like peptidyl-prolyl isomerase [Marinobacter algicola
           DG893]
 gi|149357732|gb|EDM46228.1| Parvulin-like peptidyl-prolyl isomerase [Marinobacter algicola
           DG893]
          Length = 429

 Score =  125 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 35/309 (11%), Positives = 102/309 (33%), Gaps = 16/309 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK--------INGEL 72
           + ++  +V         +  ++   +N +VI   ++  RI  +  +             L
Sbjct: 2   LALMVVMVSATVQADRKLLDQVVAVVNDDVILQSELEARINTITGRLRAQGTGLPPRDIL 61

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           E+  +++LI E+++ Q  +++G+    N +N      A+   ++   F   L ++G+   
Sbjct: 62  EERVLEQLISESIQLQMADRAGMRISDNELNETLASIAQRNNMTLAQFEQQLVQEGVTYR 121

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN---KQKMKNITVREYLIRTVLFSIPD 189
             ++ +  + I   V +     +    + E+                  L   ++     
Sbjct: 122 EAREQIRNEMITSRVQQRQVGNRVRVTDREVENYLAAMAGQGRSNAEYELAHILIEVNDF 181

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
           N  +     +++++   E         +     +   + +  G   +  E+ L     ++
Sbjct: 182 NDEEEVSAAREKVEQLREEIAEGRDFRSVAVAESDASNALDGGNMGWRAENQLPSLVADV 241

Query: 250 LKK-SQNNTTNPYVTQKGVEYIAICDKRDLG----GEIALKAYLSAQNTPTKIEKHEAEY 304
           +        +       G   + + D+R        E +   ++  + + T  E      
Sbjct: 242 VPDLETGTVSPVLRNSSGFHLVMVMDRRGGDKAQFIEQSKVRHILVRTSETVSEAQAEAT 301

Query: 305 VKKLRSNAI 313
           ++ L     
Sbjct: 302 IRDLYQQID 310



 Score = 97.8 bits (241), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/280 (9%), Positives = 84/280 (30%), Gaps = 10/280 (3%)

Query: 46  INGEV-ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           +   V +TD ++   +A +  Q  +    ++A   LI       E E S        +  
Sbjct: 141 VGNRVRVTDREVENYLAAMAGQGRSNAEYELA-HILIEVNDFNDEEEVSAAREKVEQLRE 199

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFML-----KYGNL 159
              +      ++  +  +     G       +      +   V   +        +  + 
Sbjct: 200 EIAEGRDFRSVAVAESDASNALDGGNMGWRAENQLPSLVADVVPDLETGTVSPVLRNSSG 259

Query: 160 EMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKL 219
              +    ++  +        +     +  ++  ++   +  I+D  +            
Sbjct: 260 FHLVMVMDRRGGDKAQFIEQSKVRHILVRTSETVSEAQAEATIRDLYQQIDNGADFAVIA 319

Query: 220 EKFASKI-HDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRD 277
            + +         G   ++    + P+F+  + ++       P+ +Q G   + + D+R 
Sbjct: 320 REHSDDPVSGSDGGNLGWVSPGQMVPEFEQAMMEADVGELKGPFRSQFGWHILQVQDRRQ 379

Query: 278 LGGEIALKA-YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                 ++           K +     +++++R  A I +
Sbjct: 380 QDISGDVRESEARQAIYRRKFDTELQNWLREIRDEAFIEF 419


>gi|322514871|ref|ZP_08067889.1| peptidyl-prolyl cis-trans isomerase [Actinobacillus ureae ATCC
           25976]
 gi|322119175|gb|EFX91320.1| peptidyl-prolyl cis-trans isomerase [Actinobacillus ureae ATCC
           25976]
          Length = 314

 Score =  125 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 51/316 (16%), Positives = 107/316 (33%), Gaps = 16/316 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +KL++   +L+       +S  + A   R+  T++G  + + D+ +    L  +      
Sbjct: 1   MKLISAKSLLLTLVAAVGISQSAMAWEERVVATVDGVPVMESDVQR----LLGKNATAAQ 56

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            K AV++ I + L ++ ++++G+  +   V+    Q A   G++       LD QGI  N
Sbjct: 57  HKSAVEQAIDDVLIQKAVKEAGVKVNYAHVDQAIEQIAARNGITYGQLLDALDYQGITLN 116

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITV--------REYLIRTVL 184
            ++Q +A Q     V              ++ A  Q++                  R   
Sbjct: 117 QYRQQIAQQMAMEQVRNISIGKSIQVQPQDVQARAQELLAQDKAIGKLKTVTGNQYRISH 176

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF--ASKIHDVSIGKAQYLLESDL 242
             +    + N    + ++               +  K      +     G   Y      
Sbjct: 177 ILLKTTPVLNDVQAKAKLTQITADINAGKTTFEQAAKLNSVDYVSAADGGDLGYNFLDIY 236

Query: 243 HPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKH 300
            P F +      Q+  T P+ +Q G   + +   +               Q    + ++ 
Sbjct: 237 DPAFAKAASMAKQDQITAPFKSQFGWHILKVTGSQQGDRTEDAYHQRAYEQLVDKQAQEA 296

Query: 301 EAEYVKKLRSNAIIHY 316
             ++VK LR  A + Y
Sbjct: 297 SRDWVKALRKTANVQY 312


>gi|303249762|ref|ZP_07335966.1| survival SurA-like protein [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|307245230|ref|ZP_07527321.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307251950|ref|ZP_07533851.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307254177|ref|ZP_07536022.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307258641|ref|ZP_07540376.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307260875|ref|ZP_07542561.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|302651329|gb|EFL81481.1| survival SurA-like protein [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306853874|gb|EFM86088.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306860642|gb|EFM92654.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306862877|gb|EFM94826.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306867298|gb|EFM99151.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306869442|gb|EFN01233.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 316

 Score =  125 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 46/316 (14%), Positives = 105/316 (33%), Gaps = 15/316 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +KL++   +L+       +S  + A+  R+   ++G  + +  + +    L  +  +   
Sbjct: 1   MKLISAKSLLVALVTAIGISQTAIAIEERVVALVDGVPVMESQVQRA---LGKKANSEAN 57

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            K A++++I + L ++ ++++G+  +   V+      A   G++       LD QGI   
Sbjct: 58  HKAALEQIIDDLLVQKAVKEAGVKVNYAKVDQVIEDIAARNGITYGQLLDALDYQGITLE 117

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVRE--------YLIRTVL 184
            ++Q +A Q     V              ++ A  +++                  R   
Sbjct: 118 QYRQQIAQQMAMEQVRHISIGKSIQVDPKDVHAYAKELLEKDKANGKLKNVTGVQHRVSH 177

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK--FASKIHDVSIGKAQYLLESDL 242
             I    + N    + ++               +  K      +     G   Y      
Sbjct: 178 ILIKTTPVLNDIQAKAKLAQIVADIKAGKTTFEEAAKANSVDYLSAADGGDLGYNFLDIY 237

Query: 243 HPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKH 300
            P F +      Q   T P+ +Q G   + +   +               Q    + ++ 
Sbjct: 238 DPAFAKAASTAKQEQITAPFKSQFGWHILKVTGTQQGDRTEDAYNQRAYEQLVDKQAQEA 297

Query: 301 EAEYVKKLRSNAIIHY 316
             ++VK LR  A + Y
Sbjct: 298 AKDWVKALRKTANVQY 313


>gi|322421262|ref|YP_004200485.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter sp. M18]
 gi|320127649|gb|ADW15209.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter sp. M18]
          Length = 342

 Score =  125 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 46/286 (16%), Positives = 100/286 (34%), Gaps = 16/286 (5%)

Query: 45  TINGEVITDGDISKRIALLKLQKINGE---------LEKIAVQELIVETLKKQEIEKSGI 95
            +NG+VIT  ++ + +  L  QK   +         ++K A+++L+   L  Q  +K+ I
Sbjct: 50  KVNGKVITRAEVDRAVKALLDQKQLRQPVALEELRAVKKEAMEQLVSSELLYQAAQKTDI 109

Query: 96  TFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLK 155
                 V     +       S E F+  + + G+     +Q +  +    D ++  F  +
Sbjct: 110 GDVEQKVAQVIARDRARY-PSDEAFARSVKEAGLTLPMLQQLIRKEMAVSDFIETMFGAR 168

Query: 156 YGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKD 215
               E E  +  +  ++       +R     +           ++  + AE    R+ + 
Sbjct: 169 INVGEDEARSFYEANRDRFKTGSSVRASQILVMVPGPSQDRDRERARERAEILLHRVKEG 228

Query: 216 CNK---LEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIA 271
            N     +  +        G   +  +  L P  +  +        ++   T  G   + 
Sbjct: 229 ENFGILAQSHSDCPSKARGGDLGFFNKGKLDPGLEQAVFALKPGEISDIVQTSFGFHILK 288

Query: 272 ICDKRDL--GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           + +KR          +  + +     K+ +  AEYV KLR  A + 
Sbjct: 289 LTEKRGPRLETYEEARPEIYSYLKREKMLRLVAEYVAKLRGKAKVE 334


>gi|172061669|ref|YP_001809321.1| SurA domain-containing protein [Burkholderia ambifaria MC40-6]
 gi|171994186|gb|ACB65105.1| SurA domain protein [Burkholderia ambifaria MC40-6]
          Length = 452

 Score =  125 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/299 (13%), Positives = 99/299 (33%), Gaps = 22/299 (7%)

Query: 35  SWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVETLK 86
              ++  +   +N +VIT  ++ +R+ L+  +             L    + ++++E ++
Sbjct: 35  GAQLADEVVAVVNNDVITGRELDQRVGLIARRLQQQNAPVPPADQLRAQVLNQMVLERIQ 94

Query: 87  KQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPD 146
            Q+ +  GI  D  TV     + A+  G++ E + + L+ QG+  + F      + +   
Sbjct: 95  VQKAKDDGIRIDDATVQSTLQRLAQANGMTLEQYRARLEAQGVPWSVFTSDARTELMLSK 154

Query: 147 VVKNDFMLKYGNLEMEIPANKQKMK----NITVREYLIRTVLFSIPDNKLQNQGFVQKRI 202
           + + +   K    + E+       +    +           + +  +         QK+ 
Sbjct: 155 LREREVDGKITVSDAEVVNYIASQRGPSASQQQDLRFQHIFIKAPTNAPQAEIEVAQKKA 214

Query: 203 KDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNP-- 260
           +   +            +  +        G   +     L  +  +   K +    NP  
Sbjct: 215 EALLQQATSGADFEKLAKNNSEANDAKKGGDLGFKAPGALPAEVVDAASKLRPGQVNPTL 274

Query: 261 YVTQKGVEYIAICDKRDLGGEIALK--------AYLSAQNTPTKIEKHEAEYVKKLRSN 311
                G E + + D+R   G  A           ++  +    K E    + ++ +R  
Sbjct: 275 IRVPDGFEIVRLVDRRQSQGTSAAAPKIVQTHVRHILLRVGEGKSEGQARQQLQDIRRQ 333



 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/287 (10%), Positives = 91/287 (31%), Gaps = 19/287 (6%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           ++G+ IT  D ++ +  +  Q+     ++  +       +K            +      
Sbjct: 160 VDGK-ITVSD-AEVVNYIASQRGPSASQQQDL-RFQHIFIKAPTNAPQAEIEVAQKKAEA 216

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN--------------D 151
            +Q A +     +   +  +           + A  ++  +VV                 
Sbjct: 217 LLQQATSGADFEKLAKNNSEANDAKKGGDLGFKAPGALPAEVVDAASKLRPGQVNPTLIR 276

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
               +  + +      Q       +          +   + +++G  +++++D       
Sbjct: 277 VPDGFEIVRLVDRRQSQGTSAAAPKIVQTHVRHILLRVGEGKSEGQARQQLQDIRRQVEA 336

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYI 270
                     ++        G   ++   +  P+F+  +        + P  T+ G   I
Sbjct: 337 GGDFAKFARTYSQDGSASQGGDLGWISPGETVPEFERAMNNLQDGQISQPVRTEYGYHLI 396

Query: 271 AICDKRDLGGEIALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            + D+R+  G +  +  +        K E+  A+++++LR ++ + Y
Sbjct: 397 QVIDRRESEGSVQQQMDIARQAIGQRKAEQAYADWLRELRDSSYVQY 443


>gi|165975861|ref|YP_001651454.1| survival SurA-like protein [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|165875962|gb|ABY69010.1| survival SurA-like protein [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
          Length = 316

 Score =  125 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 47/316 (14%), Positives = 105/316 (33%), Gaps = 15/316 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +KL++   +L+       +S  + A+  R+   ++G  + +  + +    L  +  +   
Sbjct: 1   MKLISAKSLLVALVTAIGISQTAIAIEERVVALVDGVPVMESQVQRA---LGKKANSEAN 57

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            K A++++I + L ++ ++++GI  +   V+      A   G++       LD QGI   
Sbjct: 58  HKAALEQIIDDLLVQKAVKEAGIKVNYAKVDQVIEDIAARNGITYGQLLDALDYQGITLE 117

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVRE--------YLIRTVL 184
            ++Q +A Q     V              ++ A  +++                  R   
Sbjct: 118 QYRQQIAQQMAMEQVRHISIGKSIQVDPKDVHAYAKELLEKDKANGKLKNVTGVQHRVSH 177

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK--FASKIHDVSIGKAQYLLESDL 242
             I    + N    + ++               +  K      +     G   Y      
Sbjct: 178 ILIKTTPVLNDIQAKAKLAQIVADIKAGKTTFEEAAKANSVDYLSAADGGDLGYNFLDIY 237

Query: 243 HPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKH 300
            P F +      Q   T P+ +Q G   + +   +               Q    + ++ 
Sbjct: 238 DPAFAKAASTAKQEQITAPFKSQFGWHILKVTGTQQGDRTEDAYNQRAYEQLVDKQAQEA 297

Query: 301 EAEYVKKLRSNAIIHY 316
             ++VK LR  A + Y
Sbjct: 298 AKDWVKALRKTADVQY 313


>gi|222056577|ref|YP_002538939.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter sp.
           FRC-32]
 gi|221565866|gb|ACM21838.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter sp.
           FRC-32]
          Length = 340

 Score =  125 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 43/288 (14%), Positives = 96/288 (33%), Gaps = 16/288 (5%)

Query: 43  RTTINGEVITDGDISKRIALLKLQK---------INGELEKIAVQELIVETLKKQEIEKS 93
              ING +IT  ++ + + +L  Q             + E+ A+ +LI   L  Q  +K+
Sbjct: 52  VAKINGTIITRKELDRAVKVLVAQNRLPQALPPEQQKQAEEAALDQLISAELMYQAGQKT 111

Query: 94  GITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFM 153
            I      +      +      + E+F   L    + +   K++     +    ++ + +
Sbjct: 112 EIKDIDKQIEEKIALNRAKF-PNPEEFDKALKSVEMSEKDLKEFTRKDIVITAFIEKNII 170

Query: 154 LKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR-- 211
                 E +             ++  IR     I  +    +   +K  + AE    +  
Sbjct: 171 SNINVAEADAKKFYDDNTEKFKQDESIRASHILIGVDAKAGEEDKKKAREKAEGILKKIK 230

Query: 212 -LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEY 269
                    +  ++       G      +  +   F+N          ++   TQ G   
Sbjct: 231 AGEDFATLAKAESTCPSSKQGGDLGTFPKGQMVAPFENAAFALKPGEVSDVVETQFGYHI 290

Query: 270 IAICDKRDLGG--EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           I + +K++ G      +K  +       KI+K   +Y+++L+S A   
Sbjct: 291 IKLAEKKEAGMVKFDEVKTKIVDYLKSQKIQKGVGDYLEELKSKAKTE 338


>gi|134093645|ref|YP_001098720.1| periplasmic peptidyl-prolyl cis-trans isomerase (PPIase), involved
           in maturation of outer membrane proteins [Herminiimonas
           arsenicoxydans]
 gi|133737548|emb|CAL60591.1| Chaperone SurA precursor (Peptidyl-prolyl cis-trans isomerase SurA)
           (PPIase SurA) (Rotamase SurA) [Herminiimonas
           arsenicoxydans]
          Length = 469

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 38/311 (12%), Positives = 101/311 (32%), Gaps = 28/311 (9%)

Query: 29  PIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--------ELEKIAVQEL 80
              S     ++  I   +N EVIT  +  +R+ +++ +            +L++  ++ +
Sbjct: 43  ASTSRLQPRLADAILVVVNNEVITRYEFIERLKVIENRLKGQGGQMPPMEQLQRQLLERM 102

Query: 81  IVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAI 140
           IVE  + Q+ ++SGI  D   ++    + A    L+  +F   L++ G+    F++ +  
Sbjct: 103 IVERAQLQQAKESGIKVDDAMLDRAVARIADQNQLTMPEFRKRLEQDGMVYFQFREEIRS 162

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI----RTVLFSIPDNKLQNQG 196
           + I   + + +   K    + E+ A   +               + ++    +   Q   
Sbjct: 163 EMILQRLREREVDNKIQVSDAEVDAYMAEHSGTNANAPQELNLGQILIRVPENATPQQLA 222

Query: 197 FVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQN 255
             +KR ++                 ++     ++ G+  +  +  L   F        Q 
Sbjct: 223 DSRKRAEEVLAQLNAGGDFAKLAAAYSDGTDGLTGGELGWRTQDRLPQLFVDATASLQQG 282

Query: 256 NTTNPYVTQKGVEYIAICDKRDL---------------GGEIALKAYLSAQNTPTKIEKH 300
                  +  G   + +  KR                   +    +++  +         
Sbjct: 283 QIAPLVKSGNGFHILKVLGKRTQSVLRAAPGANPAAANTVKQTHASHILIKVNQVVSAAD 342

Query: 301 EAEYVKKLRSN 311
               + +L+  
Sbjct: 343 ARRKLTELKQR 353



 Score = 95.9 bits (236), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 13/139 (9%), Positives = 45/139 (32%), Gaps = 2/139 (1%)

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLE 239
             + +    +  +      +K  +  +    +           ++       G   ++  
Sbjct: 326 HASHILIKVNQVVSAADARRKLTELKQRLDNKAATFEELARLHSNDFSASKGGDLGWIYP 385

Query: 240 SDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKA-YLSAQNTPTKI 297
            D  P+F+  +        + P  +  G   I + +++        +   +       K+
Sbjct: 386 GDTVPEFERAMDALPVGEVSEPIESPFGYHLILVKERKSDDVSQERQRLVVRQALRAQKV 445

Query: 298 EKHEAEYVKKLRSNAIIHY 316
           E+   ++++++R  A + Y
Sbjct: 446 EEATQDWLRQVRDRAYVEY 464


>gi|171317315|ref|ZP_02906511.1| SurA domain [Burkholderia ambifaria MEX-5]
 gi|171097514|gb|EDT42352.1| SurA domain [Burkholderia ambifaria MEX-5]
          Length = 452

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/299 (13%), Positives = 99/299 (33%), Gaps = 22/299 (7%)

Query: 35  SWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVETLK 86
              ++  +   +N +VIT  ++ +R+ L+  +             L    + ++++E ++
Sbjct: 35  GAQLADEVVAVVNNDVITGRELDQRVGLIARRLQQQNAPVPPADQLRAQVLNQMVLERIQ 94

Query: 87  KQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPD 146
            Q+ +  GI  D  TV     + A+  G++ E + + L+ QG+  + F      + +   
Sbjct: 95  VQKAKDDGIRIDDATVQSTLQRLAQANGMTLEQYRARLEAQGVPWSVFTSDARTELMLSK 154

Query: 147 VVKNDFMLKYGNLEMEIPANKQKMK----NITVREYLIRTVLFSIPDNKLQNQGFVQKRI 202
           + + +   K    + E+       +    +           + +  +         QK+ 
Sbjct: 155 LREREVDGKITVSDAEVVNYIASQRGPSASQQQDLRFQHIFIKAPTNAPQAEIEVAQKKA 214

Query: 203 KDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNP-- 260
           +   +            +  +        G   +     L  +  +   K +    NP  
Sbjct: 215 EALLQQATSGADFEKLAKNNSEANDAKKGGDLGFKAPGALPAEVVDAASKLRPGQVNPTL 274

Query: 261 YVTQKGVEYIAICDKRDLGGEIALK--------AYLSAQNTPTKIEKHEAEYVKKLRSN 311
                G E + + D+R   G  A           ++  +    K E    + ++ +R  
Sbjct: 275 IRVPDGFEIVRLVDRRQSQGTSAAAPKIVQTHVRHILLRVGEGKSEGQARQQLQDIRRQ 333



 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/287 (10%), Positives = 91/287 (31%), Gaps = 19/287 (6%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           ++G+ IT  D ++ +  +  Q+     ++  +       +K            +      
Sbjct: 160 VDGK-ITVSD-AEVVNYIASQRGPSASQQQDL-RFQHIFIKAPTNAPQAEIEVAQKKAEA 216

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN--------------D 151
            +Q A +     +   +  +           + A  ++  +VV                 
Sbjct: 217 LLQQATSGADFEKLAKNNSEANDAKKGGDLGFKAPGALPAEVVDAASKLRPGQVNPTLIR 276

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
               +  + +      Q       +          +   + +++G  +++++D       
Sbjct: 277 VPDGFEIVRLVDRRQSQGTSAAAPKIVQTHVRHILLRVGEGKSEGQARQQLQDIRRQVEA 336

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYI 270
                     ++        G   ++   +  P+F+  +        + P  T+ G   I
Sbjct: 337 GGDFAKFARTYSQDGSASQGGDLGWISPGETVPEFERAMNNLQDGQISQPVRTEYGYHLI 396

Query: 271 AICDKRDLGGEIALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            + D+R+  G +  +  +        K E+  A+++++LR ++ + Y
Sbjct: 397 QVIDRREAEGSVQQQMDIARQAIGQRKAEQAYADWLRELRDSSYVQY 443


>gi|293392898|ref|ZP_06637215.1| peptidylprolyl cis-trans isomerase SurA [Serratia odorifera DSM
           4582]
 gi|291424432|gb|EFE97644.1| peptidylprolyl cis-trans isomerase SurA [Serratia odorifera DSM
           4582]
          Length = 433

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 34/303 (11%), Positives = 106/303 (34%), Gaps = 16/303 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   +    ++ +     ++   ++  V+ + D++  +  +KL              L
Sbjct: 7   LILGLVVCANAAFAAPQEVDKVAAVVDNGVVLESDVNGLLQSVKLNAQQAGQQLPDDKTL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ ++ Q  +K GI      ++      A    +S +   S L  +G+  N
Sbjct: 67  RHQILERLIMDNIQLQMAKKMGINVTDADLDKAIGNIAAQNRMSIDQLRSRLAYEGLNYN 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            ++  +  + +  +V  N+   +   L  E+ A  +++      +  +      IP  + 
Sbjct: 127 TYRSQIRKEMLITEVRNNEVRRRVTILPQEVDALAKQVGAQNGSDTEMNISHILIPLPEN 186

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +Q  V +    A+     +    +       +++    +  G   +    ++   F + 
Sbjct: 187 PSQQQVDEAETLAKRLIGEINSGADFGKLAITYSADSQALKGGNMGWGKLQEIPTLFAER 246

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDL----GGEIALKAYLSAQNTPTKIEKHEAEY 304
           L+   + +   P  +  G   + + D R              ++  + +    +      
Sbjct: 247 LVSAKKGDVVGPIRSGVGFHILKVNDLRGASQSISVTEVHARHILLKPSVVMTDDQARAK 306

Query: 305 VKK 307
           +++
Sbjct: 307 LEE 309



 Score = 84.7 bits (207), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 38/285 (13%), Positives = 84/285 (29%), Gaps = 17/285 (5%)

Query: 47  NGEV-----ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNT 101
           N EV     I   ++      +  Q  +     I+   LI       + +       +  
Sbjct: 143 NNEVRRRVTILPQEVDALAKQVGAQNGSDTEMNIS-HILIPLPENPSQQQVDEAETLAKR 201

Query: 102 VNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND-------FML 154
           +       A    L+    +     +G      K           +V             
Sbjct: 202 LIGEINSGADFGKLAITYSADSQALKGGNMGWGKLQEIPTLFAERLVSAKKGDVVGPIRS 261

Query: 155 KYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
             G   +++   +   ++I+V E   R +L         +Q    K  + A   +    K
Sbjct: 262 GVGFHILKVNDLRGASQSISVTEVHARHILLKPSVVMTDDQA-RAKLEEVAAAVKSGKAK 320

Query: 215 DCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAI 272
             ++ ++ +      +  G   +       P F++ L K  +   + P  +  G   I +
Sbjct: 321 FADEAKQLSQDPGSALQGGDLGWASPDIYDPAFRDALLKLQKGEVSQPVHSAFGWHLIQL 380

Query: 273 CDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            D R +   + A K          K  +    ++++ R+ A +  
Sbjct: 381 LDTRQVDKTDAAQKERAYRMLFNRKFAEEAQTWMQEQRAAAYVKI 425


>gi|115352813|ref|YP_774652.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Burkholderia
           ambifaria AMMD]
 gi|115282801|gb|ABI88318.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Burkholderia
           ambifaria AMMD]
          Length = 452

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/299 (13%), Positives = 98/299 (32%), Gaps = 22/299 (7%)

Query: 35  SWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVETLK 86
              ++  +   +N +VIT  ++ +R+ L+  +             L    + ++++E ++
Sbjct: 35  GAQLADEVVAVVNNDVITGRELDQRVGLIARRLQQQNAPVPPADQLRAQVLNQMVLERIQ 94

Query: 87  KQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPD 146
            Q+ +  GI  D  TV     + A+  G++ E + + L+ QG+  + F      + +   
Sbjct: 95  VQKAKDDGIRIDDATVQSTLQRLAQANGMTLEQYRARLEAQGVPWSVFTSDARTELMLSK 154

Query: 147 VVKNDFMLKYGNLEMEIPANKQKMK----NITVREYLIRTVLFSIPDNKLQNQGFVQKRI 202
           + + +   K    + E+       +                + +  +         QK+ 
Sbjct: 155 LREREVDGKITVSDAEVVNYIASQRGPSAAQQQDLRFQHIFIKAPTNAPQAEIEVAQKKA 214

Query: 203 KDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNP-- 260
           +   +            +  +        G   +     L  +  +   K +    NP  
Sbjct: 215 EALLQQATSGADFEKLAKNNSEANDAKKGGDLGFKAPGALPAEVVDAASKLRPGQVNPTL 274

Query: 261 YVTQKGVEYIAICDKRDLGGEIALK--------AYLSAQNTPTKIEKHEAEYVKKLRSN 311
                G E + + D+R   G  A           ++  +    K E    + ++ +R  
Sbjct: 275 IRVPDGFEIVRLVDRRQSQGTSAAAPKIVQTHVRHILLRVGEGKSEGQARQQLQDIRRQ 333



 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/287 (10%), Positives = 91/287 (31%), Gaps = 19/287 (6%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           ++G+ IT  D ++ +  +  Q+     ++  +       +K            +      
Sbjct: 160 VDGK-ITVSD-AEVVNYIASQRGPSAAQQQDL-RFQHIFIKAPTNAPQAEIEVAQKKAEA 216

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN--------------D 151
            +Q A +     +   +  +           + A  ++  +VV                 
Sbjct: 217 LLQQATSGADFEKLAKNNSEANDAKKGGDLGFKAPGALPAEVVDAASKLRPGQVNPTLIR 276

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
               +  + +      Q       +          +   + +++G  +++++D       
Sbjct: 277 VPDGFEIVRLVDRRQSQGTSAAAPKIVQTHVRHILLRVGEGKSEGQARQQLQDIRRQVEA 336

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYI 270
                     ++        G   ++   +  P+F+  +        + P  T+ G   I
Sbjct: 337 GGDFAKFARTYSQDGSASQGGDLGWISPGETVPEFERAMNNLQDGQISQPVRTEYGYHLI 396

Query: 271 AICDKRDLGGEIALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            + D+R+  G +  +  +        K E+  A+++++LR ++ + Y
Sbjct: 397 QVIDRRESEGSVQQQMDIARQAIGQRKAEQAYADWLRELRDSSYVQY 443


>gi|78067506|ref|YP_370275.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Burkholderia sp.
           383]
 gi|122070639|sp|Q39D35|SURA_BURS3 RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|77968251|gb|ABB09631.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Burkholderia sp.
           383]
          Length = 452

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/302 (13%), Positives = 98/302 (32%), Gaps = 22/302 (7%)

Query: 32  SYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVE 83
             +   ++  +   +N +VIT  ++ +R  L+  +             L    + ++++E
Sbjct: 32  GSQGAQLADEVVAVVNNDVITGRELDQRAGLIARRLQQQNAPVPPTDQLRAQVLNQMVLE 91

Query: 84  TLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSI 143
            ++ Q+ +  GI  D  TV     + A+  G++ E +   L+ QG+  + F      + +
Sbjct: 92  RIQVQKAKDDGIRIDDATVQSTLQRLAQANGMTLEQYRGRLEAQGVPWSVFTSDARTELM 151

Query: 144 WPDVVKNDFMLKYGNLEMEIPAN----KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQ 199
              + + +   K    + E+       +    +           + +  +    +    Q
Sbjct: 152 LSKLREREVDGKITVSDAEVANYIASQRGPNASQQQDLRFQHIFIKAPTNAPQADIEAAQ 211

Query: 200 KRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTN 259
           K+     +            +  +        G   +   S L     +   K +    N
Sbjct: 212 KKADALLQQAKSGADFEKLAKNNSEANDAKKGGDLGFKAPSALPADVVDAASKLRPGQVN 271

Query: 260 P--YVTQKGVEYIAICDKRDLGGEIALK--------AYLSAQNTPTKIEKHEAEYVKKLR 309
           P       G E + + D+R   G  A           ++  +    K E    + +  +R
Sbjct: 272 PTLIRVPDGFEIVRLVDRRQSQGATAAAPKIVQTHVRHILLRVGEGKSEGQARQQLADIR 331

Query: 310 SN 311
           + 
Sbjct: 332 NQ 333



 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/287 (10%), Positives = 89/287 (31%), Gaps = 19/287 (6%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           ++G+ IT  D ++    +  Q+     ++  +       +K            +      
Sbjct: 160 VDGK-ITVSD-AEVANYIASQRGPNASQQQDL-RFQHIFIKAPTNAPQADIEAAQKKADA 216

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN--------------D 151
            +Q A++     +   +  +           + A  ++  DVV                 
Sbjct: 217 LLQQAKSGADFEKLAKNNSEANDAKKGGDLGFKAPSALPADVVDAASKLRPGQVNPTLIR 276

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
               +  + +      Q       +          +   + +++G  ++++ D       
Sbjct: 277 VPDGFEIVRLVDRRQSQGATAAAPKIVQTHVRHILLRVGEGKSEGQARQQLADIRNQVEA 336

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYI 270
                     ++        G   ++   +  P+F+  +        + P  T+ G   I
Sbjct: 337 GGDFAKFARTYSQDGSASQGGDLGWISPGETVPEFERAMNNLQDGQISQPIRTEYGYHLI 396

Query: 271 AICDKRDLGGEIALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            +  +R+  G +  +  +        K E+  A+++++LR ++ + Y
Sbjct: 397 QVLSRREAEGSVQQQMDIARQAIGQRKAEQAYADWLRELRDSSYVQY 443


>gi|253701697|ref|YP_003022886.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter sp. M21]
 gi|251776547|gb|ACT19128.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter sp. M21]
          Length = 341

 Score =  124 bits (311), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 36/287 (12%), Positives = 90/287 (31%), Gaps = 13/287 (4%)

Query: 41  RIRTTINGEVITDGDISKRIALLKLQKIN------GELEKIAVQELIVETLKKQEIEKSG 94
            +   +NG+ I   ++ +   +L   +         ELEK A+ +L+   L  Q      
Sbjct: 52  EVVARVNGKEIHRNELERSKKILMAGQPGIPPYLLKELEKQALDQLVGAELMYQAGL-GL 110

Query: 95  ITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFML 154
              D + +    +   ++     + +   L   G+ +   ++Y     +  ++V      
Sbjct: 111 QIKDLDRMADAKLVQIKSGFKDQQVYEKELANIGMTEQMLREYSRRDLVIANLVNTKLAA 170

Query: 155 KYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
                ++EI            ++  +R     I  +        +K    AE     + +
Sbjct: 171 DLQVTDLEIEKFYADNPERFEQKEQVRASHILIGCDSKGTAEEKKKARDKAERLLKEVKE 230

Query: 215 DCNKLE---KFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYI 270
             +  +   + ++     + G   Y     + P F+           ++   T  G   +
Sbjct: 231 GADFAKLARENSTCPSATNGGDLGYFPRGKMVPPFEEAAFALKSGEVSDVVETGFGFHLV 290

Query: 271 AICDKRDLG--GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
              D+           +  + A     K  +  A ++ + + +A I 
Sbjct: 291 KQTDRIKAEKVSLATAREKIVAYLKSQKTGEVVASFIGRAKQDAKIE 337


>gi|306838742|ref|ZP_07471576.1| Chaperone surA precursor [Brucella sp. NF 2653]
 gi|306406144|gb|EFM62389.1| Chaperone surA precursor [Brucella sp. NF 2653]
          Length = 317

 Score =  124 bits (311), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 69/314 (21%), Positives = 132/314 (42%), Gaps = 10/314 (3%)

Query: 11  DFIKLLTTYFVLIIFCIVPIVSYKSWA---MSSRIRTTINGEVITDGDISKRIALLKLQK 67
            F + L    +    C+  + +  + A     S ++  ++G  IT+ DI  R+A LKLQ+
Sbjct: 1   MFARPLIASLLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQR 60

Query: 68  INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
            +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +++ 
Sbjct: 61  KSGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQS 120

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI 187
           G+   HFK+Y+ +Q  W  +V   F       E E      K                  
Sbjct: 121 GVTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVIF 180

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF- 246
                +    +  + +    +     ++C+   + A  I DV++     ++E  L  ++ 
Sbjct: 181 VVPASKRSPALLAKRRQEANALRARFQNCDSTRQQAKGILDVTVRDLGRIIEPQLPGEWS 240

Query: 247 QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ------NTPTKIEKH 300
           +++     N TT P+ T+KGVE++A+C  R +  +   +   S +          K E+ 
Sbjct: 241 KDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKAEEL 300

Query: 301 EAEYVKKLRSNAII 314
             +YV++LR  A I
Sbjct: 301 SKKYVQELREKATI 314


>gi|254480950|ref|ZP_05094196.1| SurA N-terminal domain family protein [marine gamma proteobacterium
           HTCC2148]
 gi|214038745|gb|EEB79406.1| SurA N-terminal domain family protein [marine gamma proteobacterium
           HTCC2148]
          Length = 425

 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 38/312 (12%), Positives = 105/312 (33%), Gaps = 12/312 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK----- 67
           IK +     L    +   ++     M  ++   +  ++I   ++ +R+  +         
Sbjct: 3   IKAMLLGTCLTASALATGLARAETQMLDQVIAVVEDDIIMASELRERMTSVTENISTRGV 62

Query: 68  ---INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +  LI+E+++ Q+  + G+      +N    + A   GLS + F   L
Sbjct: 63  EMPPEDVLIRETLDRLILESIQMQKGARVGVRISDTQLNGAMQRVAAQNGLSLDQFRMAL 122

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
           ++QG      ++ +  + I   V + +   +    E E+       +   + +   + + 
Sbjct: 123 EQQGQSYQVMREQIRKELIIQRVQQGNVNQRIEITEQEVENFLATEEGQKLTQPEYQIMH 182

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFAS-KIHDVSIGKAQYLLESDLH 243
             +  +       V++           +       E  ++   ++ + G   +    DL 
Sbjct: 183 ALLAVSPGAPAAEVERAEAYVTRLLEEISAGAPFDEVVSAPGPYNFTGGNLGWRKLDDLP 242

Query: 244 PQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
             F ++        T    +  G   + + D+R   ++        ++  + +    +  
Sbjct: 243 SLFSDVAPGLSKGKTTLVKSDSGFHLVHMADRRGGENMMVSQTKVRHILVKPSEIMTDGQ 302

Query: 301 EAEYVKKLRSNA 312
               V  L++ A
Sbjct: 303 AKALVTSLKARA 314



 Score = 95.5 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/281 (10%), Positives = 85/281 (30%), Gaps = 16/281 (5%)

Query: 46  INGEV-ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           +N  + IT+ ++   +A  + QK+     +      I+  L            +      
Sbjct: 150 VNQRIEITEQEVENFLATEEGQKLTQPEYQ------IMHALLAVSPGAPAAEVERAEAYV 203

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQS------IWPDVVKNDFMLKYGN 158
             +    + G   ++  S          +               + P + K    L   +
Sbjct: 204 TRLLEEISAGAPFDEVVSAPGPYNFTGGNLGWRKLDDLPSLFSDVAPGLSKGKTTLVKSD 263

Query: 159 LEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK 218
               +     +     +     +     +  +++   G  +  +   +          + 
Sbjct: 264 SGFHLVHMADRRGGENMMVSQTKVRHILVKPSEIMTDGQAKALVTSLKARAEDGEDFADL 323

Query: 219 LEKFASKI-HDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKR 276
             +++  I      G   +     + P+F+  ++ +     ++P  +Q G   + + D+R
Sbjct: 324 AREYSEDIGSAQEGGDLGWTDPGQMVPEFEQTMQITAVGEISDPVKSQFGWHVLEVLDRR 383

Query: 277 DLG-GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           D    + A K          K ++    +++++R  A +  
Sbjct: 384 DEDMTDTATKNMAMNYLHNRKYQEELDAWLRQIRDEAFVDI 424


>gi|238752276|ref|ZP_04613756.1| Chaperone surA [Yersinia rohdei ATCC 43380]
 gi|238709544|gb|EEQ01782.1| Chaperone surA [Yersinia rohdei ATCC 43380]
          Length = 434

 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/296 (12%), Positives = 106/296 (35%), Gaps = 16/296 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   +    ++ +     ++   ++  V+   D+   +  +KL            G L
Sbjct: 7   LILGLVVCANTAFAAPQEVDKVAAVVDNGVVLQSDVDGLLQSVKLNAQQAGQQVPDDGTL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ +  Q  +K GIT     ++      A    ++     S L   G+  +
Sbjct: 67  RHQVLERLIMDNILLQMAKKMGITVSDEALDKAIADIAAQNRMTPAQMRSRLAADGLNYD 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            +++ +  + +  +V  N+   +   L  E+ +  +++ N T  +  +      IP  + 
Sbjct: 127 TYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQIGNQTSGDAELNLSHILIPLPEN 186

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +Q  V +  + A++    +    +        ++    +  G+  +    +L   F + 
Sbjct: 187 PSQQQVDQAEELAKKLASDIKAGADFGKLAIANSADSQALKGGQMGWGKLQELPSLFAER 246

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKH 300
           L    + +   P  +  G   + + D R     +        ++  + +P   +  
Sbjct: 247 LQSAKKGDIVGPIRSGVGFHILKVNDIRGADKTVSVTELHARHILLKPSPVMTDDQ 302



 Score = 81.3 bits (198), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 17/140 (12%), Positives = 43/140 (30%), Gaps = 3/140 (2%)

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLL 238
               +   P   + +     K    A + +          ++ +      +  G   +  
Sbjct: 286 HARHILLKPSPVMTDDQARAKLSAAAADIKSGKASFATIAKEISQDPGSAMQGGDLGWAS 345

Query: 239 ESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDL-GGEIALKAYLSAQNTPTK 296
                P F++ + K  +   + P  +  G   I + D R +   + A K          K
Sbjct: 346 PDIYDPAFRDAVMKLQKGEISAPVHSSFGWHLIQLVDSRQVDKTDAAQKDRAYRMLFSRK 405

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
             +    ++++ R+ A +  
Sbjct: 406 FAEEAQTWMQEQRAAAYVKI 425


>gi|83591773|ref|YP_425525.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodospirillum
           rubrum ATCC 11170]
 gi|83574687|gb|ABC21238.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodospirillum
           rubrum ATCC 11170]
          Length = 444

 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 53/313 (16%), Positives = 116/313 (37%), Gaps = 10/313 (3%)

Query: 8   SLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALL---- 63
           +L   + +    +V ++ C  P+ + ++   + RI   +N + ++  D++ RI ++    
Sbjct: 26  ALGRLLGIALLAWVAVLGCGWPVHTAQAAVPTQRIAAVVNEDAVSLYDLNARIDIVMATG 85

Query: 64  ---KLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
                 ++   L    ++ LI ETLK QE +++ +T  +  +N    +  R   L     
Sbjct: 86  GMPNSPEVRQRLAPQILRALIDETLKIQEAKRANVTVSTEDINGGIERLERQNKLPPGGL 145

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180
                  G+        +  +  W   V++    +    E EI   +Q ++    +   +
Sbjct: 146 EKAFKAAGLDQQSLIHQIRAELGWIKAVQSTLGPRVNVSEDEISLYQQNLQRNLGKPEYL 205

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLES 240
              +F   DN  Q+   +    +  E+ RL         ++F+        G   ++   
Sbjct: 206 VADIFLPVDNAAQDAEVLTAAQRMIEQMRL-GANFAALAQQFSRGPAAQRGGDLGWVGPG 264

Query: 241 DLHPQ-FQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKI-E 298
           ++  +  Q L   +  N + P  T  G   + + D+R   G  +    +S    P +   
Sbjct: 265 EIDAEVLQALGAMAPGNLSQPIRTFGGYHILLLRDQRIASGGASSLLKMSRIVIPLRGPR 324

Query: 299 KHEAEYVKKLRSN 311
               E +  LR  
Sbjct: 325 MPTPERLADLRQR 337



 Score = 51.6 bits (121), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 32/86 (37%), Gaps = 3/86 (3%)

Query: 232 GKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSA 290
           G    +  + L  + QN+++       + P         + ICD+    G +  +  L  
Sbjct: 359 GSMGSIDPARLPAEAQNVIRDLPAGQPSTPLTMDNAEIRLMICDR--PTGGLPGRDILRE 416

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIHY 316
           +    K++      ++ LR  AII  
Sbjct: 417 RLIEQKLQNLAQRRLRDLRQQAIIDI 442


>gi|220932946|ref|YP_002509854.1| peptidil-prolyl cis-trans isomerase [Halothermothrix orenii H 168]
 gi|219994256|gb|ACL70859.1| peptidil-prolyl cis-trans isomerase [Halothermothrix orenii H 168]
          Length = 332

 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 43/338 (12%), Positives = 99/338 (29%), Gaps = 41/338 (12%)

Query: 11  DFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI-- 68
            F + +  +  L++     +++      +  I   ++G+ IT  ++ +      +     
Sbjct: 2   RFRRSVFLFLALVLVISFSVLAEDKVEKTDNIAAVVDGKEITISEVDEYARTRDVIMQLY 61

Query: 69  -------------------NGELEKIAVQELIVETLKKQEIEKSGITFDSNTV----NYF 105
                                E  K+ + ELI   L  +E +  GI      +    N  
Sbjct: 62  QANGEFTQLILSTEAGNELINEYRKLKLDELITRELLIKEAKNQGINVSKEEMDKIFNEQ 121

Query: 106 FVQHARNTGLSAEDFSSFLDKQG----IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEM 161
                +   ++ E     L++QG        +         +  + ++   M      E 
Sbjct: 122 IEMVKQKNNINEEQLLQALNQQGIESLDQYKNLFFEQNGDLLLINKLREKVMEDVSVEES 181

Query: 162 EIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK 221
            +       K        I+                 +K  ++               ++
Sbjct: 182 AVREYYDNNKENFKHGTQIKARHIL---------VETEKEAREILNELENGADFGEMAKE 232

Query: 222 FASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDK--RDL 278
           +++     + G   Y  +  + P+F+           ++P  TQ G   I + DK    +
Sbjct: 233 YSTGPSSKNGGDLGYFGKGRMVPEFEEAAFALKVGQISDPVKTQYGYHIIKVEDKVEEGI 292

Query: 279 GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                +K  +       K +     ++K+LR  A I  
Sbjct: 293 TPFDEVKDKIKNNLLQQKQQTAWNNFLKELRDKAEIEI 330


>gi|261493819|ref|ZP_05990333.1| peptidylprolyl isomerase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261495044|ref|ZP_05991511.1| peptidylprolyl isomerase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261309286|gb|EEY10522.1| peptidylprolyl isomerase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261310522|gb|EEY11711.1| peptidylprolyl isomerase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 314

 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 51/316 (16%), Positives = 107/316 (33%), Gaps = 17/316 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +KL+ + F + +  +   ++  + A   R+   +N   I    + +   +L  +K     
Sbjct: 1   MKLVKSLFAVAVATMS--LTQTAHAFEERVVALVNDTPIMQSQVQR---VLGKKKATETA 55

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           ++ A+ ++I + L +Q ++++G+      VN      A   G++       LD QGI   
Sbjct: 56  QRAAIDQVIDDMLVQQAMKEAGVKVSPAAVNQAVENVAIQNGITYGQLLDALDYQGITLE 115

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITV---------REYLIRTV 183
            FK+ +A Q     V              ++ A  +++               +    + 
Sbjct: 116 QFKRNIAQQMAMEQVRHISISKSIQVAPQQVQALAKELMAKDKAAGKLKTVSGKEHRISH 175

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLESDL 242
           +    +  L +     K      +            +  +         G   +      
Sbjct: 176 ILLKTNPILNDAQAKAKLSSLTADINSGKISFEEAAKAHSVDYASGTDGGDLGFNFLEIY 235

Query: 243 HPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKH 300
            P F N+  K   N  + P+ +Q G   + + D R+              Q    + E+ 
Sbjct: 236 DPAFANVASKIKPNQISAPFKSQFGWHILKVTDTRNGDRTEDAYHQRAYQQLVNKQAEEA 295

Query: 301 EAEYVKKLRSNAIIHY 316
             ++VK LR  A I Y
Sbjct: 296 SKDWVKALRKTANIQY 311


>gi|158521718|ref|YP_001529588.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Desulfococcus
           oleovorans Hxd3]
 gi|158510544|gb|ABW67511.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Desulfococcus
           oleovorans Hxd3]
          Length = 316

 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 42/307 (13%), Positives = 103/307 (33%), Gaps = 18/307 (5%)

Query: 27  IVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL------------EK 74
           +    +     +  RI   +N E+I   ++ K +AL +      +L             +
Sbjct: 7   LTSCRADTEAEVVDRIVAFVNQEIILLSELEKAMALYETAIRERQLPADTEKEMLYRARQ 66

Query: 75  IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF 134
             +  LI   L +Q  ++ G+T D   V+    +  R+   + ED    L ++G     +
Sbjct: 67  EMIDHLIDRRLIQQRADELGVTVDDREVDDAMERMKRSMLFTDEDLRQSLAEKGYTLEGY 126

Query: 135 KQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIR---TVLFSIPDNK 191
           +  L  Q +   V+  +   K     ++I A  +                 ++    D  
Sbjct: 127 RNELREQILRQRVLTLEVKSKVVVTPVDIQAYYETHPEEYSAGRQYHLRNIIMRVDKDMP 186

Query: 192 LQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLK 251
            +++  + + ++   +             +++        G   +    DL PQ +  ++
Sbjct: 187 DESKKTISEMMQKIHDRLQAGESFETLASQYSQSSFAEKGGDLGFFALEDLAPQLREAIE 246

Query: 252 K-SQNNTTNPYVTQKGVEYIAICDK--RDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKL 308
           +      T    T  G + + + +   +           +  +     +E+   ++V +L
Sbjct: 247 ELQAGEFTPVLDTPLGYQILYLEEIQEKPAVSLEKATDEIREKLYEDLLEERFEKWVTEL 306

Query: 309 RSNAIIH 315
           R  + I 
Sbjct: 307 REKSHIK 313


>gi|271502081|ref|YP_003335107.1| Peptidylprolyl isomerase [Dickeya dadantii Ech586]
 gi|270345636|gb|ACZ78401.1| Peptidylprolyl isomerase [Dickeya dadantii Ech586]
          Length = 430

 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/303 (12%), Positives = 103/303 (33%), Gaps = 16/303 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   +   +++ +    ++I   ++  V+ + DI+  +  +KL              L
Sbjct: 7   LVLGLALSANMAFAAPQEVNKIAAVVDNSVVLESDINSLLQSVKLNAQEAGQQLPDDATL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ +  Q  +K G+      ++      A    +S +   S L  +G+  +
Sbjct: 67  RHQILERLIMDNIIMQMAQKMGVQVTDEQLDRSITNIAAQNHMSLDQLRSRLAAEGVSFD 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            ++  +    +  DV  ++   +   L  E+ A  Q++ +       +      IP  + 
Sbjct: 127 TYRSQIRKDMMIADVRNSEVRRRVTVLPQEVDALAQQLASQGANGPEVNLSQILIPLPEN 186

Query: 193 QNQGFVQKRIKDAE---ESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
             Q  V K    A    +   +          +++    +  G+  +    +L   F + 
Sbjct: 187 PTQDQVDKAESLANRLVKEASQGADFGKLAITYSADPQALKGGQMGWGRPQELPSLFAER 246

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRD----LGGEIALKAYLSAQNTPTKIEKHEAEY 304
           L    +     P  +  G   + + D R     +        ++    +    +      
Sbjct: 247 LANPQKGQIIGPIRSGVGFHILRVNDTRGGSQAVSVTEVHARHILLTTSVVMNDAQAKAK 306

Query: 305 VKK 307
           +++
Sbjct: 307 LEE 309



 Score = 85.1 bits (208), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 16/140 (11%), Positives = 41/140 (29%), Gaps = 3/140 (2%)

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLL 238
               +       + +     K  + A + R          ++ +         G   +  
Sbjct: 286 HARHILLTTSVVMNDAQAKAKLEEVASQIRSGKLSFAAAAKQLSQDPGSANQGGDLGWAS 345

Query: 239 ESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKRDL-GGEIALKAYLSAQNTPTK 296
                P F++  +   +   + P  +  G   I + D R +   + A K          K
Sbjct: 346 PDMYDPAFRDALMDLKKGEISAPVHSSFGWHLIQLLDTRQVDKTDAAQKDRAYRMLFNRK 405

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
             +    ++++ R+ A +  
Sbjct: 406 FAEEAQTWMQEKRAAAYVKI 425


>gi|85713800|ref|ZP_01044790.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Nitrobacter sp.
           Nb-311A]
 gi|85699704|gb|EAQ37571.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Nitrobacter sp.
           Nb-311A]
          Length = 305

 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 42/313 (13%), Positives = 92/313 (29%), Gaps = 47/313 (15%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDI---SKRIALL 63
           T  S  ++L ++     +  ++ + +    A +  +   +NG  I   D+    + +   
Sbjct: 8   TKHSLRVRLASSALGGCLAAVLFVGTPVHAADADPVLAKVNGTEIHQSDVNLAEQELGPS 67

Query: 64  KLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSF 123
             Q      ++  +  LI   +  +  E+  I                            
Sbjct: 68  LAQMDPAAKQENILSFLIDMKIITKAAEEKKIENSEEFKKRL------------------ 109

Query: 124 LDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTV 183
                        +   + +   ++ +       +  M+        +  + +E   R +
Sbjct: 110 ------------AFARDRLLMDRLLASQGKAAITDDAMKTVYADASKQITSEQEVHARHI 157

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLH 243
           L    D   + +G ++K                   +K +        G   +  +  + 
Sbjct: 158 LVPTEDEAKKIEGELKK-----------GADFAELAKKESKDPGASDGGDLGFFTKEQMV 206

Query: 244 PQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEA 302
           P+F +          ++P  TQ G   I + +KR           +  Q       K +A
Sbjct: 207 PEFSKVAFALEPGKISDPVKTQFGWHIIKVEEKRARKA--PDFDQVKPQIEQFVTRKAQA 264

Query: 303 EYVKKLRSNAIIH 315
           EYV KLR  A I 
Sbjct: 265 EYVAKLRETAKIE 277


>gi|238795196|ref|ZP_04638783.1| Chaperone surA [Yersinia intermedia ATCC 29909]
 gi|238725483|gb|EEQ17050.1| Chaperone surA [Yersinia intermedia ATCC 29909]
          Length = 434

 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 36/301 (11%), Positives = 108/301 (35%), Gaps = 16/301 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--------EL 72
           +++   +    ++ +     ++   ++  V+   D+   +  +KL              L
Sbjct: 7   LILGLVVCANTAFAAPQEVDKVAAVVDNGVVLQSDVDGLLQSVKLNAQQSGQQVPDDATL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ ++ Q  +K GIT +   ++      A    ++     S L   G+  +
Sbjct: 67  RHQILERLIMDNIQLQMAKKMGITINDEALDKAIADIAAQNRMTTAQMRSRLAADGLNYD 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            +++ +  + +  +V  N+   +   L  E+ +  +++ N T  +  +      IP  + 
Sbjct: 127 TYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQIGNQTSGDAELNLSHILIPLPEN 186

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +Q  V +  + A +    +    +        ++    +  G+  +    +L   F + 
Sbjct: 187 PSQQQVDQAEELATKLVSDIKSGADFGKLAIANSADSQALKGGQMGWGKLQELPSLFAER 246

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKHEAEY 304
           L   ++ +   P  +  G   + + D R     +        ++  + +P   +      
Sbjct: 247 LQSANKGDVVGPIRSGVGFHILKVNDIRGADKTISVTEVHARHILLKPSPVMTDDQARTK 306

Query: 305 V 305
           +
Sbjct: 307 L 307



 Score = 82.4 bits (201), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 25/168 (14%), Positives = 54/168 (32%), Gaps = 4/168 (2%)

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
                G   +++   +   K I+V E   R +L         +Q    K    A + +  
Sbjct: 259 IRSGVGFHILKVNDIRGADKTISVTEVHARHILLKPSPVMTDDQART-KLAAAAADIKSG 317

Query: 212 LPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEY 269
                   ++ +      V  G   +       P F++  +K  +   + P  +  G   
Sbjct: 318 KSSFATIAKEISQDPGSAVQGGDLGWASPDIYDPAFRDALMKLQKGEISAPVHSSFGWHL 377

Query: 270 IAICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           I + D R +   + A K          K  +    ++++ R+ A +  
Sbjct: 378 IQVVDTRQVDKTDAAQKDRAYRMLFSRKFAEEAQTWMQEQRAAAYVKI 425


>gi|90411942|ref|ZP_01219950.1| putative survival protein SurA [Photobacterium profundum 3TCK]
 gi|90327200|gb|EAS43572.1| putative survival protein SurA [Photobacterium profundum 3TCK]
          Length = 434

 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/314 (12%), Positives = 112/314 (35%), Gaps = 15/314 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +K      + I    +   S  +     ++ T +N  VI   D++  +  +++       
Sbjct: 1   MKKWKISLLGIAIWSLAASSMAAPKELDKVVTLVNDSVILQSDVNAMLQTVRINAAEQNQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI+ETL+ Q+ E+ GI  D   ++    + A+   L+       L
Sbjct: 61  PLPDNALLTEQVMEKLIIETLQLQQAEQFGIRIDDTRLDQAVAEIAKERELTIPQLQQEL 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
           +K GI  + F++ +       +        +   L  E+    +++   T++        
Sbjct: 121 EKSGISYSIFREQMRRDMTASEARTIQVRRRINILPQEVDMLAEQLNKQTLQTVQFNISH 180

Query: 185 FSIPDNKLQN---QGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESD 241
             +   +      +   Q++ +   +         N    ++     +  G+  ++ + +
Sbjct: 181 IQLRVEEGATKVQREETQQQAQQLVDELKNGADFANLAYSYSKGPKALQGGEWGWMRQEE 240

Query: 242 LHPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKI 297
           +   F + +K + +     P+ +  G   I + D +    +        ++  + +    
Sbjct: 241 MPTIFADQIKSNGKGAIIGPFRSGVGYHIIKVNDVKGLETVSVTEVNARHILIKTSVILS 300

Query: 298 EKHEAEYVKKLRSN 311
           +      ++K R +
Sbjct: 301 DDGAKRQLEKARQD 314



 Score = 85.1 bits (208), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/273 (12%), Positives = 83/273 (30%), Gaps = 9/273 (3%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++      L  Q +      I+  +L VE     ++++      +  +       A
Sbjct: 154 ILPQEVDMLAEQLNKQTLQTVQFNISHIQLRVEEG-ATKVQREETQQQAQQLVDELKNGA 212

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
               L+          QG      +Q          +  N      G     +  +  K+
Sbjct: 213 DFANLAYSYSKGPKALQGGEWGWMRQEEMPTIFADQIKSNGKGAIIGPFRSGVGYHIIKV 272

Query: 171 KNITV------REYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFAS 224
            ++         E   R +L         +    Q      +    R        +  + 
Sbjct: 273 NDVKGLETVSVTEVNARHILIKTSVILSDDGAKRQLEKARQDILAGRQTFADEAQKLSSD 332

Query: 225 KIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLG-GEI 282
                + G+  +       P+F++ ++   +   + P+ T  G   + + ++R++   + 
Sbjct: 333 PGSAANGGELGWQTPDLYVPEFKDKVETLPKGTISEPFKTVHGWHIVEVLERRNVDRTDA 392

Query: 283 ALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           A+K          K  +    ++++LR+ A I 
Sbjct: 393 AVKNRAYRILFSRKFNEEAQAWLQELRAGAYIE 425


>gi|189423767|ref|YP_001950944.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter lovleyi
           SZ]
 gi|189420026|gb|ACD94424.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter lovleyi
           SZ]
          Length = 355

 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 39/300 (13%), Positives = 94/300 (31%), Gaps = 17/300 (5%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING---------ELEKIAVQELIVET 84
                 + +   +N ++IT  ++ +    +                 L  + +  LI + 
Sbjct: 49  AGAKRINGVAAIVNDDIITFREVLRESQAVIQDAQKKGLVDDTARHNLRVMVLDRLIEKL 108

Query: 85  LKKQEIEKSGITFDSNTVNYFFVQHA-RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSI 143
           L +Q+I++ GI    + +         +N  ++     + L  QG     ++  L  Q  
Sbjct: 109 LTEQKIKELGIKIGDDEIRQAIDDVKRQNNNMTQSQLEAALKSQGYTFAQYEVQLREQLE 168

Query: 144 WPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIK 203
              +V  +   K    E E     Q   +    E   +     I  ++      +Q+ + 
Sbjct: 169 RLRLVSMEVRSKIYVSEKEAEEYYQSHLSSYAEEETFKASHIFIKVDEKAPADQIQQAMN 228

Query: 204 DAEESRL---RLPKDCNKLEKFASKIHDVS-IGKAQYLLESDL-HPQFQNLLKKSQNNTT 258
            A +      +         +++         G        ++     + +L        
Sbjct: 229 KALKVLFEARQGKDFAQLAREYSDDAAAKKDGGSLGTFKRGEMLADLEKAILPLKPGEVG 288

Query: 259 NPYVTQKGVEYIAICDK--RDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
               T  G+  + + ++    +     +KA +S      K +     ++K+LR+ A I  
Sbjct: 289 ELVSTPSGLHIVKLDERSSGKVKPFETVKADISDLLYRQKQDSRFTSWMKELRTKASIEI 348


>gi|254718820|ref|ZP_05180631.1| Chaperone surA precursor [Brucella sp. 83/13]
 gi|265983805|ref|ZP_06096540.1| SurA domain-containing protein [Brucella sp. 83/13]
 gi|264662397|gb|EEZ32658.1| SurA domain-containing protein [Brucella sp. 83/13]
          Length = 318

 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 69/314 (21%), Positives = 132/314 (42%), Gaps = 10/314 (3%)

Query: 11  DFIKLLTTYFVLIIFCIVPIVSYKSWA---MSSRIRTTINGEVITDGDISKRIALLKLQK 67
            F + L    +    C+  + +  + A     S ++  ++G  IT+ DI  R+A LKLQ+
Sbjct: 2   MFARPLIASLLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQR 61

Query: 68  INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
            +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +++ 
Sbjct: 62  KSGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQS 121

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI 187
           G+   HFK+Y+ +Q  W  +V   F       E E      K                  
Sbjct: 122 GVTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVIF 181

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF- 246
                +    +  + +    +     ++C+   + A  I DV++     ++E  L  ++ 
Sbjct: 182 VVPASKRSPALLAKRRQEANALRARFQNCDSTRQQAKGILDVTVRDLGRIIEPQLPGEWS 241

Query: 247 QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ------NTPTKIEKH 300
           +++     N TT P+ T+KGVE++A+C  R +  +   +   S +          K E+ 
Sbjct: 242 KDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKAEEL 301

Query: 301 EAEYVKKLRSNAII 314
             +YV++LR  A I
Sbjct: 302 SKKYVQELREKATI 315


>gi|251793857|ref|YP_003008589.1| SurA [Aggregatibacter aphrophilus NJ8700]
 gi|247535256|gb|ACS98502.1| SurA [Aggregatibacter aphrophilus NJ8700]
          Length = 308

 Score =  124 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 47/310 (15%), Positives = 104/310 (33%), Gaps = 19/310 (6%)

Query: 20  FVLIIFCIVPIVSY-KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQ 78
              + F  V I++   +     ++  T+NG  + +  +                 + A+ 
Sbjct: 3   LKSVFFSAVGILALVANVQAEEKVVATVNGIPVLESQVQ------SALNKKTNNRQAALN 56

Query: 79  ELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYL 138
           ++I + L  Q +++SG+  ++  V+      A   GL+       LD QGI    ++Q +
Sbjct: 57  KVIDDILVDQAVQESGVKVNNAQVDKIIEGIAAQNGLTFGQLLDALDYQGISYRAYRQQI 116

Query: 139 AIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITV---------REYLIRTVLFSIPD 189
           A Q +  +V  +           ++ A  +KM +                    +    +
Sbjct: 117 AQQVMMSEVRNHAISQSVDISREQVEALAKKMLDEAKSKGSVAKVSDTQYEVRHILLKLN 176

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQY-LLESDLHPQFQ 247
             L +     +  +   +         +   K++       + G   Y   E  + P  Q
Sbjct: 177 PLLNDAQAKAQLEQIRADIIAGKMTFADAALKYSKDYLSGANGGSLGYAFPEMYVGPFNQ 236

Query: 248 NLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKHEAEYVK 306
            +    Q   + P+ T+ G   + + + R               Q    +++    ++V+
Sbjct: 237 AIRTTKQGVISAPFKTEFGWHILEVTNTRQGDRTEDAYRQKAYEQIVNQQLQDSARDWVQ 296

Query: 307 KLRSNAIIHY 316
            LR  A I Y
Sbjct: 297 ALRKRADIKY 306


>gi|54307618|ref|YP_128638.1| putative survival protein SurA [Photobacterium profundum SS9]
 gi|81697526|sp|Q6LV39|SURA_PHOPR RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|46912041|emb|CAG18836.1| putative survival protein SurA [Photobacterium profundum SS9]
          Length = 434

 Score =  124 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/314 (12%), Positives = 115/314 (36%), Gaps = 15/314 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +K   +  + I    +   S  +     ++ T +N  VI   D++  +  +++       
Sbjct: 1   MKKWKSSLLGIAIWSLAASSMAAPKELDKVVTLVNDSVILQSDVNAMLQTVRINAAEQNQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI+ETL+ Q+ E+ GI  D   ++    + A+   L+       L
Sbjct: 61  PLPDDALLTEQVMEKLIIETLQLQQAEQFGIRIDDTRLDQAVAEIAKERELTIPQLQKEL 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
           +K GI  + F++ +       +        +   L  E+    +++   T++        
Sbjct: 121 EKSGISYSIFREQMRRDMTASEARTIQVRRRINILPQEVEMLAEQLNKQTLQTVQFNISH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE---KFASKIHDVSIGKAQYLLESD 241
             +   +   +   ++  + A++    L    +       ++     +  G+  ++ + +
Sbjct: 181 IQLRVEEGATKEQREETQQQAQQIVDELKNGADFANLAYSYSKGPKALQGGEWGWMRQEE 240

Query: 242 LHPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKI 297
           +   F + +K + +     P+ +  G   I + D +    +        ++  + +    
Sbjct: 241 MPTIFADQIKSNGKGAIIGPFRSGVGYHIIKVNDVKGLETVSVTEVNARHILIKTSVILS 300

Query: 298 EKHEAEYVKKLRSN 311
           +      ++K R +
Sbjct: 301 DDGAKRQLEKARQD 314



 Score = 84.7 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/273 (12%), Positives = 87/273 (31%), Gaps = 9/273 (3%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVE----TLKKQEIEKSGITFDSNTVNYFF 106
           I   ++      L  Q +      I+  +L VE      +++E ++          N   
Sbjct: 154 ILPQEVEMLAEQLNKQTLQTVQFNISHIQLRVEEGATKEQREETQQQAQQIVDELKNGAD 213

Query: 107 VQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPD--VVKNDFMLKYGNLEMEIP 164
             +   +           +   +         A Q        +   F    G   +++ 
Sbjct: 214 FANLAYSYSKGPKALQGGEWGWMRQEEMPTIFADQIKSNGKGAIIGPFRSGVGYHIIKV- 272

Query: 165 ANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFAS 224
            + + ++ ++V E   R +L         +    Q      +    R        +  + 
Sbjct: 273 NDVKGLETVSVTEVNARHILIKTSVILSDDGAKRQLEKARQDILAGRQTFADEAQKLSSD 332

Query: 225 KIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLG-GEI 282
                + G+  +       P+F++ ++   +   + P+ T  G   + + D+R++   + 
Sbjct: 333 PGSAANGGELGWQTPDLYVPEFKDKIETLPKGTISEPFKTVHGWHIVEVLDRRNVDRTDA 392

Query: 283 ALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           A+K          K  +    ++++LR+ A I 
Sbjct: 393 AMKNRAYRILFSRKFNEEAQAWLQELRAGAYIE 425


>gi|109899724|ref|YP_662979.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudoalteromonas
           atlantica T6c]
 gi|122070658|sp|Q15QB3|SURA_PSEA6 RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|109702005|gb|ABG41925.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudoalteromonas
           atlantica T6c]
          Length = 431

 Score =  124 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 38/312 (12%), Positives = 101/312 (32%), Gaps = 15/312 (4%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--- 71
           +  T     +   +   ++        +   ++  V+ +  I + +  +K   +      
Sbjct: 1   MKLTVVTFALLAFISFNTFAKQVRLDNVAVIVDQGVVLESQIEELVNTVKRNALTNNQTL 60

Query: 72  -----LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDK 126
                L   A++ LIV++L+ Q  E+ GI      ++      AR  G + ED    L  
Sbjct: 61  PSDRVLRTQAIERLIVDSLQNQMAERMGIQISDPQLDQTIDNIAREDGTTVEDLRKNLAS 120

Query: 127 QGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
           +G+    +++ +  + +  +V + +   +      EI      +     ++         
Sbjct: 121 EGVSFEVYREQVRKELVTGEVRRANVRRRIYITPQEISNLVTLIDEQGGQQAEYHLGHIL 180

Query: 187 IPDNKLQNQGFVQKRIK---DAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLH 243
           I          V K         E      +        +S    +  G   ++  + + 
Sbjct: 181 IGFPPEPTDEDVSKAKDTAEKVLELLNNGSEFAKIATASSSGSKALEGGDLGWMNINSMP 240

Query: 244 PQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK---AYLSAQNTPTKIEK 299
             F + +   S+++   P  +  G   + I D R +      +    ++  + +    ++
Sbjct: 241 TLFAEAVQGTSKDDLIGPIRSGAGFHVLKIIDFRGIEKVEVAELKSRHILIKPSVILSDE 300

Query: 300 HEAEYVKKLRSN 311
              + + + R  
Sbjct: 301 KAEKMLTEFRKE 312



 Score = 81.6 bits (199), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 17/137 (12%), Positives = 44/137 (32%), Gaps = 3/137 (2%)

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLES 240
             +   P   L ++   +   +  +E            ++ ++     +  G   +   +
Sbjct: 287 RHILIKPSVILSDEKAEKMLTEFRKELLAGEADFAELAKEHSADPGSALRGGDLGWADPN 346

Query: 241 DLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-AYLSAQNTPTKIE 298
              P F++ L+       + P  +  G   + + DKR        K           K  
Sbjct: 347 VYVPAFRDTLQSLEVGEISQPVRSTHGWHLMQLMDKRVQDATEKRKEDKAYQLLFQRKFA 406

Query: 299 KHEAEYVKKLRSNAIIH 315
           +    ++K++R +A + 
Sbjct: 407 EETEAWLKEMRDSAYVE 423


>gi|119504985|ref|ZP_01627062.1| Parvulin-like peptidyl-prolyl isomerase [marine gamma
           proteobacterium HTCC2080]
 gi|119459271|gb|EAW40369.1| Parvulin-like peptidyl-prolyl isomerase [marine gamma
           proteobacterium HTCC2080]
          Length = 436

 Score =  124 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 36/322 (11%), Positives = 109/322 (33%), Gaps = 11/322 (3%)

Query: 3   SKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIAL 62
           SK     + ++  L      +   ++   +        ++   ++ ++I   ++ +R+ L
Sbjct: 5   SKAMLMSTLYLPRLAATLATLACIVLAPWANAQIQTLDKVVAIVDDDIILATELQERLLL 64

Query: 63  LKLQKINGE--------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTG 114
           ++      +        L +  +  LI+E+++ Q   + G+      ++    + A  + 
Sbjct: 65  IQRNIEQRQIDAPPDEVLARETLDRLILESIQLQLANRYGVRIPDAQLDAAMARMASGSN 124

Query: 115 LSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNIT 174
            + E F + ++  G      ++ +  + +   V + +        E E+           
Sbjct: 125 YTLEQFRAAVEANGQSYLAMREEIRREMMIQRVQQGNVSRNIEISEQEVDNFLSTEAGAE 184

Query: 175 VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFA-SKIHDVSIGK 233
           + +   R +   +  +K  ++   QK+    +     +    +  E  +  + +    G 
Sbjct: 185 MTQPEFRVIQALVEVSKKDSKADRQKKEDFVDGILASILAGKDFPEAVSVIEPYVFKGGD 244

Query: 234 AQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDK--RDLGGEIALKAYLSAQ 291
             +     +   F  ++   +   T    +  G   + + D+  R+   E     ++  +
Sbjct: 245 LGWKKLDAIPSMFAAVIPSLKVGDTAKVASGAGFHLVYLADERGRERLVEQTEVRHILIK 304

Query: 292 NTPTKIEKHEAEYVKKLRSNAI 313
            T    E        +LR  A+
Sbjct: 305 PTEVLDEDAAIALATELRQRAM 326



 Score = 91.3 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 22/272 (8%), Positives = 78/272 (28%), Gaps = 4/272 (1%)

Query: 48  GEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFV 107
              I++ ++   ++  +      + E   +Q L+  + K  + ++       + +    +
Sbjct: 165 NIEISEQEVDNFLST-EAGAEMTQPEFRVIQALVEVSKKDSKADRQKKEDFVDGILASIL 223

Query: 108 QHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANK 167
                    +           +G        ++ +     +K     K  +         
Sbjct: 224 AGKDFPEAVSVIEPYVFKGGDLGWKKLDAIPSMFAAVIPSLKVGDTAKVASGAGFHLVYL 283

Query: 168 QKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI- 226
              +               I   ++ ++        +  +  +         ++++  I 
Sbjct: 284 ADERGRERLVEQTEVRHILIKPTEVLDEDAAIALATELRQRAMDGEDFGALAKEYSDDIG 343

Query: 227 HDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLG-GEIAL 284
                G+  +     + P+F   +        + P  +Q G   + +  +R+    E   
Sbjct: 344 SAQEGGELGWTSPGQMVPEFDATMATTEVGEISYPVKSQFGWHILEVTGRREENIAEQMR 403

Query: 285 KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           +  +       K ++    +++K+R  A +  
Sbjct: 404 RQQVMGYLHDQKYDEELEAWLRKIREEAFVDI 435


>gi|283850614|ref|ZP_06367901.1| SurA domain protein [Desulfovibrio sp. FW1012B]
 gi|283573857|gb|EFC21830.1| SurA domain protein [Desulfovibrio sp. FW1012B]
          Length = 330

 Score =  124 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 46/329 (13%), Positives = 110/329 (33%), Gaps = 26/329 (7%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--- 69
           +  L    ++++  +    +  +  +  ++   +NG++IT  D++ R+A L  +      
Sbjct: 1   MPRLPKICLMLVLLVALTTTAWATQLVDKVVAVVNGKLITMFDVNARLADLLQRTQGVSM 60

Query: 70  -------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSS 122
                   EL +  ++ +I + L +QE  +  ++     ++    +  +   L+ + F +
Sbjct: 61  RPDDPQAAELRRQVLESMINDILIEQEAARLKVSISETELDSQIDEIKKKNNLTQQQFVA 120

Query: 123 FLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRT 182
            L+K+G+    F++ + + S+   ++      K    + EI    +K K        I  
Sbjct: 121 ELNKEGMTLKDFRERMRLDSVKKRLLGFMVHRKVLVTDDEIRDYYEKNKGALPTAKSILG 180

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDL 242
              S     +      ++      +      K  +  +K++        G    +   DL
Sbjct: 181 PKVSGTIGFIM-VATKKQADDLRAQITSGSLKFSDAAKKYSIGPGRDQGGDLGDVQAKDL 239

Query: 243 -HPQFQNLLKKSQNNTTNPYVTQKGVEYIAI--------------CDKRDLGGEIALKAY 287
             P    L        + P +       + +                          +  
Sbjct: 240 APPLRDALKSVPAGQVSPPVMLDGKAVLLVLRTGAASTPAPAAPAPTPAGGPSFEGARDQ 299

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           +       K +K   EY+  LRS A+I  
Sbjct: 300 IQEMLYKQKFDKLFQEYIDNLRSKAVIEI 328


>gi|309379764|emb|CBX21540.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 327

 Score =  124 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 38/286 (13%), Positives = 78/286 (27%), Gaps = 17/286 (5%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKLQKIN------GELEKIAVQELIVETLKKQEIEK 92
           S  I    + EVIT   +++ +A  K            EL    + +L+ ++L  Q  ++
Sbjct: 50  SDGIAAVADNEVITRRRLAQAVADAKANLPKDVQIGDEELTGQVLMQLVNQSLIVQAGKR 109

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
                +           A          +    +        K           V + + 
Sbjct: 110 R----NIQASEAEIDAAAAQNPQLKHLSAEQRRELADSIIAEKVRQQAVMQNSRVSEAEV 165

Query: 153 MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRL 212
                    E    +             R     I  +        +  I+   +     
Sbjct: 166 DRFI-----EQAQKQGITLPEGEPLRQYRAQHILIKADGENAAVGAESTIRKIYDQARNG 220

Query: 213 PKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIA 271
                   +++      + G   +  +  +   F+  +        + P  TQ G   I 
Sbjct: 221 TDFSGLARQYSQDAGAGNGGDLGWFSDGVMVAPFEAAVHALKPGQVSAPVRTQFGWHIIK 280

Query: 272 ICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           + + RD    E  ++  +       K E+  AE ++ L S A I  
Sbjct: 281 LNEVRDAGTPEERIRNSVRQYIFQQKAEQATAELLRDLHSGAYIDI 326


>gi|146340301|ref|YP_001205349.1| hypothetical protein BRADO3324 [Bradyrhizobium sp. ORS278]
 gi|146193107|emb|CAL77118.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 287

 Score =  124 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 51/284 (17%), Positives = 111/284 (39%), Gaps = 3/284 (1%)

Query: 36  WAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGI 95
            A +  I   +NG+ ITD DI +R  L  L     +  +  + ELI + +K +E +K G+
Sbjct: 3   SAHAQSIVVMVNGDPITDYDIEQRSKLNFLSTHKQQSRQEVLNELIDDKVKIKEGKKFGV 62

Query: 96  TFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLK 155
              S+ ++  F        L+AE  +  L+ QG+     KQ +  + +W  +V+  +  +
Sbjct: 63  EPSSSDIDQSFAGMGSRMRLNAEQLTRSLESQGVRPETLKQRIKAEIVWTSLVRGRYKER 122

Query: 156 --YGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP 213
               + ++               +     +   +      +     +  +   E+     
Sbjct: 123 LFVSDKDVAAAVAAAGGDTGQQGQSFEYKMQPVVLIVPNSSNQGAMEIRQKEAEALRGRV 182

Query: 214 KDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAI 272
           + C      +    +  + +      +D+ P  + LL  +   + T P  T++G++ +A+
Sbjct: 183 QSCADANNISRTTANAVVKEIVVKTSADIPPNLRKLLDDTPIGHLTPPEATKQGIQMVAL 242

Query: 273 CDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           C +     +      +  Q    K E     Y++++R  A+I Y
Sbjct: 243 CARTPTTVDTPKAREIKEQMYAKKYEATSKAYLQEVRKAAMIEY 286


>gi|153007317|ref|YP_001381642.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Anaeromyxobacter sp.
           Fw109-5]
 gi|152030890|gb|ABS28658.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Anaeromyxobacter sp.
           Fw109-5]
          Length = 317

 Score =  124 bits (309), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 43/280 (15%), Positives = 80/280 (28%), Gaps = 17/280 (6%)

Query: 43  RTTINGEVI----TDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFD 98
              +NGE I       ++ +  A          L +  + EL+  TL  QE     I   
Sbjct: 37  VALVNGEPIGADVLARELREASAGDARGDGGDVLRRRLLDELVDRTLLLQEARARSIVVG 96

Query: 99  SNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGN 158
            + V   F++           F   L +Q +     K  LA Q     + +     +   
Sbjct: 97  QDQVERAFLRVRAE--YPGTHFDDLLAQQRLSQADLKARLADQLTVERLFEEQVYPQVQV 154

Query: 159 LEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK 218
            + EI                +  +   +           ++ +   E+ R         
Sbjct: 155 SDAEIQRYFADHAAEFEEPEKVHVLQVVV--------ASKEEALAVREKLRRNPQTFAEV 206

Query: 219 LEKFASKIHDVSIGKAQYLLESD-LHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRD 277
             K +        G   Y+         F        N  ++   +  G     + D+R 
Sbjct: 207 ARKSSIAPEGKGGGDLGYIGRGSGFPEVFDVTFTLPLNRVSDVTPSPYGFHIFKVVDRRA 266

Query: 278 LG--GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
                    +  ++A+    K  + + +YVK LR  A I 
Sbjct: 267 AQRRTLEQARGDIAAKLAREKRAQVQQDYVKGLRERARIE 306


>gi|154253778|ref|YP_001414602.1| SurA domain-containing protein [Parvibaculum lavamentivorans DS-1]
 gi|154157728|gb|ABS64945.1| SurA domain [Parvibaculum lavamentivorans DS-1]
          Length = 443

 Score =  124 bits (309), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 38/282 (13%), Positives = 102/282 (36%), Gaps = 13/282 (4%)

Query: 18  TYFVLIIFCIVPI----VSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ------- 66
           T F+ +    V      ++  + + +  I   +N  +I+  D+ +R+ L+ L        
Sbjct: 25  TAFIFLAGLAVTPADMPLAQNAPSNTQGIAAVVNDRIISSYDLDQRVKLVMLSSGIPDTP 84

Query: 67  KINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDK 126
           +    +    ++ L+ E L++QE  +  I      ++    + A+   +S +   +FL  
Sbjct: 85  ENISRIRGQVLRSLVDEYLQQQEAARLNIEVQQEEIDSALQRIAQRANMSVDQIEAFLKD 144

Query: 127 QGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
            G+     +  +     W  V++  F       ++EI    ++++  + +   + + +  
Sbjct: 145 GGVSRAALEAQIRSDIAWNRVIQQQFGPSVTVGDVEIDEVLRRLEEESDQPRYLVSEILI 204

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
             D+    +       +  E+ R +         +F+      + G+  ++  S L    
Sbjct: 205 TFDSPQHAEEIAGGAQRLVEQIR-QGAPFEAVAHQFSQSASAANGGEIGWVHASQLPEGV 263

Query: 247 -QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY 287
              + K      ++P  T  G   + +   +   G   ++  
Sbjct: 264 GSVVAKMQPGMVSDPIRTLNGFYIMQLKAMQTGSGADPMRDQ 305



 Score = 48.1 bits (112), Expect = 0.002,   Method: Composition-based stats.
 Identities = 31/257 (12%), Positives = 75/257 (29%), Gaps = 10/257 (3%)

Query: 44  TTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEK---SGITFDSN 100
            T+    I   ++ +R+      + + +   +  + LI     +   E    +    +  
Sbjct: 174 VTVGDVEI--DEVLRRLE-----EESDQPRYLVSEILITFDSPQHAEEIAGGAQRLVEQI 226

Query: 101 TVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLE 160
                F   A     SA   +             +   ++ +     + +D +       
Sbjct: 227 RQGAPFEAVAHQFSQSASAANGGEIGWVHASQLPEGVGSVVAKMQPGMVSDPIRTLNGFY 286

Query: 161 MEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE 220
           +      Q              +   +P         V +R ++AEE R +     +   
Sbjct: 287 IMQLKAMQTGSGADPMRDQYSLMQVLLPLTPDAEPQAVSRRAREAEEFRRQTNSCDDAAR 346

Query: 221 KFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG 280
                +   +  K   +         Q L      NTT P  +++G+E + +C  +   G
Sbjct: 347 NITKYLSGAASPKRDVIAGQLDPRLRQALSGLKAGNTTAPIRSERGIEMVVVCGHKAAEG 406

Query: 281 EIALKAYLSAQNTPTKI 297
           E   +  + +     ++
Sbjct: 407 ERPTREQIDSSLYEQQL 423


>gi|49475336|ref|YP_033377.1| hypothetical protein BH05420 [Bartonella henselae str. Houston-1]
 gi|49238142|emb|CAF27350.1| hypothetical protein BH05420 [Bartonella henselae str. Houston-1]
          Length = 322

 Score =  124 bits (309), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 73/316 (23%), Positives = 128/316 (40%), Gaps = 7/316 (2%)

Query: 7   TSLSDFIKLLTTYFVLIIFCI--VPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK 64
             ++   K + T F ++   I  + +    S    + I  T+NG+ IT+ DI +R A L+
Sbjct: 5   NYMNKLKKHILTLFCIVPLSISNLLVSEIPSTFAQTVIVVTVNGKPITNYDIQRRAAFLR 64

Query: 65  LQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
           LQ+  G L + A  ELI E LK  EI++  I   +N V   F   A    ++ +  +  L
Sbjct: 65  LQQKQGNLSEQAKNELINEVLKNIEIKRRNIEVSNNEVESAFKNFAAQNNMTVDQLNQIL 124

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
               I   HFK Y+  Q  W  +V   +  + G +  +    +              T+ 
Sbjct: 125 IDNDITVQHFKDYIRGQLGWGRLVNARYQAETGMISEQEAVRRILKNGGVKPSTNEYTLQ 184

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             I       +  + +R +    +     + C    K A  I DV++      LE  L  
Sbjct: 185 RIIFVIPAHRRSEIFERRQREANNFRAHFQGCANTSKQAKGILDVTVRNLGKFLEPQLPR 244

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTK----IEK 299
           +++  ++ +     T    T  G+E IA+C  + +  +   +   S Q+   K    +E 
Sbjct: 245 EWEQAIRITPAGKMTQLQETADGIEAIAVCKIKRVSDDYVARLIFSLQDNKQKSPQELEI 304

Query: 300 HEAEYVKKLRSNAIIH 315
              +Y+K+LR  A I 
Sbjct: 305 LSEKYLKELRQVARIK 320


>gi|254362982|ref|ZP_04979046.1| peptidylprolyl isomerase [Mannheimia haemolytica PHL213]
 gi|153094638|gb|EDN75442.1| peptidylprolyl isomerase [Mannheimia haemolytica PHL213]
          Length = 314

 Score =  124 bits (309), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 53/316 (16%), Positives = 111/316 (35%), Gaps = 17/316 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +KL+ + F + +  +   ++  + A   R+   +N   I    + +   +L  +K     
Sbjct: 1   MKLVKSLFAVAVATMS--LTQTAHAFEERVVALVNDTPIMQSQVQR---VLGKKKATETA 55

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           ++ A+ ++I + L +Q ++++G+      VN      A   G++       LD QGI   
Sbjct: 56  QRAAIDQVIDDMLVQQAMKEAGVKVSPAAVNQAVENVAIQNGITYGQLLDALDYQGITLE 115

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNI----------TVREYLIRT 182
            FK+ +A Q     V              ++ A  +++             + +E+ I  
Sbjct: 116 QFKRNIAQQMAMEQVRHISISKSIQVAPQQVQALAKELMAKDKAAGKLKTVSGKEHRISH 175

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDL 242
           +L          Q   +      + +  ++  +                G   +      
Sbjct: 176 ILLKTNPILNDAQAKAKLSSLTTDINSGKISFEEAAKTHSVDYASGADGGDLGFNFLEIY 235

Query: 243 HPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKH 300
            P F N+  K   N  + P+ +Q G   + + D R+              Q    + E+ 
Sbjct: 236 DPAFANVASKIKPNQISAPFKSQFGWHILKVTDTRNGDRTEDAYHQRAYQQLVNKQAEEA 295

Query: 301 EAEYVKKLRSNAIIHY 316
             ++VK LR  A I Y
Sbjct: 296 SKDWVKALRKTANIQY 311


>gi|303256196|ref|ZP_07342212.1| peptidyl-prolyl cis-trans isomerase SurA [Burkholderiales bacterium
           1_1_47]
 gi|331001252|ref|ZP_08324878.1| SurA protein [Parasutterella excrementihominis YIT 11859]
 gi|302860925|gb|EFL84000.1| peptidyl-prolyl cis-trans isomerase SurA [Burkholderiales bacterium
           1_1_47]
 gi|329568979|gb|EGG50775.1| SurA protein [Parasutterella excrementihominis YIT 11859]
          Length = 453

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 51/292 (17%), Positives = 94/292 (32%), Gaps = 16/292 (5%)

Query: 36  WAMSSRIRTTINGEVITDGDISKRI--------ALLKLQKINGELEKIAVQELIVETLKK 87
                RI   +N +VIT+  + +RI                   L    +  +I+E + +
Sbjct: 44  PVPVDRIAAVVNHDVITEIQLQQRIHQVATNLRRRNIPLPPMDNLRDQTLDRMILERIIE 103

Query: 88  QEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDV 147
           Q+   +GI  D N +N    Q A N GL+       L   GI    FK  +  + +   +
Sbjct: 104 QKARDTGIRIDDNMLNGAIEQIATNNGLTVPQLEKKLAADGISVPSFKSEIRSELLTQRL 163

Query: 148 VKNDFMLKYGNLEMEIPANKQKMKNITVREYLI--RTVLFSIPDNKLQNQGFVQKRIKDA 205
            + D   K    E EI    +       R      R V+    +         Q+    A
Sbjct: 164 RERDVDDKIQIPESEIDQYLKDQSGPGKRMEYRLSRIVISFPENPTKAEVEAAQRTASRA 223

Query: 206 EESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQK 265
            E   R         K++     +  G   ++    L P     L+  +     P     
Sbjct: 224 LEQAQRGADFSQLAAKYSVTPEAMEGGVMGWVPAGKLPPFVVQALQNHKAGDIIPLQAGN 283

Query: 266 GVEYIAICDKRDLGGE------IALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
             + + +   RD G +           ++  + +    EK   + + +++S 
Sbjct: 284 SFQILKLTGVRDPGEQAQQGVRQTHVRHIMMRPSNVTPEKVVIQRLNEIKSR 335



 Score = 99.7 bits (246), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/281 (10%), Positives = 84/281 (29%), Gaps = 14/281 (4%)

Query: 46  INGEV-ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           ++ ++ I + +I +    LK Q   G+  +  +  +++   +     +      + +   
Sbjct: 168 VDDKIQIPESEIDQ---YLKDQSGPGKRMEYRLSRIVISFPENPTKAEVEAAQRTASRAL 224

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKY-------G 157
              Q   +    A  +S   +    G   +     +       ++N              
Sbjct: 225 EQAQRGADFSQLAAKYSVTPEAMEGGVMGWVPAGKLPPFVVQALQNHKAGDIIPLQAGNS 284

Query: 158 NLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP-KDC 216
              +++   +   +               +  + +  +  V +R+ + +    +      
Sbjct: 285 FQILKLTGVRDPGEQAQQGVRQTHVRHIMMRPSNVTPEKVVIQRLNEIKSRLDKGDGDFQ 344

Query: 217 NKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICDK 275
                 ++       G   +L   D+ P+ +    K S    + P  T  G     + D+
Sbjct: 345 TLARLHSADPSGTRGGDLGWLYPGDVPPEMEQQLDKLSVGEISEPIRTPYGWHIFQVLDR 404

Query: 276 R-DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           R   G     +          K+     ++ ++LRS A + 
Sbjct: 405 RTKSGINERQREQAREALREQKLGDAVLDWERRLRSEAYVE 445


>gi|224827238|ref|ZP_03700332.1| SurA domain protein [Lutiella nitroferrum 2002]
 gi|224600527|gb|EEG06716.1| SurA  domain protein [Lutiella nitroferrum 2002]
          Length = 428

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 44/301 (14%), Positives = 105/301 (34%), Gaps = 16/301 (5%)

Query: 29  PIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI--------NGELEKIAVQEL 80
                       RI   +N   IT+ D+ KRI    ++             L +  ++++
Sbjct: 17  GTAYAAPVRAVDRIVAVVNKSAITESDLQKRIKETVMELEARKVTPPAPDVLARQVLEQM 76

Query: 81  IVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAI 140
           I E ++ Q    +G+    + +     + A    L+ E   + L K+G+  ++F++ +  
Sbjct: 77  ITEEVQVQYATSNGVRVSDDELQQTLERLASQNKLTLEAMKAQLAKEGVTFDNFREQIRR 136

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQ- 199
           Q +   + + +   +    + E+    +  +     EY +  +L S+P+     Q   Q 
Sbjct: 137 QILLSRLKEREVESRVNVSDTEVEQVLKSEQTANRSEYRLANILVSVPERADAKQIDAQS 196

Query: 200 KRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTT 258
           ++   A                ++   + +  G   +   S L   F + L      + T
Sbjct: 197 QKAHKALAELDAGQPFAKVAAAYSDAPNGLKGGDLGWRPASSLPLDFTKLLETMQPGSHT 256

Query: 259 NPYVTQKGVEYIAICDKRDLGGEIALK----AYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
               +Q+G     + +KR     + ++     ++  +      E      + ++R    I
Sbjct: 257 TVIRSQQGFFIFQLQEKRSADTPLIVEQYHVRHILLRTNEAVSEADAKTRLLQIRDR--I 314

Query: 315 H 315
            
Sbjct: 315 E 315



 Score = 93.2 bits (229), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 34/280 (12%), Positives = 86/280 (30%), Gaps = 19/280 (6%)

Query: 45  TINGEVITDGDISKRIALLKLQKING--------ELEKIAVQELIVETLKKQEIEKSGIT 96
            +N   ++D ++ + +   +    +          + + A  + I    +K     + + 
Sbjct: 151 RVN---VSDTEVEQVLKSEQTANRSEYRLANILVSVPERADAKQIDAQSQKAHKALAELD 207

Query: 97  FDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKY 156
                            GL   D           D               V+++      
Sbjct: 208 AGQPFAKVAAAYSDAPNGLKGGDLGWRPASSLPLDFTKLLETMQPGSHTTVIRSQQGFFI 267

Query: 157 GNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDC 216
                ++   +     + V +Y +R +L     N+  ++   + R+    +   R     
Sbjct: 268 ----FQLQEKRSADTPLIVEQYHVRHILL--RTNEAVSEADAKTRLLQIRDRIERGASFE 321

Query: 217 NKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDK 275
              + ++    +   G   ++   D  P F+  +     N  + P  +  G   I +  K
Sbjct: 322 EMAKLYSEDASNTRGGDLGWVNLGDTVPTFEQAMTSLPLNTVSQPVRSPFGWHLIKVEGK 381

Query: 276 RDLGGEIALKA-YLSAQNTPTKIEKHEAEYVKKLRSNAII 314
           R        +   +  Q    KI++   ++V++LR +A +
Sbjct: 382 RTQDVAQDREKMMVKQQIRARKIDEAYLDWVRQLRDSAFV 421


>gi|74318356|ref|YP_316096.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Thiobacillus
           denitrificans ATCC 25259]
 gi|121956487|sp|Q3SGF9|SURA_THIDA RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|74057851|gb|AAZ98291.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Thiobacillus
           denitrificans ATCC 25259]
          Length = 436

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 42/290 (14%), Positives = 90/290 (31%), Gaps = 17/290 (5%)

Query: 40  SRIRTTINGEVITDGDISKR----IALLKLQK----INGELEKIAVQELIVETLKKQEIE 91
           + I   +N EVIT  +++KR    +  L  Q         LEK  ++ ++ E   +Q   
Sbjct: 36  NHIVAVVNDEVITRQELAKRYDEVVRNLSRQNTPLPPRNVLEKQLLERMVTELALQQHAR 95

Query: 92  KSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
            +G+  D   V     + A    L      + L+K+G   +  +  +  + +     + D
Sbjct: 96  NTGVRADPTLVERALQRIAAQNKLDMAGLQAALEKEGQTLDGMRNTIRNELLIARARERD 155

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
              +    + EI    Q             + +         +   +++R   AE+   +
Sbjct: 156 VDNRISVSDAEIDGYLQTQAQQGAETEYNFSHILVSVPE-NASPEQIRERRARAEDILAQ 214

Query: 212 LPKDCNKL---EKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGV 267
           L    +        +     +  G   +     L   F + L        +    +  G 
Sbjct: 215 LAAGADFAQLSASHSDAPDALKGGNFGWRASGKLPALFVEALKPMQPGEISPLLRSGNGF 274

Query: 268 EYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAI 313
             + + DKR     L        ++  +      E      + +L+    
Sbjct: 275 HILKLVDKRGLDATLSVTQTHARHILIKTNEITSEADARNRLLQLKERID 324



 Score = 99.0 bits (244), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 19/139 (13%), Positives = 45/139 (32%), Gaps = 2/139 (1%)

Query: 179 LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLL 238
                   I  N++ ++   + R+   +E      K        +        G   ++ 
Sbjct: 293 QTHARHILIKTNEITSEADARNRLLQLKERIDNGVKFDELARLHSEDASASKGGDLGWIN 352

Query: 239 ESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL-SAQNTPTK 296
             D  P F+  +        + P  +  G   I + ++RD       +  +        K
Sbjct: 353 PGDTVPDFEKAMNALQPGEVSAPVQSPFGWHLIQVLERRDQDVTQERQKLMARQAIRERK 412

Query: 297 IEKHEAEYVKKLRSNAIIH 315
            E+   ++V+++R  A + 
Sbjct: 413 AEEAFQDWVRQIRDAAYVE 431


>gi|83720338|ref|YP_441133.1| survival protein SurA [Burkholderia thailandensis E264]
 gi|257140205|ref|ZP_05588467.1| survival protein SurA, putative [Burkholderia thailandensis E264]
 gi|122070640|sp|Q2T116|SURA_BURTA RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|83654163|gb|ABC38226.1| survival protein SurA, putative [Burkholderia thailandensis E264]
          Length = 448

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 40/336 (11%), Positives = 107/336 (31%), Gaps = 31/336 (9%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAM-------SSRIRTTINGEVITDGDISKRIA 61
           +   ++       L+   I    S  + A+       +  +   +N +VIT  ++ +R+ 
Sbjct: 1   MKKTLRFAAVAAGLVASLITVAPSASAQALRAQGASLADEVVAVVNNDVITGRELDQRVG 60

Query: 62  LLKLQKING--------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNT 113
           L+  +            +L    + ++++E ++ Q  +  GI  D+ TV     + A+  
Sbjct: 61  LIARRLQQQKAPVPPTDQLRAQVLNQMVLERIQVQRAKDDGIVVDNATVQATLGRLAQAN 120

Query: 114 GLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNI 173
           G+  + + + ++ QG+  + F +    + +   + + +   K    + E+ +     +  
Sbjct: 121 GMPLDQYKARIEAQGVPWDLFVRDARTELMLSKLREKEVDSKITVSDAEVASYIASQRGP 180

Query: 174 TVREYLIRTVLFSIPDNKLQNQ-----GFVQKRIKDAEESRLRLPKDCNKLEKFASKIHD 228
                    +                    +K     +++           +  +     
Sbjct: 181 NAGAQQDLRLEHIFVKAPTNAPQADIDAAQKKAEGLLQQALASGTNFERLAKSQSEADDA 240

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQNNTTNP--YVTQKGVEYIAICDKR----DLGGEI 282
              G   +   S L     + + K +    NP       G E + + D+R          
Sbjct: 241 KKGGDLGFKAPSSLPSDVVDAVSKLRPGEVNPTLIRVPDGFEIVRLVDRRASQNPAASPK 300

Query: 283 ALKAYLSAQNT---PTKIEKHEAEYVKKLRSNAIIH 315
            ++ ++          K E    + +  +R    I 
Sbjct: 301 IVQTHVRHILLRVGEGKSESQARQQLIDIRRQ--IE 334



 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 16/156 (10%), Positives = 54/156 (34%), Gaps = 2/156 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +     +    + +          +   + +++   ++++ D                 +
Sbjct: 287 VDRRASQNPAASPKIVQTHVRHILLRVGEGKSESQARQQLIDIRRQIEAGGDFEKFARTY 346

Query: 223 ASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
           +        G   ++   +  P+F+  +        +NP  T+ G   I +  +RD  G 
Sbjct: 347 SQDGSASQGGDLGWISPGETVPEFERAMNALQDGQVSNPVRTEYGYHLIQVLGRRDAEGS 406

Query: 282 IALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           +  +  +        K E+  ++++++LR ++ +  
Sbjct: 407 VQQQMDIARQAIGQRKAEQAYSDWLRELRDSSYVQI 442


>gi|167835488|ref|ZP_02462371.1| survival protein SurA, putative [Burkholderia thailandensis MSMB43]
          Length = 448

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/336 (11%), Positives = 106/336 (31%), Gaps = 35/336 (10%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMS-----------SRIRTTINGEVITDGDISKRIA 61
           +K    +  +    +  +++    A +             +   +N +VIT  ++ +R+ 
Sbjct: 1   MKKTLRFAAVASGLVASLITVAPPASAQALRAQGASLADEVVAVVNNDVITGRELDQRVG 60

Query: 62  LLKLQKING--------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNT 113
           L+  +            +L    + ++++E ++ Q  +  GI  D+ TV     + A+  
Sbjct: 61  LIARRLQQQKAPVPPTDQLRAQVLNQMVLERIQVQRAKDDGIVVDNATVQATLGRLAQAN 120

Query: 114 GLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNI 173
           G+  + + + ++ QG+  + F +    + +   + + +   K    + E+ +     +  
Sbjct: 121 GMPLDQYKARIEAQGVPWDLFVRDARTELMLSKLREKEVDSKITVSDAEVASYIASQRGP 180

Query: 174 TVREYLIRTVLFSIPDNKLQNQ-----GFVQKRIKDAEESRLRLPKDCNKLEKFASKIHD 228
                    +                    +K     +++           +  +     
Sbjct: 181 NAGSQQDLRLEHIFVKAPTNAPQADIDAAQKKADGLLQQALASGANFERLAKSQSEADDA 240

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQNNTTNP--YVTQKGVEYIAICDKR----DLGGEI 282
              G   +   S L     + + K +    NP       G E + + ++R          
Sbjct: 241 KKGGDLGFKSPSSLPSDVVDAVSKLRPGEVNPALIRVPDGFEIVRLVERRASQNPAASPK 300

Query: 283 ALKAYLSAQNT---PTKIEKHEAEYVKKLRSNAIIH 315
            ++ ++          K E    + +  +R    I 
Sbjct: 301 IVQTHVRHILLRVGEGKSESQARQQLIDIRRQ--IE 334



 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 16/156 (10%), Positives = 54/156 (34%), Gaps = 2/156 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +     +    + +          +   + +++   ++++ D                 +
Sbjct: 287 VERRASQNPAASPKIVQTHVRHILLRVGEGKSESQARQQLIDIRRQIEAGGDFEKFARTY 346

Query: 223 ASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
           +        G   ++   +  P+F+  +        +NP  T+ G   I +  +RD  G 
Sbjct: 347 SQDGSASQGGDLGWISPGETVPEFERAMNTLQDGQVSNPVRTEYGYHLIQVLGRRDAEGS 406

Query: 282 IALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           +  +  +        K E+  ++++++LR ++ +  
Sbjct: 407 VQQQMDIARQAIGQRKAEQAYSDWLRELRDSSYVQI 442


>gi|288958015|ref|YP_003448356.1| peptidyl-prolyl cis-trans isomerase [Azospirillum sp. B510]
 gi|288910323|dbj|BAI71812.1| peptidyl-prolyl cis-trans isomerase [Azospirillum sp. B510]
          Length = 485

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 50/308 (16%), Positives = 104/308 (33%), Gaps = 34/308 (11%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKLQKIN-------GELEKIAVQELIVETLKKQEIE 91
           S  I   +N EV++  D++ RI +  L             L    ++ LI E L+ QE +
Sbjct: 53  SEGIAAVVNDEVVSVSDVNARIRMALLNAGGAANPETIQRLTPQVMRLLIDERLQMQEAK 112

Query: 92  KSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
           + G+T  ++ ++    + A    ++ +     L +Q +  +  K  +     W  V++  
Sbjct: 113 RQGVTVSASEIDDAIKRIAEQNRMNNQQLQEMLKRQNVPVSTLKDQIRALLAWQKVMQRR 172

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
              +    E E+ A  +++K    +   +   +F   D+  Q+    +   +  EE + R
Sbjct: 173 IRQEVVVGEDEVDAAMERLKANIGKPEYLVAEIFLAVDSPDQDDEVRRNAERLVEEVK-R 231

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYI 270
                    +F+      S G   ++   +L P+  + L        + P  T  G   +
Sbjct: 232 GGNFAALARQFSQSAGAASGGDLGWVRSGELSPEVDKALSGMRGGQLSAPVRTATGYHIL 291

Query: 271 AICDKRDLGGE-------------------------IALKAYLSAQNTPTKIEKHEAEYV 305
            +  +R  G                                 +       +  K   E  
Sbjct: 292 LVRGQRPFGSSGGEVPMPAAQPAAPRPQPRPDLAKATVNMKQIILPIESKEQAKEVKEQA 351

Query: 306 KKLRSNAI 313
           +KLR +  
Sbjct: 352 EKLRKSIK 359



 Score = 55.1 bits (130), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/144 (12%), Positives = 41/144 (28%), Gaps = 22/144 (15%)

Query: 194 NQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS 253
                 K +K+  E   +  K C   +  A +      G    +   D+ P  QNL    
Sbjct: 339 ESKEQAKEVKEQAEKLRKSIKSCGDFQARAKETGMPESGDMGTMRVKDMAPGLQNLALGI 398

Query: 254 Q-NNTTNPYVTQKGVEYIAICDK---------------------RDLGGEIALKAYLSAQ 291
                +   ++      + +C +                          ++  +  +  +
Sbjct: 399 PLGQASPVLMSPAAAVILIVCKRDVPMIQPPPEAQPAPPPPAPTPIQEAKLPGRDEIERE 458

Query: 292 NTPTKIEKHEAEYVKKLRSNAIIH 315
               + E     Y++ LR +A + 
Sbjct: 459 LVNERSELLSRRYLRDLRRSAFVE 482


>gi|307946740|ref|ZP_07662075.1| SurA N- domain family [Roseibium sp. TrichSKD4]
 gi|307770404|gb|EFO29630.1| SurA N- domain family [Roseibium sp. TrichSKD4]
          Length = 291

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 63/290 (21%), Positives = 119/290 (41%), Gaps = 3/290 (1%)

Query: 30  IVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--ELEKIAVQELIVETLKK 87
           +  +     S+ I+  +NG+ IT  DI++R  L++L + +      + A +ELI + L+ 
Sbjct: 1   MGGFGLTPASAGIKVVVNGKPITTYDINQRAKLIRLIQRSSVAASRREAEKELIDDRLRL 60

Query: 88  QEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDV 147
           +E  + G+      VN  +   ARN  L+    ++ L + G+     K  L  Q  +   
Sbjct: 61  EEASRIGVKISEAEVNNAYANIARNVKLTPAKLTAGLRQSGVNPQTLKDRLKAQLAFQQS 120

Query: 148 VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEE 207
           V+  F  +    E +I    +K  +      +   +   I     ++    + +      
Sbjct: 121 VRRRFNSQVDVDESDIINALRKSDDENKNISVEYNLQRVIVVVPKKSSKGFRNKRLAESN 180

Query: 208 SRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKG 266
           S  +    C+       K  +V +      LE++L     + + K +    T+P  T+ G
Sbjct: 181 SIRKAVTACDSAGAVFGKYSEVVVQPIGRRLETELPEPMRKEISKTTPGKLTSPRKTEVG 240

Query: 267 VEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            E IA+C KR++  +IA +  L  +    + E     Y+  LR  A I Y
Sbjct: 241 FEMIAVCGKREIASDIAARTELENELRAKEGEALTRRYLMDLRRRASIVY 290


>gi|167579883|ref|ZP_02372757.1| survival protein SurA, putative [Burkholderia thailandensis TXDOH]
          Length = 448

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 40/336 (11%), Positives = 107/336 (31%), Gaps = 31/336 (9%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAM-------SSRIRTTINGEVITDGDISKRIA 61
           +   ++       L+   I    S  + A+       +  +   +N +VIT  ++ +R+ 
Sbjct: 1   MKKTLRFAAVAAGLVASLITVAPSASAQALRAQGASLADEVVAVVNNDVITGRELDQRVG 60

Query: 62  LLKLQKING--------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNT 113
           L+  +            +L    + ++++E ++ Q  +  GI  D+ TV     + A+  
Sbjct: 61  LIARRLQQQKAPVPPTDQLRAQVLNQMVLERIQVQRAKDDGIVVDNATVQATLGRLAQAN 120

Query: 114 GLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNI 173
           G+  + + + ++ QG+  + F +    + +   + + +   K    + E+ +     +  
Sbjct: 121 GMPLDQYKARIEAQGVPWDLFVRDARTELMLSKLREKEVDSKITVSDAEVASYIASQRGP 180

Query: 174 TVREYLIRTVLFSIPDNKLQNQ-----GFVQKRIKDAEESRLRLPKDCNKLEKFASKIHD 228
                    +                    +K     +++           +  +     
Sbjct: 181 NAGAQQDLRLEHIFVKAPTNAPQTDIDAAQKKAEGLLQQALASGTNFERLAKSQSEADDA 240

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQNNTTNP--YVTQKGVEYIAICDKR----DLGGEI 282
              G   +   S L     + + K +    NP       G E + + D+R          
Sbjct: 241 KKGGDLGFKAPSSLPSDVVDAVSKLRPGEVNPTLIRVPDGFEIVRLVDRRASQNPAASPK 300

Query: 283 ALKAYLSAQNT---PTKIEKHEAEYVKKLRSNAIIH 315
            ++ ++          K E    + +  +R    I 
Sbjct: 301 IVQTHVRHILLRVGEGKSESQARQQLIDIRRQ--IE 334



 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 16/156 (10%), Positives = 55/156 (35%), Gaps = 2/156 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +     +    + +          +   + +++   ++++ D                 +
Sbjct: 287 VDRRASQNPAASPKIVQTHVRHILLRVGEGKSESQARQQLIDIRRQIEAGGDFEKFARTY 346

Query: 223 ASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
           +        G   ++   +  P+F+  +    +   +NP  T+ G   I +  +RD  G 
Sbjct: 347 SQDGSASQGGDLGWISPGETVPEFERAMNALQEGQVSNPVRTEYGYHLIQVLGRRDAEGS 406

Query: 282 IALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           +  +  +        K E+  ++++++LR ++ +  
Sbjct: 407 VQQQMDIARQAIGQRKAEQAYSDWLRELRDSSYVQI 442


>gi|325526673|gb|EGD04205.1| SurA domain-containing protein [Burkholderia sp. TJI49]
          Length = 452

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 40/304 (13%), Positives = 102/304 (33%), Gaps = 24/304 (7%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVETL 85
           +   ++  +   +N +VIT  ++ +R+ L+  +             L    + ++++E +
Sbjct: 34  QGAQLADEVVAVVNNDVITGRELDQRVGLIARRLQQQNAPVPPTDQLRAQVLNQMVLERI 93

Query: 86  KKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWP 145
           + Q+ +  GI  D  TV     + A+  G++ + + + L+ QG+  + F      + +  
Sbjct: 94  QVQKAKDDGIRIDDATVQATLQRLAQANGMTLDQYRARLESQGVPWSIFTADARTELMLS 153

Query: 146 DVVKNDFMLKYGNLEMEIPAN----KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKR 201
            + + +   K    + E+       +    +           + +  +         QK+
Sbjct: 154 KLREREVDGKITVSDAEVANYIASQRGPNASQQQDLRFQHIFIKAPTNAPQTEIEAAQKK 213

Query: 202 IKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNP- 260
            +   +            +  +        G   +   S L  +  +   K +    NP 
Sbjct: 214 AEALLQQATSGADFEKLAKNNSEASDAKKGGDLGFKSPSALPAEVVDAASKLRPGQVNPT 273

Query: 261 -YVTQKGVEYIAICDKRDLGGEIALK--------AYLSAQNTPTKIEKHEAEYVKKLRSN 311
                 G E + + D+R   G  A           ++  +    K E    + +  +R+ 
Sbjct: 274 LIRVPDGFEIVRLVDRRQSQGATAAAPKIVQTHVRHILLRVGEGKSEGQARQQLLDIRNQ 333

Query: 312 AIIH 315
             I 
Sbjct: 334 --IE 335



 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/288 (11%), Positives = 95/288 (32%), Gaps = 21/288 (7%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQ-ELIV--------ETLKKQEIEKSGIT 96
           ++G+ IT  D ++    +  Q+     ++  ++ + I         +T  +   +K+   
Sbjct: 160 VDGK-ITVSD-AEVANYIASQRGPNASQQQDLRFQHIFIKAPTNAPQTEIEAAQKKAEAL 217

Query: 97  FDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD------NHFKQYLAIQSIWPDVVKN 150
               T    F + A+N   +++                         L    + P +++ 
Sbjct: 218 LQQATSGADFEKLAKNNSEASDAKKGGDLGFKSPSALPAEVVDAASKLRPGQVNPTLIR- 276

Query: 151 DFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRL 210
                +  + +      Q       +          +   + +++G  ++++ D      
Sbjct: 277 -VPDGFEIVRLVDRRQSQGATAAAPKIVQTHVRHILLRVGEGKSEGQARQQLLDIRNQIE 335

Query: 211 RLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEY 269
                      ++        G   ++   +  P+F+  +        + P  T+ G   
Sbjct: 336 AGGDFAKFARTYSQDGSASQGGDLGWISPGETVPEFERAMNNLQDGQISQPVRTEYGYHL 395

Query: 270 IAICDKRDLGGEIALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           I +  +RD  G +  +  +        K E+  A+++++LR ++ + Y
Sbjct: 396 IQVIGRRDAEGSVQQQMDIARQAIGQRKAEQAYADWLRELRDSSYVQY 443


>gi|238782669|ref|ZP_04626699.1| Chaperone surA [Yersinia bercovieri ATCC 43970]
 gi|238716329|gb|EEQ08311.1| Chaperone surA [Yersinia bercovieri ATCC 43970]
          Length = 434

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 36/296 (12%), Positives = 107/296 (36%), Gaps = 16/296 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--------EL 72
           +++   +    ++ +     ++   ++  V+   D+   +  +KL              L
Sbjct: 7   LILGLVVCANTAFAAPQEVDKVAAVVDNGVVLQSDVDGLLQSVKLNAQQAGQQVPDDATL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI+++++ Q  +K GIT     ++      A    ++     S L   G+  +
Sbjct: 67  RHQILERLIMDSIQLQMAKKMGITVSDEALDKAIADIAAQNRMTPAQMRSRLAADGLNYD 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            +++ +  + +  +V  N+   +   L  E+ +  +++ N T  +  +      IP  + 
Sbjct: 127 TYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQIGNQTSGDAELNLSHILIPLPEN 186

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +Q  V +  + A +    +    +        ++    +  G+  +    +L   F + 
Sbjct: 187 PSQQQVDQAEELANKLVSDIKGGADFGKLAIANSADSQALKGGQMGWGKLQELPSLFAEK 246

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKH 300
           L   ++ +   P  +  G   + + D R     +        ++  + +P   +  
Sbjct: 247 LQSANKGDVVGPIRSGVGFHILKVNDIRGADKTVSVTEVHARHILLKPSPVMTDDQ 302



 Score = 81.3 bits (198), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/168 (14%), Positives = 55/168 (32%), Gaps = 4/168 (2%)

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
                G   +++   +   K ++V E   R +L         +Q   +     A+    +
Sbjct: 259 IRSGVGFHILKVNDIRGADKTVSVTEVHARHILLKPSPVMTDDQARAKLAAAAADIKSGK 318

Query: 212 LPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEY 269
                N  ++ +      V  G   +       P F++  +K  +   + P  +  G   
Sbjct: 319 -TTFANIAKEISQDPGSAVQGGDLGWASPDIYDPAFRDALMKLQKGEISAPVHSSFGWHL 377

Query: 270 IAICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           I + D R +   + A K          K  +    ++++ R+ A +  
Sbjct: 378 IQVVDTRQVDKTDAAQKDRAYRMLFSRKFAEEAQTWMQEQRAAAYVKI 425


>gi|307825062|ref|ZP_07655283.1| SurA domain protein [Methylobacter tundripaludum SV96]
 gi|307733810|gb|EFO04666.1| SurA domain protein [Methylobacter tundripaludum SV96]
          Length = 434

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 45/313 (14%), Positives = 107/313 (34%), Gaps = 15/313 (4%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE-- 71
            +  T  V ++  ++         +   I   +  +VI + ++ K +A+++ +       
Sbjct: 6   NIKRTIVVALLCNLLFGSFLVHAEVLDTIIAVVEEDVILERELQKEVAVIEQRIQQSNAA 65

Query: 72  ------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLD 125
                 L K  ++++IV+ L++Q  EK+GIT     +N      AR   +  E F + L+
Sbjct: 66  IPPAYVLRKQVLEKMIVDKLQRQLAEKAGITVSEEMLNSSAADIARRNNMDIEQFRAELE 125

Query: 126 KQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLF 185
            QGI    F   +  + I   +   +   +    + E+    +    I            
Sbjct: 126 GQGISYQSFLDNMRNEIIINQLRGREIGGRIKVTDREVEHYMETQDKIGEESTQYHLGHI 185

Query: 186 SIPDNKLQNQGFVQKRIKDAEES---RLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDL 242
            I   +  +   +QK +  AE                   +   + +  G   +   S++
Sbjct: 186 LIAVKEGASSTEIQKAMSKAEGIVGSLRGGQDFSQTAISDSDDANALKGGDLGWRTLSEV 245

Query: 243 HPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKI---E 298
              F   + +  Q + + P  +  G   + + + +     +  K  +      T     +
Sbjct: 246 PTLFVNEIRQMKQGDVSEPIRSPSGFHIVKMLELKGTDNHMITKTKVRHILIKTNELVDD 305

Query: 299 KHEAEYVKKLRSN 311
               + +  L++ 
Sbjct: 306 AEANKRLLALKAR 318



 Score = 84.0 bits (205), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/140 (17%), Positives = 47/140 (33%), Gaps = 3/140 (2%)

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK-IHDVSIGKAQYLLE 239
           +     I  N+L +     KR+   +                +      +  G   ++  
Sbjct: 291 KVRHILIKTNELVDDAEANKRLLALKARIADGDDFAALARAHSDDKGSALKGGSLDWVGP 350

Query: 240 SDLHPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKRDLGGEIA-LKAYLSAQNTPTKI 297
            DL   F+  + K   N  ++P  TQ G   I +  + +        K  +       KI
Sbjct: 351 GDLVKPFEEAMVKLGINEVSDPVQTQFGWHIIQVLGRENKDDSSEFKKNLVREAIRKRKI 410

Query: 298 EKHEAEYVKKLRSNAIIHYY 317
           E+    +V++LR  A +  Y
Sbjct: 411 EEETELWVRRLRDEAFVEIY 430


>gi|292492134|ref|YP_003527573.1| SurA domain protein [Nitrosococcus halophilus Nc4]
 gi|291580729|gb|ADE15186.1| SurA domain protein [Nitrosococcus halophilus Nc4]
          Length = 425

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 42/312 (13%), Positives = 106/312 (33%), Gaps = 16/312 (5%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK-------- 67
           +    V ++     + S+ +  +  RI   +N EV+ + ++ + +  ++ Q         
Sbjct: 1   MRRLLVAVLAVFWSMGSFGAT-ILDRIVAVVNEEVVLESELEQMVHTVQEQLVAKGTPLP 59

Query: 68  INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
            +  LE+  ++ L+++ L+ Q   ++GI     T+N    + A + GL+   F   L++ 
Sbjct: 60  PDYMLEQQVLERLVMQQLQLQLAARTGIRVGDETLNQALRRIAEDNGLTLSQFRDVLEQD 119

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI 187
           G     F++ +  + I   + K +   +    E EI       +    ++   +     I
Sbjct: 120 GYNFPSFRENIRRELIISQLHKREVNDRVTVSEAEIDNFLTTQRKRGNQDVQYQLGHVLI 179

Query: 188 PDNKLQNQGFVQKRIKDAEESRLR---LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
              +  +   +Q      E+   +             ++     +  G   +     L  
Sbjct: 180 AVPEAASPEQLQAARAKGEQLLRQLREGMDFQKAALAYSDGQQALEGGNLGWRKMGQLPT 239

Query: 245 QF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F   + K      +    +  G   + + D+R             ++  +       + 
Sbjct: 240 LFVDVVPKLQVGEISELIRSPSGFHIVKLLDRRGEEQQVVTQTHARHILLRTDELTSNRD 299

Query: 301 EAEYVKKLRSNA 312
               + +LR  A
Sbjct: 300 ARLRLGQLRQRA 311



 Score = 97.8 bits (241), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/283 (12%), Positives = 89/283 (31%), Gaps = 17/283 (6%)

Query: 46  INGEV-ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           +N  V +++ +I      L  Q+  G   +    +L    +   E         +     
Sbjct: 144 VNDRVTVSEAEIDN---FLTTQRKRGN--QDVQYQLGHVLIAVPEAASPEQLQAARAKGE 198

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP 164
             ++  R      +   ++ D Q   +     +  +  +    V     L+ G +   I 
Sbjct: 199 QLLRQLREGMDFQKAALAYSDGQQALEGGNLGWRKMGQLPTLFVDVVPKLQVGEISELIR 258

Query: 165 ANKQKMKNI--------TVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDC 216
           +                             +  ++L +    + R+    +  L+     
Sbjct: 259 SPSGFHIVKLLDRRGEEQQVVTQTHARHILLRTDELTSNRDARLRLGQLRQRALQGDDFS 318

Query: 217 NKLEKFASK-IHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICD 274
              +  +      +  G   ++    + P+F+ +++       + P+ TQ G   + I +
Sbjct: 319 ELAQAHSDDKASALKGGDLGWISPGQMIPRFEEVMRSLDPGEISKPFQTQFGWHVVQILN 378

Query: 275 KRDLG-GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           +R     E   +     +    KIE+    ++++LR  A + Y
Sbjct: 379 RRQQNMTEEFNRNRARMEIRQRKIEEELENWLRQLRDEAYVEY 421


>gi|251788205|ref|YP_003002926.1| peptidyl-prolyl cis-trans isomerase SurA [Dickeya zeae Ech1591]
 gi|247536826|gb|ACT05447.1| Peptidylprolyl isomerase [Dickeya zeae Ech1591]
          Length = 430

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 36/303 (11%), Positives = 103/303 (33%), Gaps = 16/303 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   +   +++ +    ++I   ++  V+ + DI+  +  +KL              L
Sbjct: 7   LVLGLALSANMAFAAPQEVNKIAAVVDNSVVLESDINSLLQSVKLNAQEAGQQLPDDATL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ +  Q  +K G+      ++      A    +S +   S L  +G+  +
Sbjct: 67  RHQILERLIMDNIILQMAQKMGVQVTDEQLDRSIANIAAQNRMSIDQLRSRLTAEGVSFD 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            ++  +    I  DV  ++   +   L  E+ +  Q++ +       +      +P  + 
Sbjct: 127 TYRGQIRKDMIIADVRNSEVRRRVTVLPQEVDSLAQQLASQGANGPEVNLSQILLPLPEN 186

Query: 193 QNQGFVQKRIKDAE---ESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
             Q  V K    A    +   +          +++    +  G+  +    +L   F + 
Sbjct: 187 PTQDQVDKAESLANRLVKEASQGADFGKLAITYSADPQALKGGQMGWGRPQELPTLFAER 246

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRD----LGGEIALKAYLSAQNTPTKIEKHEAEY 304
           L    +     P  +  G   + + D R     +        ++    +    +      
Sbjct: 247 LTNPQKGQIVGPIRSGVGFHILRVNDTRGGAQAVSVTEVHARHILLTTSVVMNDAQARAK 306

Query: 305 VKK 307
           +++
Sbjct: 307 LEE 309



 Score = 85.5 bits (209), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 38/309 (12%), Positives = 86/309 (27%), Gaps = 26/309 (8%)

Query: 28  VPIVSYKSWAMSSRIRTTI-NGEV-----ITDGDISKRIALLKLQKINGELEKIAVQELI 81
           V   +Y+       I   + N EV     +   ++      L  Q  NG         L 
Sbjct: 123 VSFDTYRGQIRKDMIIADVRNSEVRRRVTVLPQEVDSLAQQLASQGANGPEVN-----LS 177

Query: 82  VETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQ 141
              L   E         + ++    V+ A       +   ++             +   Q
Sbjct: 178 QILLPLPENPTQDQVDKAESLANRLVKEASQGADFGKLAITYSADPQALKGGQMGWGRPQ 237

Query: 142 SIWPDVVKND-----------FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
            +     +                  G   + +   +   + ++V E   R +L +    
Sbjct: 238 ELPTLFAERLTNPQKGQIVGPIRSGVGFHILRVNDTRGGAQAVSVTEVHARHILLTTSVV 297

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL 249
               Q    K  + A + +       N  ++ +         G   +       P F++ 
Sbjct: 298 MNDAQA-RAKLEEVAGQIKSGKLSFANAAKQLSQDPGTANQGGDLGWASPEMYDPAFRDA 356

Query: 250 -LKKSQNNTTNPYVTQKGVEYIAICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKK 307
             +  +   + P  +  G   I + D R++   + A K          K  +    ++++
Sbjct: 357 LTQLKKGEISTPVHSSFGWHLIQLLDTREVDKTDAAQKERAYRMLFNRKFAEEAQTWMQE 416

Query: 308 LRSNAIIHY 316
            R+ A +  
Sbjct: 417 KRAAAYVKI 425


>gi|161618653|ref|YP_001592540.1| chaperone surA precursor [Brucella canis ATCC 23365]
 gi|260566737|ref|ZP_05837207.1| SurA domain-containing protein [Brucella suis bv. 4 str. 40]
 gi|161335464|gb|ABX61769.1| Chaperone surA precursor [Brucella canis ATCC 23365]
 gi|260156255|gb|EEW91335.1| SurA domain-containing protein [Brucella suis bv. 4 str. 40]
          Length = 318

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 67/317 (21%), Positives = 130/317 (41%), Gaps = 9/317 (2%)

Query: 5   VFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK 64
           +  +      +L     L     V   ++ +     ++   ++G  IT+ DI  R+A LK
Sbjct: 1   MMFARPLIASMLGAAVCLTALGTVTAPAFAAGESEVKVI--VSGNAITNSDIKHRMAFLK 58

Query: 65  LQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
           LQ+ +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +
Sbjct: 59  LQRKSGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVM 118

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
           ++ G+   HFK+Y+ +Q  W  +V   F       E E      K               
Sbjct: 119 NQSGVTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQ 178

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
                   +    +  + +    +     ++C+   + A  I DV++     ++E  L  
Sbjct: 179 VIFVVPASKRSPALLAKRRQEANALRARFQNCDSTRQQAKGILDVTVRDLGRIIEPQLPG 238

Query: 245 QF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ------NTPTKI 297
           ++ +++     N TT P+ T+KGVE++A+C  R +  +   +   S +          K 
Sbjct: 239 EWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKA 298

Query: 298 EKHEAEYVKKLRSNAII 314
           E+   +YV++LR  A I
Sbjct: 299 EELSKKYVQELREKATI 315


>gi|160872391|ref|ZP_02062523.1| chaperone SurA (Peptidyl-prolyl cis-trans isomerase surA) (PPIase
           surA) (Rotamase surA) [Rickettsiella grylli]
 gi|159121190|gb|EDP46528.1| chaperone SurA (Peptidyl-prolyl cis-trans isomerase surA) (PPIase
           surA) (Rotamase surA) [Rickettsiella grylli]
          Length = 431

 Score =  123 bits (308), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 47/317 (14%), Positives = 116/317 (36%), Gaps = 18/317 (5%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE 71
           ++K + ++ VL    + P + Y +     RI   +N   IT   +  ++ + + Q ++  
Sbjct: 3   YLKKIFSFIVLWTSLVTPSLLY-AIETLDRIEAVVNHHAITAQQLDNQMEVKRQQWLSEN 61

Query: 72  --------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSF 123
                     K  + E+I + L+ Q     G+  + +T++   +  A++ GL+ E     
Sbjct: 62  KSIPNTTTFRKQVLNEMIDQELQLQLAATIGLKINDDTLDKTILSIAQHNGLTLEQLREK 121

Query: 124 LDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVRE--YLIR 181
           L +  +    +++ +  Q +   + +N+   K    + EI      +  I  ++  Y + 
Sbjct: 122 LQQANMPFARYREQIRHQLLINRLQQNEVAAKITVTDQEIKDMLTHLPKIISKKAVYHVE 181

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLES 240
            +L    +N         K    +   + +     + L + A+      S G   +   +
Sbjct: 182 DLLIPFSNNPSSTDIARTKETALSLLQKAKQGTSFSALIEHANASTIPLSGGDLGWRPLN 241

Query: 241 DLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKR-----DLGGEIALKAYLSAQNTP 294
           DL   FQ  ++         P     G   I + + R               ++  + +P
Sbjct: 242 DLPDIFQTSVQTLKPGEVAGPIRADNGFHLIRLLELRGIAPAPHDVISTHARHILIKTSP 301

Query: 295 TKIEKHEAEYVKKLRSN 311
               +     ++++R++
Sbjct: 302 LLNNQQAENRLREIRAD 318



 Score = 81.6 bits (199), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 22/140 (15%), Positives = 49/140 (35%), Gaps = 4/140 (2%)

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLE 239
                 I  + L N    + R+++     L      +  +K++         G   + L 
Sbjct: 291 HARHILIKTSPLLNNQQAENRLREIRADILHGGDFASLAKKYSQDPGSSYKGGDLGWTLP 350

Query: 240 SDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICD--KRDLGGEIALKAYLSAQNTPTK 296
               P F+    K + N  + P+ TQ G   + +    K+    +  L    +      K
Sbjct: 351 GFFDPTFEEHLKKLAVNQISLPFQTQYGWHIVQVLGRAKKLQTAQNTLHKQAAQLVYQKK 410

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
            +K    ++++LR+ + +  
Sbjct: 411 FQKALKNWLRQLRNQSYVKI 430


>gi|284008562|emb|CBA75119.1| chaperone SurA protein (peptidyl-prolyl cis-trans isomerase)
           [Arsenophonus nasoniae]
          Length = 433

 Score =  123 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 32/310 (10%), Positives = 99/310 (31%), Gaps = 16/310 (5%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GE 71
            ++ +   V   +  +     ++   +N  V+   D+   + ++++   N          
Sbjct: 7   LIIGLLFTVSTTTLAAPQQLDKVTAIVNDGVVLQSDVDGMLDIVRINARNAGQQIPDENA 66

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L    ++ LI++ +  Q  EK  I      ++      A   GL+       L   GI  
Sbjct: 67  LRHQILERLIIDKIIMQIAEKMQIQIPDQAIDATIANIAAQNGLTIGQLQQRLSMDGINL 126

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNK 191
            +++  +  + +  +V  N+   +   L  E+ +   ++ +   ++  +      IP  +
Sbjct: 127 QNYRSDVRREMMIAEVRNNEVRRRITILPQEVDSLAAQLNSQAGQDANVNLSHILIPLPE 186

Query: 192 LQNQGFVQKRI---KDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN 248
                  Q  +           +          +++  + +  G+  +    +L   F  
Sbjct: 187 NPTNTQSQLAMDTVNKIIAQLKQGADFGKLAITYSADPNALKGGQMGWSKVEELPTVFAQ 246

Query: 249 L-LKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKHEAE 303
                 + +   P  +  G   + + D +     +        ++  + +P    +    
Sbjct: 247 QIQHAKKGDIIGPIRSSVGFHILKLNDIQRGNMPISVTEVKARHILIKLSPIMNNEQAHA 306

Query: 304 YVKKLRSNAI 313
            ++++     
Sbjct: 307 KIQQIAQQIK 316



 Score = 83.6 bits (204), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 41/290 (14%), Positives = 92/290 (31%), Gaps = 18/290 (6%)

Query: 43  RTTI-NGEV-----ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGIT 96
              + N EV     I   ++    A L  Q        ++   LI         +     
Sbjct: 139 IAEVRNNEVRRRITILPQEVDSLAAQLNSQAGQDANVNLS-HILIPLPENPTNTQSQLAM 197

Query: 97  FDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND----- 151
              N +     Q A    L+    +     +G      K           +         
Sbjct: 198 DTVNKIIAQLKQGADFGKLAITYSADPNALKGGQMGWSKVEELPTVFAQQIQHAKKGDII 257

Query: 152 --FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESR 209
                  G   +++   ++    I+V E   R +L  +       Q    K  + A++ +
Sbjct: 258 GPIRSSVGFHILKLNDIQRGNMPISVTEVKARHILIKLSPIMNNEQAH-AKIQQIAQQIK 316

Query: 210 LRLPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGV 267
                     +K++      +  G+  + + +   P F++  ++ S+  T+ P  +  G 
Sbjct: 317 TGQITFAEAAKKYSQDPGSALRGGELGWNMPNIYDPAFRDGLMRLSKGETSQPIHSSFGW 376

Query: 268 EYIAICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
             I + D R +   ++A K +        K  +    ++++LR++A +  
Sbjct: 377 HLIQLEDTRQVDKTDVAQKDHAYRLLFNRKFNEEAQIWMQELRASAYVKI 426


>gi|145300233|ref|YP_001143074.1| chaperone surA [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142853005|gb|ABO91326.1| chaperone surA [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 432

 Score =  123 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 28/310 (9%), Positives = 100/310 (32%), Gaps = 15/310 (4%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--- 70
           K L +     +F  +   ++ +  +  ++   +N +V+        +  +K         
Sbjct: 3   KTLISLLTAGLFGAMSQGAFAAPELMDKVLAVVNKDVVLASQQEALVQKVKSSAQESGQS 62

Query: 71  -----ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLD 125
                 L K A+  LI E+L+ Q  ++ G+      +       A +  ++ +   + L 
Sbjct: 63  LPDDATLRKQALDRLIQESLQLQLADRQGLKISDTQLEQAIQSIAADNKMTLDQLRAQLA 122

Query: 126 KQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLF 185
           ++G+    +++ +  + +  +V +N    +    + E+      +     ++        
Sbjct: 123 REGLTYAQYREEVRREILMNEVRRNQVRRRINISDQEVKQVVDILAKQGQQQQQYHVGHI 182

Query: 186 SIPDNKLQNQGFVQKRIKDAE---ESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDL 242
            I      +   +       E    +  +           ++    +  G   ++   ++
Sbjct: 183 QIALPDNPSAEQLNAAKSKIERILAALKQGADFRKLAIAESNGPKALEGGDWSWMSPQEM 242

Query: 243 HPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIE 298
                + +   ++ +   P  +  G+  + + D +    +        ++  + +    E
Sbjct: 243 PTLMAEAVQGAAKGDIVGPLRSGAGLHIVKVFDAKGQQQVLQTEVKARHILIKPSIILSE 302

Query: 299 KHEAEYVKKL 308
           +     +  +
Sbjct: 303 EKAKGMLDGI 312



 Score = 84.3 bits (206), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 17/150 (11%), Positives = 48/150 (32%), Gaps = 4/150 (2%)

Query: 170 MKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HD 228
            + +   E   R +L        + +          +    +     +  EK++      
Sbjct: 279 QQQVLQTEVKARHILIKPSIILSEEKAKGMLDGILHDIKSGKATF-ASLAEKYSEDPGSA 337

Query: 229 VSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY 287
           V  G+  +   +   P+F++++ +      + P+ T  G   + + ++R        +  
Sbjct: 338 VQGGELGWSDPNVYVPEFRDMVNRLKPGELSAPFRTTHGWHIVQLEERRSQDATSKAQEQ 397

Query: 288 -LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                    +  +    ++ +LR  A I  
Sbjct: 398 RAYQLIFNRRFTEESQAWLDELRDEAYIQI 427


>gi|94971251|ref|YP_593299.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Candidatus
           Koribacter versatilis Ellin345]
 gi|94553301|gb|ABF43225.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Candidatus
           Koribacter versatilis Ellin345]
          Length = 369

 Score =  123 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 54/319 (16%), Positives = 110/319 (34%), Gaps = 17/319 (5%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING- 70
           F+K +     L+    VP+ +     +   I   +N ++IT  D+ +    +  Q     
Sbjct: 10  FMKKILVSSFLVAALAVPMFAGDDTVVEE-IIARVNNQIITRADLRRESEQVLDQLKQQD 68

Query: 71  ---------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFS 121
                    + +K  +++LI + L   +    GI+ D+  +        +    S +D  
Sbjct: 69  AATADQKFVQRQKDVLRDLIDQQLLVDKGADLGISADAELIKRLDEMRKQMNLASMDDLE 128

Query: 122 SFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANK--QKMKNITVREYL 179
           +   KQG+    FKQ +  Q I   V+  +        + E        K +     +  
Sbjct: 129 NEAKKQGVSFEDFKQNMKNQIITQRVISQEVGSHIQITKDEEQKFYDAHKSEMERPEQVR 188

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLL 238
           +  +L  +   K  N    Q++ +          K  +  +  ++        G   Y  
Sbjct: 189 LSEILVPVDAEKDPNATAAQQKAEGIIAELKAGKKFDDVAKAESAGPTAKEQGGDLGYFK 248

Query: 239 ESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRD--LGGEIALKAYLSAQNTPT 295
              L  Q ++ +    +   T P  T++G   I + + +   +     ++  L       
Sbjct: 249 RGVLAKQLEDTVFPLKEGEYTEPIRTKQGFVIIKVTEHQQSGVPPLQQIEPKLQEAVYME 308

Query: 296 KIEKHEAEYVKKLRSNAII 314
           K+E     Y+ KLR  A I
Sbjct: 309 KLEPTLRTYLTKLREEAYI 327


>gi|306845285|ref|ZP_07477861.1| Chaperone surA precursor [Brucella sp. BO1]
 gi|306274444|gb|EFM56251.1| Chaperone surA precursor [Brucella sp. BO1]
 gi|326538427|gb|ADZ86642.1| chaperone surA precursor [Brucella melitensis M5-90]
          Length = 317

 Score =  123 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 67/308 (21%), Positives = 128/308 (41%), Gaps = 9/308 (2%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
            +L     L     V   ++ +     ++   ++G  IT+ DI  R+A LKLQ+ +G L 
Sbjct: 9   SMLGAAVCLTALGTVAAPAFAAGESEVKVI--VSGNAITNSDIKHRMAFLKLQRKSGNLN 66

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +++ G+   H
Sbjct: 67  QLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSGVTPEH 126

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQ 193
           FK+Y+ +Q  W  +V   F       E E      K                       +
Sbjct: 127 FKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVIFVVPASK 186

Query: 194 NQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKK 252
               +  + +    +     ++C+   + A  I DV++     ++E  L  ++ +++   
Sbjct: 187 RSPALLAKRRQEANALRARFQNCDSTRQQAKGILDVTVRDLGRIIEPQLPGEWSKDVKAA 246

Query: 253 SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ------NTPTKIEKHEAEYVK 306
             N TT P+ T+KGVE++A+C  R +  +   +   S +          K E+   +YV+
Sbjct: 247 GVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKAEELSKKYVQ 306

Query: 307 KLRSNAII 314
           +LR  A I
Sbjct: 307 ELREKATI 314


>gi|225627181|ref|ZP_03785219.1| Chaperone surA precursor [Brucella ceti str. Cudo]
 gi|260168435|ref|ZP_05755246.1| peptidyl-prolyl cis-trans isomerase, putative [Brucella sp. F5/99]
 gi|261757897|ref|ZP_06001606.1| SurA domain-containing protein [Brucella sp. F5/99]
 gi|225618016|gb|EEH15060.1| Chaperone surA precursor [Brucella ceti str. Cudo]
 gi|261737881|gb|EEY25877.1| SurA domain-containing protein [Brucella sp. F5/99]
          Length = 318

 Score =  123 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 67/317 (21%), Positives = 130/317 (41%), Gaps = 9/317 (2%)

Query: 5   VFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK 64
           +  +      +L     L     V   ++ +     ++   ++G  IT+ DI  R+A LK
Sbjct: 1   MMFARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVI--VSGNAITNSDIKHRMAFLK 58

Query: 65  LQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
           LQ+ +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +
Sbjct: 59  LQRKSGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVM 118

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
           ++ G+   HFK+Y+ +Q  W  +V   F       E E      K               
Sbjct: 119 NQSGVTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQ 178

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
                   +    +  + +    +     ++C+   + A  I DV++     ++E  L  
Sbjct: 179 VIFVVPASKRSPALLAKRRQEANALRARFQNCDSTRQQAKGILDVTVRDLGRIIEPQLPG 238

Query: 245 QF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ------NTPTKI 297
           ++ +++     N TT P+ T+KGVE++A+C  R +  +   +   S +          K 
Sbjct: 239 EWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSVEGADSPAGQEKKA 298

Query: 298 EKHEAEYVKKLRSNAII 314
           E+   +YV++LR  A I
Sbjct: 299 EELSKKYVQELREKATI 315


>gi|23501571|ref|NP_697698.1| peptidyl-prolyl cis-trans isomerase [Brucella suis 1330]
 gi|62289646|ref|YP_221439.1| peptidyl-prolyl cis-trans isomerase [Brucella abortus bv. 1 str.
           9-941]
 gi|82699574|ref|YP_414148.1| peptidyl-prolyl cis-trans isomerase [Brucella melitensis biovar
           Abortus 2308]
 gi|189023896|ref|YP_001934664.1| peptidyl-prolyl cis-trans isomerase [Brucella abortus S19]
 gi|225852204|ref|YP_002732437.1| chaperone SurA [Brucella melitensis ATCC 23457]
 gi|237815137|ref|ZP_04594135.1| Chaperone surA precursor [Brucella abortus str. 2308 A]
 gi|254697090|ref|ZP_05158918.1| Chaperone surA precursor [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701467|ref|ZP_05163295.1| Chaperone surA precursor [Brucella suis bv. 5 str. 513]
 gi|254704014|ref|ZP_05165842.1| Chaperone surA precursor [Brucella suis bv. 3 str. 686]
 gi|254707612|ref|ZP_05169440.1| Chaperone surA precursor [Brucella pinnipedialis M163/99/10]
 gi|254709805|ref|ZP_05171616.1| Chaperone surA precursor [Brucella pinnipedialis B2/94]
 gi|254713809|ref|ZP_05175620.1| Chaperone surA precursor [Brucella ceti M644/93/1]
 gi|254717133|ref|ZP_05178944.1| Chaperone surA precursor [Brucella ceti M13/05/1]
 gi|254729986|ref|ZP_05188564.1| Chaperone surA precursor [Brucella abortus bv. 4 str. 292]
 gi|256031296|ref|ZP_05444910.1| Chaperone surA precursor [Brucella pinnipedialis M292/94/1]
 gi|256060809|ref|ZP_05450969.1| Chaperone surA precursor [Brucella neotomae 5K33]
 gi|256113220|ref|ZP_05454088.1| Chaperone surA precursor [Brucella melitensis bv. 3 str. Ether]
 gi|256159410|ref|ZP_05457188.1| Chaperone surA precursor [Brucella ceti M490/95/1]
 gi|256254704|ref|ZP_05460240.1| Chaperone surA precursor [Brucella ceti B1/94]
 gi|256257204|ref|ZP_05462740.1| Chaperone surA precursor [Brucella abortus bv. 9 str. C68]
 gi|256264288|ref|ZP_05466820.1| SurA domain-containing protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|256369119|ref|YP_003106627.1| peptidyl-prolyl cis-trans isomerase, putative [Brucella microti CCM
           4915]
 gi|260545602|ref|ZP_05821343.1| SurA domain-containing protein [Brucella abortus NCTC 8038]
 gi|260757664|ref|ZP_05870012.1| SurA domain-containing protein [Brucella abortus bv. 4 str. 292]
 gi|260761491|ref|ZP_05873834.1| SurA domain-containing protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883474|ref|ZP_05895088.1| SurA domain-containing protein [Brucella abortus bv. 9 str. C68]
 gi|261218948|ref|ZP_05933229.1| SurA domain-containing protein [Brucella ceti M13/05/1]
 gi|261221884|ref|ZP_05936165.1| SurA domain-containing protein [Brucella ceti B1/94]
 gi|261315102|ref|ZP_05954299.1| SurA domain-containing protein [Brucella pinnipedialis M163/99/10]
 gi|261317343|ref|ZP_05956540.1| SurA domain-containing protein [Brucella pinnipedialis B2/94]
 gi|261321553|ref|ZP_05960750.1| SurA domain-containing protein [Brucella ceti M644/93/1]
 gi|261324801|ref|ZP_05963998.1| SurA domain-containing protein [Brucella neotomae 5K33]
 gi|261752010|ref|ZP_05995719.1| SurA domain-containing protein [Brucella suis bv. 5 str. 513]
 gi|261754669|ref|ZP_05998378.1| SurA domain-containing protein [Brucella suis bv. 3 str. 686]
 gi|265988381|ref|ZP_06100938.1| SurA domain-containing protein [Brucella pinnipedialis M292/94/1]
 gi|265994631|ref|ZP_06107188.1| SurA domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265997847|ref|ZP_06110404.1| SurA domain-containing protein [Brucella ceti M490/95/1]
 gi|294852046|ref|ZP_06792719.1| peptidyl-prolyl cis-trans isomerase [Brucella sp. NVSL 07-0026]
 gi|297248054|ref|ZP_06931772.1| peptidyl-prolyl cis-trans isomerase SurA [Brucella abortus bv. 5
           str. B3196]
 gi|306842051|ref|ZP_07474724.1| Chaperone surA precursor [Brucella sp. BO2]
 gi|23347483|gb|AAN29613.1| peptidyl-prolyl cis-trans isomerase, putative [Brucella suis 1330]
 gi|62195778|gb|AAX74078.1| peptidyl-prolyl cis-trans isomerase, hypothetical [Brucella abortus
           bv. 1 str. 9-941]
 gi|82615675|emb|CAJ10662.1| peptidyl-prolyl cis-trans isomerase, putative [Brucella melitensis
           biovar Abortus 2308]
 gi|189019468|gb|ACD72190.1| peptidyl-prolyl cis-trans isomerase, putative [Brucella abortus
           S19]
 gi|225640569|gb|ACO00483.1| Chaperone surA precursor [Brucella melitensis ATCC 23457]
 gi|237789974|gb|EEP64184.1| Chaperone surA precursor [Brucella abortus str. 2308 A]
 gi|255999279|gb|ACU47678.1| peptidyl-prolyl cis-trans isomerase, putative [Brucella microti CCM
           4915]
 gi|260097009|gb|EEW80884.1| SurA domain-containing protein [Brucella abortus NCTC 8038]
 gi|260667982|gb|EEX54922.1| SurA domain-containing protein [Brucella abortus bv. 4 str. 292]
 gi|260671923|gb|EEX58744.1| SurA domain-containing protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260873002|gb|EEX80071.1| SurA domain-containing protein [Brucella abortus bv. 9 str. C68]
 gi|260920468|gb|EEX87121.1| SurA domain-containing protein [Brucella ceti B1/94]
 gi|260924037|gb|EEX90605.1| SurA domain-containing protein [Brucella ceti M13/05/1]
 gi|261294243|gb|EEX97739.1| SurA domain-containing protein [Brucella ceti M644/93/1]
 gi|261296566|gb|EEY00063.1| SurA domain-containing protein [Brucella pinnipedialis B2/94]
 gi|261300781|gb|EEY04278.1| SurA domain-containing protein [Brucella neotomae 5K33]
 gi|261304128|gb|EEY07625.1| SurA domain-containing protein [Brucella pinnipedialis M163/99/10]
 gi|261741763|gb|EEY29689.1| SurA domain-containing protein [Brucella suis bv. 5 str. 513]
 gi|261744422|gb|EEY32348.1| SurA domain-containing protein [Brucella suis bv. 3 str. 686]
 gi|262552315|gb|EEZ08305.1| SurA domain-containing protein [Brucella ceti M490/95/1]
 gi|262765744|gb|EEZ11533.1| SurA domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263094548|gb|EEZ18357.1| SurA domain-containing protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264660578|gb|EEZ30839.1| SurA domain-containing protein [Brucella pinnipedialis M292/94/1]
 gi|294820635|gb|EFG37634.1| peptidyl-prolyl cis-trans isomerase [Brucella sp. NVSL 07-0026]
 gi|297175223|gb|EFH34570.1| peptidyl-prolyl cis-trans isomerase SurA [Brucella abortus bv. 5
           str. B3196]
 gi|306287892|gb|EFM59312.1| Chaperone surA precursor [Brucella sp. BO2]
 gi|326408703|gb|ADZ65768.1| peptidyl-prolyl cis-trans isomerase, putative [Brucella melitensis
           M28]
          Length = 318

 Score =  123 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 67/317 (21%), Positives = 130/317 (41%), Gaps = 9/317 (2%)

Query: 5   VFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK 64
           +  +      +L     L     V   ++ +     ++   ++G  IT+ DI  R+A LK
Sbjct: 1   MMFARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVI--VSGNAITNSDIKHRMAFLK 58

Query: 65  LQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
           LQ+ +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +
Sbjct: 59  LQRKSGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVM 118

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
           ++ G+   HFK+Y+ +Q  W  +V   F       E E      K               
Sbjct: 119 NQSGVTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQ 178

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
                   +    +  + +    +     ++C+   + A  I DV++     ++E  L  
Sbjct: 179 VIFVVPASKRSPALLAKRRQEANALRARFQNCDSTRQQAKGILDVTVRDLGRIIEPQLPG 238

Query: 245 QF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ------NTPTKI 297
           ++ +++     N TT P+ T+KGVE++A+C  R +  +   +   S +          K 
Sbjct: 239 EWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKA 298

Query: 298 EKHEAEYVKKLRSNAII 314
           E+   +YV++LR  A I
Sbjct: 299 EELSKKYVQELREKATI 315


>gi|107023645|ref|YP_621972.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Burkholderia
           cenocepacia AU 1054]
 gi|116690730|ref|YP_836353.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Burkholderia
           cenocepacia HI2424]
 gi|170734072|ref|YP_001766019.1| SurA domain-containing protein [Burkholderia cenocepacia MC0-3]
 gi|122070635|sp|Q1BTQ6|SURA_BURCA RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|105893834|gb|ABF76999.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Burkholderia
           cenocepacia AU 1054]
 gi|116648819|gb|ABK09460.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Burkholderia
           cenocepacia HI2424]
 gi|169817314|gb|ACA91897.1| SurA domain [Burkholderia cenocepacia MC0-3]
          Length = 452

 Score =  123 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 39/302 (12%), Positives = 99/302 (32%), Gaps = 22/302 (7%)

Query: 32  SYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVE 83
             +   ++  +   +N +VIT  ++ +R+ L+  +             L    + ++++E
Sbjct: 32  GSQGAQLADEVVAVVNNDVITGRELDQRVGLIARRLQQQNAPVPPADQLRAQVLNQMVLE 91

Query: 84  TLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSI 143
            ++ Q+ +  GI  D  TV     + A+  G++ + +   L+ QG+  + F      + +
Sbjct: 92  RIQVQKAKDDGIRIDDATVQATLQRLAQANGMTLDQYRGRLEAQGVPWSIFTNDARTELM 151

Query: 144 WPDVVKNDFMLKYGNLEMEIPAN----KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQ 199
              + + +   K    + E+       +    +           + +  +    +    Q
Sbjct: 152 LSKLREREVDGKITVSDAEVANYIASQRGPNASQQQDLRFQHIFIKAPTNAPQADIEAAQ 211

Query: 200 KRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTN 259
           K+     +            +  +        G   +   S L     +   K +    N
Sbjct: 212 KKADALLQQAKSGADFERLAKNNSEANDAKKGGDLGFKSPSALPADVVDAASKLRPGQVN 271

Query: 260 P--YVTQKGVEYIAICDKRDLGGEIALK--------AYLSAQNTPTKIEKHEAEYVKKLR 309
           P       G E + + D+R   G  A           ++  +    K E    + +  +R
Sbjct: 272 PTLIRVPDGFEIVRLVDRRQSQGASAAAPKIVQTHVRHILLRVGEGKSEGQARQQLVDIR 331

Query: 310 SN 311
           + 
Sbjct: 332 NQ 333



 Score =  106 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 29/287 (10%), Positives = 89/287 (31%), Gaps = 19/287 (6%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           ++G+ IT  D ++    +  Q+     ++  +       +K            +      
Sbjct: 160 VDGK-ITVSD-AEVANYIASQRGPNASQQQDL-RFQHIFIKAPTNAPQADIEAAQKKADA 216

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN--------------D 151
            +Q A++         +  +           + +  ++  DVV                 
Sbjct: 217 LLQQAKSGADFERLAKNNSEANDAKKGGDLGFKSPSALPADVVDAASKLRPGQVNPTLIR 276

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
               +  + +      Q       +          +   + +++G  ++++ D       
Sbjct: 277 VPDGFEIVRLVDRRQSQGASAAAPKIVQTHVRHILLRVGEGKSEGQARQQLVDIRNQVEA 336

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYI 270
                     ++        G   ++   +  P+F+  +        + P  T+ G   I
Sbjct: 337 GGDFAKFARTYSQDGSASQGGDLGWISPGETVPEFERAMNNLQDGQISQPIRTEYGYHLI 396

Query: 271 AICDKRDLGGEIALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            + ++R+  G +  +  +        K E+  A+++++LR ++ + Y
Sbjct: 397 QVLNRREAEGSVQQQMDIARQAIGQRKAEQAYADWLRELRDSSYVQY 443


>gi|149912930|ref|ZP_01901464.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Roseobacter sp.
           AzwK-3b]
 gi|149813336|gb|EDM73162.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Roseobacter sp.
           AzwK-3b]
          Length = 285

 Score =  123 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 40/306 (13%), Positives = 79/306 (25%), Gaps = 53/306 (17%)

Query: 17  TTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQK---ING 70
             +  L I   V      +   S     +  T+NG  IT G +    A L  Q       
Sbjct: 6   KLFPALAIVAAVGFAQAPAAQDSPDIDTVLATVNGTDITLGHMIALRASLPAQYGQLPPE 65

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
            L    + +LI +TL                                    SF  +    
Sbjct: 66  ILFNGILDQLIQQTLL---------------------------------MQSFEGEVSKR 92

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
                +      +  +V++        + +++    ++        EY    +L      
Sbjct: 93  SALVLENERRAILATEVIEKVMQGALTDADIQAAYEERYASAGQETEYKAAHIL------ 146

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP-QFQNL 249
                   ++  +D                + ++     + G   +     +    F  +
Sbjct: 147 -----VETEETARDLIAQLEGGADFATLARENSTGPSGPNGGDLGWFGPGVMVESFFNAV 201

Query: 250 LKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLR 309
                   + P  TQ G   I + + R    E      + A+   T  ++    +V  L 
Sbjct: 202 ASLEPGQVSEPVQTQFGWHVIKLNETR--LTETPPLEEVRAEIEETLQQEKFDAHVDTLT 259

Query: 310 SNAIIH 315
             A I 
Sbjct: 260 DQATIE 265


>gi|92116105|ref|YP_575834.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Nitrobacter
           hamburgensis X14]
 gi|91798999|gb|ABE61374.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Nitrobacter
           hamburgensis X14]
          Length = 308

 Score =  123 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 39/313 (12%), Positives = 88/313 (28%), Gaps = 47/313 (15%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDI---SKRIALL 63
           T  S  ++L  +     +   + + +       + +   +NG  I   D+    + +   
Sbjct: 8   TKHSLRVRLALSALGGCLALTLLVGTPVRADDLNPVLAKVNGSEIRQSDVNVAEEELGPG 67

Query: 64  KLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSF 123
             Q      ++  +  LI   +  +  E   I    +                       
Sbjct: 68  LAQMDPAAKQENVLSFLIDMKIIAKAAEDKKIENSEDFKKRL------------------ 109

Query: 124 LDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTV 183
                        +   + +   ++ ++      +  M+        +  +  E   R +
Sbjct: 110 ------------AFARDRLLMDKLLASEGKAAITDEAMKTVYADASKQITSEEEVHARHI 157

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLH 243
           L              ++  K  E+   +        +K +        G   +  +  + 
Sbjct: 158 LVP-----------TEEEAKKVEDELKKGADFAELAKKESKDPGASDGGDLGFFTKEQMV 206

Query: 244 PQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEA 302
           P+F +          ++P  TQ G   I + +KR           +  Q       K +A
Sbjct: 207 PEFSKVAFALEPGKISDPVKTQFGWHIIKVEEKRARKA--PAFDQVKPQIEQFVTRKAQA 264

Query: 303 EYVKKLRSNAIIH 315
           +YV KLR  A I 
Sbjct: 265 DYVAKLRETAKIE 277


>gi|163737941|ref|ZP_02145357.1| preprotein translocase ATPase subunit [Phaeobacter gallaeciensis
           BS107]
 gi|161388557|gb|EDQ12910.1| preprotein translocase ATPase subunit [Phaeobacter gallaeciensis
           BS107]
          Length = 283

 Score =  123 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 38/299 (12%), Positives = 89/299 (29%), Gaps = 50/299 (16%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN---GELEKIAV 77
           + +   +   +S  +   ++ +  T+NGE IT G +    A L  Q        L    +
Sbjct: 11  LALTVALTLPISTAAEPHANTVVATVNGEEITIGHMIIARATLPQQYQQLPDDVLYDAIL 70

Query: 78  QELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQY 137
            +LI +T  KQE                                    +         + 
Sbjct: 71  DQLIQQTSLKQE---------------------------------LNGEVPKYVALSLEN 97

Query: 138 LAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGF 197
            A   +  DV++        + ++    +++        E+    +L    ++    +  
Sbjct: 98  EARSLLAADVIEKVMENAASDEDLRTAYDEKYTDGTGGDEFNASHILVETEEDAADIRAE 157

Query: 198 VQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS-QNN 256
           +                      + ++     + G+  +  +  + PQF+  +      +
Sbjct: 158 LDA-----------GADFATLARERSTGPSGPNGGELGWFSKGRMVPQFEEAVLVMGAGD 206

Query: 257 TTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            ++P  TQ G   I + D+R           +  +      ++   + V  L + A I 
Sbjct: 207 VSDPVQTQFGWHVIKLNDRRTSAA--PTFDEVREELATQMRQEAVEDRVLSLTTAATIE 263


>gi|163842954|ref|YP_001627358.1| chaperone surA precursor [Brucella suis ATCC 23445]
 gi|163673677|gb|ABY37788.1| Chaperone surA precursor [Brucella suis ATCC 23445]
          Length = 318

 Score =  123 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 67/317 (21%), Positives = 130/317 (41%), Gaps = 9/317 (2%)

Query: 5   VFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK 64
           +  +      +L     L     V   ++ +     ++   ++G  IT+ DI  R+A LK
Sbjct: 1   MMFARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVI--VSGNAITNSDIKHRMAFLK 58

Query: 65  LQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
           LQ+ +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +
Sbjct: 59  LQRKSGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVM 118

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
           ++ G+   HFK+Y+ +Q  W  +V   F       E E      K               
Sbjct: 119 NQSGVTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQ 178

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
                   +    +  + +    +     ++C+   + A  I DV++     ++E  L  
Sbjct: 179 VIFVLPASKRSPALLAKRRQEANALRARFQNCDSTRQQAKGILDVTVRDLGRIIEPQLPG 238

Query: 245 QF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ------NTPTKI 297
           ++ +++     N TT P+ T+KGVE++A+C  R +  +   +   S +          K 
Sbjct: 239 EWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKA 298

Query: 298 EKHEAEYVKKLRSNAII 314
           E+   +YV++LR  A I
Sbjct: 299 EELSKKYVQELREKATI 315


>gi|17987548|ref|NP_540182.1| survival protein surA precursor (peptidyl-prolyl cis-trans
           isomerase surA) [Brucella melitensis bv. 1 str. 16M]
 gi|265990795|ref|ZP_06103352.1| SurA domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|17983251|gb|AAL52446.1| survival protein sura precursor (peptidyl-prolyl cis-trans
           isomerase sura) [Brucella melitensis bv. 1 str. 16M]
 gi|263001579|gb|EEZ14154.1| SurA domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 317

 Score =  123 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 68/308 (22%), Positives = 128/308 (41%), Gaps = 9/308 (2%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
            +L     L     V   ++ +     ++   ++G  IT+ DI  R+A LKLQ+ +G L 
Sbjct: 9   SMLGAAVCLTALGTVAAPAFAAGESEVKVI--VSGNAITNSDIKHRMAFLKLQRKSGNLN 66

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           ++A  EL  E LK+ E++  GI      VN  +   A    ++    +  +++ G+   H
Sbjct: 67  QLARNELTEEMLKRIEMKSLGINISDKEVNDAYAGFASRNKMTLAQLNQVMNQSGVTPEH 126

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQ 193
           FK+Y+ +Q  W  +V   F       E E      K                       +
Sbjct: 127 FKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVIFVVPASK 186

Query: 194 NQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKK 252
               +  + +    +     ++C+   + A  I DV++     ++E  L  ++ +++   
Sbjct: 187 RSPALLAKRRQEANALRARFQNCDSTRQQAKGILDVTVRDLGRIIEPQLPGEWSKDVKAA 246

Query: 253 SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ------NTPTKIEKHEAEYVK 306
             N TT P+ T+KGVE++A+C  R +  +   +   S +          K E+   +YV+
Sbjct: 247 GVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKAEELSKKYVQ 306

Query: 307 KLRSNAII 314
           +LR  A I
Sbjct: 307 ELREKATI 314


>gi|256044377|ref|ZP_05447281.1| survival protein surA precursor (peptidyl-prolyl cis-trans
           isomerase surA) [Brucella melitensis bv. 1 str. Rev.1]
 gi|260563729|ref|ZP_05834215.1| SurA domain-containing protein [Brucella melitensis bv. 1 str. 16M]
 gi|260153745|gb|EEW88837.1| SurA domain-containing protein [Brucella melitensis bv. 1 str. 16M]
          Length = 318

 Score =  123 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 68/317 (21%), Positives = 130/317 (41%), Gaps = 9/317 (2%)

Query: 5   VFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK 64
           +  +      +L     L     V   ++ +     ++   ++G  IT+ DI  R+A LK
Sbjct: 1   MMFARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVI--VSGNAITNSDIKHRMAFLK 58

Query: 65  LQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
           LQ+ +G L ++A  EL  E LK+ E++  GI      VN  +   A    ++    +  +
Sbjct: 59  LQRKSGNLNQLARNELTEEMLKRIEMKSLGINISDKEVNDAYAGFASRNKMTLAQLNQVM 118

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
           ++ G+   HFK+Y+ +Q  W  +V   F       E E      K               
Sbjct: 119 NQSGVTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQ 178

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
                   +    +  + +    +     ++C+   + A  I DV++     ++E  L  
Sbjct: 179 VIFVVPASKRSPALLAKRRQEANALRARFQNCDSTRQQAKGILDVTVRDLGRIIEPQLPG 238

Query: 245 QF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ------NTPTKI 297
           ++ +++     N TT P+ T+KGVE++A+C  R +  +   +   S +          K 
Sbjct: 239 EWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKA 298

Query: 298 EKHEAEYVKKLRSNAII 314
           E+   +YV++LR  A I
Sbjct: 299 EELSKKYVQELREKATI 315


>gi|209548668|ref|YP_002280585.1| peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209534424|gb|ACI54359.1| putative peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 314

 Score =  123 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 77/291 (26%), Positives = 139/291 (47%), Gaps = 10/291 (3%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKS 93
                +S ++  +NG  IT GD++KR A ++LQ    +  K A ++LI ETLK+QE+ + 
Sbjct: 25  APALAASEVKAVVNGTAITSGDVAKRQAFMRLQHTKADA-KAAEEQLIDETLKRQEVSRV 83

Query: 94  GITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFM 153
            ++     V+  F + +    LS E  S  LD+ G+G +HFK ++A+Q  WP VV   + 
Sbjct: 84  HMSVSQQDVDASFARFSAGNKLSVEQMSQILDRAGVGVDHFKGFIAVQMSWPRVVNARYG 143

Query: 154 LKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP 213
                   ++ +   +                     + +      KR  +AE SR + P
Sbjct: 144 STSRLSNYDLVSRMMQNNKQKPVTTEYMLQQIIFVIPQAKRNAITGKRKGEAEASRSKFP 203

Query: 214 KDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAIC 273
              ++ + FA+ + DVS+     +L  ++ P ++ L+++++ NTT   VT KGVEY+AIC
Sbjct: 204 GC-DQAKVFAATMRDVSVRDLGRMLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEYLAIC 262

Query: 274 DKRDLGGEIALKAYLSAQNTPTKI--------EKHEAEYVKKLRSNAIIHY 316
            +R +  + A +     ++              ++  +Y+ +LR  A I Y
Sbjct: 263 SQRQVSDDQAAEMVFRQEDLGKAKGGKDASPENENSKKYLDELRKKAQIAY 313


>gi|115522177|ref|YP_779088.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodopseudomonas
           palustris BisA53]
 gi|115516124|gb|ABJ04108.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodopseudomonas
           palustris BisA53]
          Length = 309

 Score =  123 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 37/305 (12%), Positives = 81/305 (26%), Gaps = 47/305 (15%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDI---SKRIALLKLQKINGE 71
                   +  C++          ++ +   +NG  I   D+    + +A    Q     
Sbjct: 13  RFGLACAAVTGCLLMAAVPVRAQDANPVVAKVNGTEIRQSDLTLAEEELAPNLAQMDPAA 72

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
            ++  +  LI   +  +  E   I   ++  +                            
Sbjct: 73  RKENVLAFLIDMRIVAKAAEDKKIADRADFKSRL-------------------------- 106

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNK 191
                +   + +   ++  +         M+        +     E   R +L    D  
Sbjct: 107 ----DFARNRILMDQLLAAEGKAAATGDAMKKVYEDAAKQIAGEPEVHARHILVETEDEA 162

Query: 192 LQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLK 251
                 ++K                   +K +        G   +  +  + P+F     
Sbjct: 163 KAVVEELKK-----------GADFAELAKKKSKDPGAADGGDLGFFTKDQMVPEFSTAAF 211

Query: 252 K-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRS 310
                  + P  +Q G   I + +KR+          +  Q       K +A+YV KLR+
Sbjct: 212 ALEPGKVSEPVKSQFGWHVIKVEEKRNRKA--PDFDQVKGQIETYVARKAQADYVTKLRA 269

Query: 311 NAIIH 315
            A I 
Sbjct: 270 EAKIE 274


>gi|121606958|ref|YP_984287.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Polaromonas
           naphthalenivorans CJ2]
 gi|120595927|gb|ABM39366.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Polaromonas
           naphthalenivorans CJ2]
          Length = 469

 Score =  123 bits (307), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 38/298 (12%), Positives = 89/298 (29%), Gaps = 21/298 (7%)

Query: 35  SWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--------ELEKIAVQELIVETLK 86
           +   +  I   +N E IT+ ++  ++   + Q            EL    ++ +I +  +
Sbjct: 56  AQQQADFIVVVVNSEPITNNEVRTKLLRTEQQLKQQSIALPPRSELMPQLLERMISDKAQ 115

Query: 87  KQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPD 146
            Q  + +G   D N V       AR   ++ ++    L   GI    F+  +  + +   
Sbjct: 116 LQAAQATGFKIDDNAVEGAVQTVARQNQITVDELRRRLKADGIDYAQFRSEIRDELLISR 175

Query: 147 VVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTV-------LFSIPDNKLQNQGFVQ 199
           + + +   +    EMEI    +  +                   +    +   +    +Q
Sbjct: 176 LRQREVESRINVSEMEIDDYLRSQEGKPGAAGAAPAALNLAEILVAVPENATPEQVASLQ 235

Query: 200 KRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTT 258
            + +   E             + ++     + G+          P F +           
Sbjct: 236 AKARQVLERAKAGADFAALATEVSAAASRSNGGQIGLRSADRYPPLFVEATQSLPAGGLA 295

Query: 259 NPYVTQKGVEYIAICDKR-----DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
            P  +  G   + + +KR     D         ++  + TP   E    E +   +  
Sbjct: 296 GPVRSAAGFHILKVIEKRQGGLPDAVITQTHARHILLRLTPQLTEAAAVEKLAGFKKR 353



 Score = 92.8 bits (228), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 18/167 (10%), Positives = 52/167 (31%), Gaps = 2/167 (1%)

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
                G   +++   +Q      V        +      +L     V+K     +     
Sbjct: 298 VRSAAGFHILKVIEKRQGGLPDAVITQTHARHILLRLTPQLTEAAAVEKLAGFKKRIVAG 357

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYI 270
                    + +        G   ++      P+F+ ++   + N  ++P V++ GV  +
Sbjct: 358 QADFAALARENSQDASAKQGGDLGWVPGGAFVPEFEKVMNALAPNQVSDPLVSRFGVHLV 417

Query: 271 AICDKRDLGG-EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            + ++R+        +  +       K  +    + + +R  A + +
Sbjct: 418 QVLERREAPVSPRDQREMVRGMLREKKQNEAYVRWAEDIRGRAYVEF 464


>gi|163868025|ref|YP_001609229.1| peptidyl-prolyl cis-trans isomerase [Bartonella tribocorum CIP
           105476]
 gi|161017676|emb|CAK01234.1| Peptidyl-prolyl cis-trans isomerase [Bartonella tribocorum CIP
           105476]
          Length = 322

 Score =  123 bits (307), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 71/324 (21%), Positives = 128/324 (39%), Gaps = 11/324 (3%)

Query: 1   MTSKVFTSLSDFIKLLTTYFVLIIF----CIVPIVSYKSWAMSSRIRTTINGEVITDGDI 56
           M   ++  ++   K L   F +        ++      S    + I  T+NG  IT+ DI
Sbjct: 1   MRKPIY--MNKLKKRLLALFCIASLGVSSLLINEFLISSAFAQTAIVVTVNGNPITNYDI 58

Query: 57  SKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLS 116
            +R+A L+LQ+  G L   A +ELI E LK  EI++  I   ++ VN  F   A    ++
Sbjct: 59  QRRVAFLRLQQKQGSLAAQAKKELIDEELKNIEIKRRNIEVSNDEVNRAFENFATQNNMT 118

Query: 117 AEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVR 176
            +  +  L +  I   HFK Y+  Q  W  +V   +  + G +  +    +         
Sbjct: 119 VDQLNQILIQNDITVQHFKDYIRGQIGWGRLVSARYQAQTGMVSEQEAVRRILKNGGVKP 178

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQY 236
                T+   +       +  + +R +    +     + C      A  I DV+I     
Sbjct: 179 STNEYTLQRIVFVIPAHRRSEILERRQREASNFRAHFRGCANAHNQARGILDVTIRPLGK 238

Query: 237 LLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTP- 294
            LE  L   ++  +  +     T    T  G+E IA+C  + +  +   +   S Q+   
Sbjct: 239 FLEPQLPSAWEQAILATPAGKMTKLQETSDGIEAIAVCKIKRISDDYVARLIFSLQDNKK 298

Query: 295 ---TKIEKHEAEYVKKLRSNAIIH 315
               K+E+   +Y+++LR  A I 
Sbjct: 299 RDPKKLEELSEKYLEELRRVARIQ 322


>gi|148559269|ref|YP_001258666.1| putative peptidyl-prolyl cis-trans isomerase [Brucella ovis ATCC
           25840]
 gi|148370526|gb|ABQ60505.1| putative peptidyl-prolyl cis-trans isomerase [Brucella ovis ATCC
           25840]
          Length = 318

 Score =  123 bits (307), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 66/317 (20%), Positives = 129/317 (40%), Gaps = 9/317 (2%)

Query: 5   VFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK 64
           +  +      +L     L     V   ++ +     ++   ++G  IT+ DI  R+A LK
Sbjct: 1   MMFARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVI--VSGNAITNSDIKHRMAFLK 58

Query: 65  LQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
           LQ+ +G L ++A  EL  E LK+ E++   I      V+  +   A    ++    +  +
Sbjct: 59  LQRKSGNLNQLARNELTEEMLKRIEMKSRSINISDKEVDDAYAGFASRNKMTLAQLNQVM 118

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
           ++ G+   HFK+Y+ +Q  W  +V   F       E E      K               
Sbjct: 119 NQSGVTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQ 178

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
                   +    +  + +    +     ++C+   + A  I DV++     ++E  L  
Sbjct: 179 VIFVVPASKRSPALLAKRRQEANALRARFQNCDSTRQQAKGILDVTVRDLGRIIEPQLPG 238

Query: 245 QF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ------NTPTKI 297
           ++ +++     N TT P+ T+KGVE++A+C  R +  +   +   S +          K 
Sbjct: 239 EWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKA 298

Query: 298 EKHEAEYVKKLRSNAII 314
           E+   +YV++LR  A I
Sbjct: 299 EELSKKYVQELREKATI 315


>gi|167561603|ref|ZP_02354519.1| survival protein SurA, putative [Burkholderia oklahomensis EO147]
          Length = 452

 Score =  122 bits (306), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 39/336 (11%), Positives = 107/336 (31%), Gaps = 25/336 (7%)

Query: 1   MTSKVFTSL--SDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISK 58
           M   +  +   S  +  L T         +  +  +  +++  +   +N +VIT  ++ +
Sbjct: 1   MKKTLRFAAVASGLVASLITVAPAASAQALRALRAQGASLADEVVAVVNNDVITGRELDQ 60

Query: 59  RIALLKLQKING--------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           R+ L+  +            +L    + ++++E ++ Q  +  GI  D+ TV     + A
Sbjct: 61  RVGLIARRLQQQKAPVPPIDQLRAQVLNQMVLERIQIQRAKDDGIVVDNATVQATLGRLA 120

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
           +  G+  + + + ++ QG+  + F +    + +   + + +   K    + E+ +     
Sbjct: 121 QANGMPLDQYKARIEAQGVPWDVFVRDARTELMLSKLREKEVDGKITVSDAEVASYIASQ 180

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQG-----FVQKRIKDAEESRLRLPKDCNKLEKFASK 225
           +           +                    +K     +++           +  +  
Sbjct: 181 RGPNAGSQQDLRLEHIFVKAPTSAPQADIDVAQKKAEGLLQQALASGADFERLAKNNSEA 240

Query: 226 IHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNP--YVTQKGVEYIAICDKR------- 276
                 G   +   S L     + + K +    NP       G E + + D+R       
Sbjct: 241 DDAKKGGDLGFKSPSSLPSDVVDAVSKLRPGQVNPTLVRVPDGFEIVRLVDRRASQSVSA 300

Query: 277 -DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
                      ++  +    K E    + +  +R  
Sbjct: 301 ASPKIVQTHVRHILLRVGEGKSESQARQQLIDIRRQ 336



 Score =  102 bits (253), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 17/168 (10%), Positives = 57/168 (33%), Gaps = 2/168 (1%)

Query: 151 DFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRL 210
                +  + +      Q +   + +          +   + +++   ++++ D      
Sbjct: 279 RVPDGFEIVRLVDRRASQSVSAASPKIVQTHVRHILLRVGEGKSESQARQQLIDIRRQVE 338

Query: 211 RLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEY 269
                      ++        G   ++   +  P+F+  +        +NP  T+ G   
Sbjct: 339 AGGDFEKFARTYSQDGSASQGGDLGWISPGETVPEFERAMNSLQDGQVSNPVRTEYGYHL 398

Query: 270 IAICDKRDLGGEIALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           I +  +RD  G +  +  +        K E+  ++++++LR ++ +  
Sbjct: 399 IQVLGRRDAEGSVQQQMDIARQAIGQRKAEQAYSDWLRELRDSSYVQI 446


>gi|154252183|ref|YP_001413007.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Parvibaculum
           lavamentivorans DS-1]
 gi|154156133|gb|ABS63350.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Parvibaculum
           lavamentivorans DS-1]
          Length = 287

 Score =  122 bits (306), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 32/304 (10%), Positives = 84/304 (27%), Gaps = 47/304 (15%)

Query: 17  TTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDI---SKRIALLKLQKINGELE 73
               +++ F   P  + K    +     T+NG  I+  D+    + +     +       
Sbjct: 7   AALALILSFAAAPAFAQKDEPSADEPIATVNGTPISYSDVALADEEMGAALARLEPDVRF 66

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           +  +  LI   +     ++  +  D                                 ++
Sbjct: 67  QYLLGMLIDRRVVALAAKEKHVDDDPQVKRRQ--------------------------DY 100

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQ 193
           F +       W  ++++    +      +    K        +E   R +L         
Sbjct: 101 FNEKALRDVYWVQLMQDKVTDEA----AKAYYEKNIAGAPAEQEAHARHIL--------- 147

Query: 194 NQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKK 252
                + +  +               ++++        G   +    ++ P+F + +   
Sbjct: 148 --VQDKAKAAEIAAEIEGGKGFEEAAKEYSQDPGSADGGDLGWFKRDEMVPEFGEAVFSM 205

Query: 253 SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNA 312
                + P  TQ G   I + + RD+            +       +   + ++KLR++A
Sbjct: 206 KPGEVSAPVQTQFGWHLIQLVELRDVP--KPTYEEAHEEIIRQLARQEGQKLMEKLRTDA 263

Query: 313 IIHY 316
            I  
Sbjct: 264 KIEI 267


>gi|167617958|ref|ZP_02386589.1| survival protein SurA, putative [Burkholderia thailandensis Bt4]
          Length = 448

 Score =  122 bits (306), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 46/336 (13%), Positives = 113/336 (33%), Gaps = 31/336 (9%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAM-------SSRIRTTINGEVITDGDISKRIA 61
           +   ++       L+   I    S  + A+       +  +   +N +VIT  ++ +R+ 
Sbjct: 1   MKKTLRFAAVAAGLVASLITVAPSASAQALRAQGASLADEVVAVVNNDVITGRELDQRVG 60

Query: 62  LLKLQKING--------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNT 113
           L+  +            +L    + ++++E ++ Q  +  GI  D+ TV     + A+  
Sbjct: 61  LIARRLQQQKAPVPPTDQLRAQVLNQMVLERIQVQRAKDDGIVVDNATVQATLGRLAQAN 120

Query: 114 GLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMK-N 172
           G+  + + + ++ QG+  + F +    + +   + + +   K    + E+ +     +  
Sbjct: 121 GMPLDQYKARIEAQGVPWDLFVRDARTELMLSKLREKEVDSKITVSDAEVASYIASQRGP 180

Query: 173 ITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIH----D 228
               +  +R     +       Q  +    K AE    +        E+ A+        
Sbjct: 181 NAGAQQDLRLEHIFVKAPTNAPQADIDAAQKKAEGLLQQALASGTNFERLATSQSEADDA 240

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQNNTTNP--YVTQKGVEYIAICDKR----DLGGEI 282
              G   +   S L     + + K +    NP       G E + + D+R          
Sbjct: 241 KKGGDLGFKAPSSLPSDVVDAVSKLRPGEVNPTLIRVPDGFEIVRLVDRRASQNPAASPK 300

Query: 283 ALKAYLSAQNT---PTKIEKHEAEYVKKLRSNAIIH 315
            ++ ++          K E    + +  +R    I 
Sbjct: 301 IVQTHVRHILLRVGEGKSESQARQQLIDIRRQ--IE 334



 Score =  103 bits (257), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 16/156 (10%), Positives = 54/156 (34%), Gaps = 2/156 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +     +    + +          +   + +++   ++++ D                 +
Sbjct: 287 VDRRASQNPAASPKIVQTHVRHILLRVGEGKSESQARQQLIDIRRQIEAGGDFEKFARTY 346

Query: 223 ASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
           +        G   ++   +  P+F+  +        +NP  T+ G   I +  +RD  G 
Sbjct: 347 SQDGSASQGGDLGWISPGETVPEFERAMNALQDGQVSNPVRTEYGYHLIQVLGRRDAEGS 406

Query: 282 IALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           +  +  +        K E+  ++++++LR ++ +  
Sbjct: 407 VQQQMDIARQAIGQRKAEQAYSDWLRELRDSSYVQI 442


>gi|149191632|ref|ZP_01869876.1| parvulin-like peptidyl-prolyl isomerase [Vibrio shilonii AK1]
 gi|148834532|gb|EDL51525.1| parvulin-like peptidyl-prolyl isomerase [Vibrio shilonii AK1]
          Length = 419

 Score =  122 bits (306), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 34/296 (11%), Positives = 100/296 (33%), Gaps = 12/296 (4%)

Query: 28  VPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQE 79
           + + +        R+R  +N  VI   DI      L       +        +++  + +
Sbjct: 1   MALHAIAEPVELDRVRVIVNDGVILQSDIDSATKTLTANARKNDQELPSADIIQEQILDK 60

Query: 80  LIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLA 139
           LI+E L+ QE ++ G+  D N +       A+N   + E     + ++G+    F++ + 
Sbjct: 61  LILEKLQLQEADRIGVRIDDNRLESTLNDIAKNNNQTIEQLRQTVREEGLTWEAFREQIR 120

Query: 140 IQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQ 199
            +    +        +   L  E+    + +   +      +     +  N  +++   +
Sbjct: 121 DEIAASEARNAMVRQRINILPAEVDNLAELLAKESDATVTYKIRHIQLRFNDGEDKSVQE 180

Query: 200 KRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTT 258
           ++ KD                 ++     +  G   ++ + ++   F +    +++    
Sbjct: 181 QQAKDLVARLKSGEDFATMAYTYSKGPKALEGGDWGWMRKEEMPTIFADQIKMQTKGTII 240

Query: 259 NPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
            P+ +  G   + I D +    +        ++  + T    ++     +  + + 
Sbjct: 241 GPFRSGVGFHILKIEDVKGLETVSVTEVNARHILIKPTVILSDEGVQRELNNIIAK 296



 Score = 77.8 bits (189), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 32/269 (11%), Positives = 79/269 (29%), Gaps = 4/269 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     LL  +       KI   +L     + + +++         +        
Sbjct: 139 ILPAEVDNLAELLAKESDATVTYKIRHIQLRFNDGEDKSVQEQQAKDLVARLKSGEDFAT 198

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I               +   I   +   
Sbjct: 199 MAYTYSKGPKALEGGDWGWMRKEEMPTIFADQIKMQTKGTIIGPFRSGVGFHILKIEDVK 258

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK-LEKFASKI-HD 228
              TV    +      I    + +   VQ+ + +             +  E+++      
Sbjct: 259 GLETVSVTEVNARHILIKPTVILSDEGVQRELNNIIAKVQSGESTFAEMAEQYSQDPGSA 318

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDL-GGEIALKA 286
           V  G+  Y       P+F++ ++       + P+ T  G   + + D+RD+     A++ 
Sbjct: 319 VQGGELGYQTPELYVPEFKHQVETLPIGQISKPFKTVHGWHIVEVLDRRDVDKTGSAMQN 378

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
                    K  +  + ++++LR++A + 
Sbjct: 379 RAYRILFNRKFNEEASAWIQELRASAFVE 407


>gi|144897576|emb|CAM74440.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 421

 Score =  122 bits (306), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 36/278 (12%), Positives = 94/278 (33%), Gaps = 9/278 (3%)

Query: 17  TTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEK-- 74
                      + + S     M  R+   IN E I+  D+  R+ L  +     + ++  
Sbjct: 5   IVLTCATAALALTLWSGAQAQMLDRVVAVINDEAISYRDVEARVRLALVSSNIPDSQEAR 64

Query: 75  -----IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
                  ++++I E L+ QE ++  I   +  V+       + + +      S L +QG+
Sbjct: 65  QRVVPQVLRKMIDERLQLQEAQRLSIVLSNADVDGAIATIEQQSRMPRGALLSNLARQGV 124

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPD 189
                ++ +     W  +V      +    E E+    Q + +      +    +F   +
Sbjct: 125 DPARVREQIRADLTWMRLVTRVIGPQIRIGEEEVNDRLQSLADRQGLREVRAAEIFLPVE 184

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
           +  Q     +   +  +E   +     +   +F+      + G   ++ +  +  +   +
Sbjct: 185 SPDQE-AEARAMGERLQEGLRQGTSFQSLARQFSRSPTSSNGGLLGWVSQGMVDDEVAAV 243

Query: 250 -LKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA 286
                +  T+    T  G   + + + R +G  +  + 
Sbjct: 244 LETLDRGQTSQLVRTSTGFYLLQVLETRIIGQSVNAED 281



 Score = 57.4 bits (136), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 19/118 (16%), Positives = 44/118 (37%), Gaps = 2/118 (1%)

Query: 199 QKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLK-KSQNNT 257
           +  + +   +  R  K C + +  A+K       +   +   +L P+ + ++   + N  
Sbjct: 300 KADLMERAFALTRNAKSCAEFDALATKAGAPLPPRQGPVRIGELPPELKGMVAGMAANQV 359

Query: 258 TNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
             P  T +G+    +C ++D           +  Q    + +     Y++ LR  A I
Sbjct: 360 GVPMDTPQGIMVPMVCSRQDAMVVSPPTAEQVRRQIEDERRDMLSRRYLRNLRRAAFI 417


>gi|261378504|ref|ZP_05983077.1| SurA/PPIASE domain protein [Neisseria cinerea ATCC 14685]
 gi|269145052|gb|EEZ71470.1| SurA/PPIASE domain protein [Neisseria cinerea ATCC 14685]
          Length = 331

 Score =  122 bits (306), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 34/286 (11%), Positives = 80/286 (27%), Gaps = 17/286 (5%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKLQKING------ELEKIAVQELIVETLKKQEIEK 92
           S  I    + EVIT   +++ +A  K     G       L +  + +L+ ++L  Q  ++
Sbjct: 54  SDGIAAVADNEVITRRRLAQAVADAKANLPKGVQISDTALTEQVLMQLVNQSLIVQAGKR 113

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
                +                      +    +        K           V + + 
Sbjct: 114 R----NIQAGEAEIAAVVAQNPSLKNLSAEQRRELADSIIAEKVRQQAVMQNSRVSEAEV 169

Query: 153 MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRL 212
                    E    +             R     I  +        +  I+         
Sbjct: 170 DRFI-----EQAQKQGVTLPEGEPMRQYRAQHILIKADSENAAVGAESTIRKIYGEARSG 224

Query: 213 PKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIA 271
               +   +++      + G   +  +  + P F+  ++       + P  TQ G   I 
Sbjct: 225 TDFSSLARQYSQDASAGNGGDLGWFADGVMVPAFEETVRSLKPGQVSAPVRTQFGWHIIK 284

Query: 272 ICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           + + R+    +  ++  +       K E+  A+ ++ L S A +  
Sbjct: 285 LNEVREAGTPQERVRNAVRQYIFQQKAERATADLLRDLHSGAYVDI 330


>gi|206559288|ref|YP_002230049.1| putative peptidyl-prolyl cis-trans isomerase [Burkholderia
           cenocepacia J2315]
 gi|198035326|emb|CAR51201.1| putative peptidyl-prolyl cis-trans isomerase [Burkholderia
           cenocepacia J2315]
          Length = 442

 Score =  122 bits (306), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 39/302 (12%), Positives = 99/302 (32%), Gaps = 22/302 (7%)

Query: 32  SYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVE 83
             +   ++  +   +N +VIT  ++ +R+ L+  +             L    + ++++E
Sbjct: 22  GSQGAQLADEVVAVVNNDVITGRELDQRVGLIARRLQQQNAPVPPADQLRGQVLNQMVLE 81

Query: 84  TLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSI 143
            ++ Q+ +  GI  D  TV     + A+  G++ + + + L+ QG+  + F      +  
Sbjct: 82  RIQVQKAKDDGIRVDDATVQATLQRLAQANGMTLDQYRARLEAQGVPWSIFTNDARTELT 141

Query: 144 WPDVVKNDFMLKYGNLEMEIPAN----KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQ 199
              + + +   K    + E+       +    +           + +  +    +    Q
Sbjct: 142 LSKLREREVDGKITVSDAEVANYIASQRGPNASQQQDLRFQHIFIKAPTNAPQADIEAAQ 201

Query: 200 KRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTN 259
           K+ +   +            +  +        G   +   S L         K +    N
Sbjct: 202 KKAEALLQQAKSGADFERLAKNNSEANDAKKGGDLGFKSPSALPADVVEAASKLRPGQVN 261

Query: 260 P--YVTQKGVEYIAICDKRDLGGEIALK--------AYLSAQNTPTKIEKHEAEYVKKLR 309
           P       G E + + D+R   G  A           ++  +    K E    + +  +R
Sbjct: 262 PTLIRVPDGFEIVRLVDRRQSQGASAAAPKIVQTHVRHILLRVGEGKSEGQARQQLVDIR 321

Query: 310 SN 311
           + 
Sbjct: 322 NQ 323



 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/287 (10%), Positives = 90/287 (31%), Gaps = 19/287 (6%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           ++G+ IT  D ++    +  Q+     ++  +       +K            +      
Sbjct: 150 VDGK-ITVSD-AEVANYIASQRGPNASQQQDL-RFQHIFIKAPTNAPQADIEAAQKKAEA 206

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN--------------D 151
            +Q A++         +  +           + +  ++  DVV+                
Sbjct: 207 LLQQAKSGADFERLAKNNSEANDAKKGGDLGFKSPSALPADVVEAASKLRPGQVNPTLIR 266

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
               +  + +      Q       +          +   + +++G  ++++ D       
Sbjct: 267 VPDGFEIVRLVDRRQSQGASAAAPKIVQTHVRHILLRVGEGKSEGQARQQLVDIRNQVEA 326

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYI 270
                     ++        G   ++   +  P+F+  +        + P  T+ G   I
Sbjct: 327 GGDFAKFARTYSQDGSASQGGDLGWISPGETVPEFERAMNNLQDGQISQPIRTEYGYHLI 386

Query: 271 AICDKRDLGGEIALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            + ++R+  G +  +  +        K E+  A+++++LR ++ + Y
Sbjct: 387 QVLNRREAEGSVQQQMDIARQAIGQRKAEQAYADWLRELRDSSYVQY 433


>gi|152982039|ref|YP_001352108.1| peptidyl-prolyl cis-trans isomerase SurA [Janthinobacterium sp.
           Marseille]
 gi|151282116|gb|ABR90526.1| peptidyl-prolyl cis-trans isomerase SurA [Janthinobacterium sp.
           Marseille]
          Length = 469

 Score =  122 bits (306), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 34/312 (10%), Positives = 96/312 (30%), Gaps = 32/312 (10%)

Query: 32  SYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--------ELEKIAVQELIVE 83
           +     ++  I   +N EVIT  D  +R  +++ +  +         +L++  ++ +IVE
Sbjct: 42  AAVQPRLADAIIVVVNNEVITRYDFLERYKMIEARLQSQGGNLPPREQLQRQLLERMIVE 101

Query: 84  TLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSI 143
             + Q+ +++GI  D   ++    + A    LS  +F   L++ G+  + F+  +  +  
Sbjct: 102 RAQLQQAKETGIKIDDTMLDRAMGRIAEQNKLSMPEFRKRLEEDGLVYSKFRNEIRDEMA 161

Query: 144 WPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTV----LFSIPDNKLQNQGFVQ 199
              + + +   K    ++EI A                 +    +    +   +     +
Sbjct: 162 IQRLREREVDNKVQVSDVEIDAYMAAHNAPAATAPQELHIAQILIRVPENATQKQLADSK 221

Query: 200 KRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTT 258
           +R  +                 ++     ++ G+  +     L   F             
Sbjct: 222 RRADEVVAQLAAGADFAKLASAYSDGTDGLTGGELGWRSAERLPQLFVDATANLQDGQIA 281

Query: 259 NPYVTQKGVEYIAICDKRDLG-------------------GEIALKAYLSAQNTPTKIEK 299
               +  G   + +  +R                       +    +++  +        
Sbjct: 282 PIVKSGNGFHILKLLGRRTQSVLRADGGASGATAAAAPAAVKQTHASHILIKVNQVVSAA 341

Query: 300 HEAEYVKKLRSN 311
                + +L+  
Sbjct: 342 EARRKLLELKQR 353



 Score = 97.4 bits (240), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 13/139 (9%), Positives = 48/139 (34%), Gaps = 2/139 (1%)

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLE 239
             + +    +  +      +K ++  +    +        + +++       G   ++  
Sbjct: 326 HASHILIKVNQVVSAAEARRKLLELKQRLDNKAATFEELAKLYSNDFSAAKGGDLGWIYP 385

Query: 240 SDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL-SAQNTPTKI 297
            D  P+F+  +        + P  +  G   I + +++        +  +        K+
Sbjct: 386 GDTVPEFERAMDALPIGQVSEPIESPFGYHLILVTERKSDDVSQERQRMIARQAIREQKV 445

Query: 298 EKHEAEYVKKLRSNAIIHY 316
           E+   ++++++R  A + Y
Sbjct: 446 EEATQDWLRQVRDRAYVEY 464


>gi|160901465|ref|YP_001567047.1| SurA domain-containing protein [Delftia acidovorans SPH-1]
 gi|160367049|gb|ABX38662.1| SurA domain [Delftia acidovorans SPH-1]
          Length = 475

 Score =  122 bits (306), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 45/299 (15%), Positives = 100/299 (33%), Gaps = 18/299 (6%)

Query: 31  VSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL-------QKINGEL-EKIAVQELIV 82
            +      +  I   +N E +T+ ++  R+A +         Q     L  +  ++ LIV
Sbjct: 61  GAKAGVRSADYIVAVVNSEPVTNNEVRARMARVAQNIAEQGGQMPPEALLAREVLERLIV 120

Query: 83  ETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQS 142
           E  + QE + +G+  D   V+      AR  GL      S L  +G+ +  F++ L  Q 
Sbjct: 121 EKAQLQEAKDTGLRVDDYAVDQALTNVARQNGLDKAGLQSRLRAEGVNEKQFREELRRQI 180

Query: 143 IWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQK 200
               + + D   +    + +I     +Q+          +      I   +  +   V +
Sbjct: 181 TLQRLRERDVDGRVRVTDADIDRYLAEQRSGGADKAPAAVNLGHILISVPENASPAEVAE 240

Query: 201 RIKDAEESRLRLPKDCNKL---EKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNN 256
           R   A+++        + L   ++F+        G             F + + + +Q  
Sbjct: 241 REARAKQAAEAARTQGDFLAVVKEFSDVPDGQGGGAMGMRPLDRYPELFTKAVGQTAQGG 300

Query: 257 TTNPYVTQKGVEYIAICDKRDLG----GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
              P+ +  G   + + +K   G           ++  +      E   A+ +   +  
Sbjct: 301 IVGPFRSGAGFHVLKVLEKSQAGMPSVVTQNHARHILLRIGDQMTEADAAKRLADYKRR 359



 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 39/282 (13%), Positives = 91/282 (32%), Gaps = 12/282 (4%)

Query: 46  INGEV-ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           ++G V +TD DI + +A  +    +     + +  +++   +     +            
Sbjct: 190 VDGRVRVTDADIDRYLAEQRSGGADKAPAAVNLGHILISVPENASPAEVAEREARAKQAA 249

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND--------FMLKY 156
              +   +     ++FS   D QG G    +       ++   V           F    
Sbjct: 250 EAARTQGDFLAVVKEFSDVPDGQGGGAMGMRPLDRYPELFTKAVGQTAQGGIVGPFRSGA 309

Query: 157 GNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDC 216
           G   +++    Q      V +   R +L  I D   +     +           +     
Sbjct: 310 GFHVLKVLEKSQAGMPSVVTQNHARHILLRIGDQMTEADAAKRLADYKRRVDSGQASF-E 368

Query: 217 NKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDK 275
           +   +F+      + G   +       P+F+ +L        ++P V++ GV  I + ++
Sbjct: 369 SLAREFSQDGSARNGGDLGWASPGQFVPEFEQVLNALQPGQVSDPLVSRFGVHLIQLIER 428

Query: 276 RDLG-GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           R         +  +       K+E     ++++LR  A + Y
Sbjct: 429 RQAALTPREQRDMVRNVVRERKLETDYQAWLQELRGRAYVEY 470


>gi|154706423|ref|YP_001425383.1| peptidyl-prolyl cis-trans isomerase [Coxiella burnetii Dugway
           5J108-111]
 gi|154355709|gb|ABS77171.1| peptidyl-prolyl cis-trans isomerase [Coxiella burnetii Dugway
           5J108-111]
          Length = 321

 Score =  122 bits (306), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 62/327 (18%), Positives = 112/327 (34%), Gaps = 19/327 (5%)

Query: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDI---- 56
           M  K+ TS+   +    T         +P  +        +I   +N E+IT  ++    
Sbjct: 1   MWKKILTSMVIILS--VTSISAFAQSTLPAPNATHEQSLDQIVAVVNDEIITQSELNHAL 58

Query: 57  ----SKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
                + +            +K  + +LI + L+ Q  + + I   +N +N    + ++ 
Sbjct: 59  TAAKQQFMQRQISLPDQKTFKKQVLDQLIYQKLQLQVAKHNQIKVTNNEINAAVARISQA 118

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN 172
             LS       L ++GI    F+  L  Q I   +            + +I A +++   
Sbjct: 119 NHLSQTALKQKLTQEGISYKEFRSQLQKQLIISKLQHQALQDTISINKSDIAAFQKQHAG 178

Query: 173 IT-VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI 231
                EY I T+L  +P +  Q Q    K        +L+         K          
Sbjct: 179 QIASTEYHIATILIPLPASATQAQINHAKGKAALVLKQLQKGSSFETAMK-----MHPGS 233

Query: 232 GKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSA 290
               +    +L   F + +LK   N  T P     G   I + DK            +  
Sbjct: 234 ADLGWRSAKELPQVFVKTVLKMKPNEVTGPIQAPNGFHIIKLLDKE--AKNTVSDQQIQR 291

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIHYY 317
                K+EK   +++ +LRS+A IH Y
Sbjct: 292 IVYQQKVEKALQKWLTQLRSSAYIHIY 318


>gi|238758995|ref|ZP_04620166.1| Chaperone surA [Yersinia aldovae ATCC 35236]
 gi|238702806|gb|EEP95352.1| Chaperone surA [Yersinia aldovae ATCC 35236]
          Length = 434

 Score =  122 bits (305), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 37/296 (12%), Positives = 106/296 (35%), Gaps = 16/296 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--------EL 72
           +++   +    ++ +     ++   ++  V+   D+   +  +KL              L
Sbjct: 7   LILGLVVCANTAFAAPQEVDKVAAVVDNGVVLQSDVDGLLQSVKLNAQQSGQQVPDDATL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ ++ Q  +K GIT     ++      A    ++A    S L   G+  +
Sbjct: 67  RHQILERLIMDNIQLQMAKKMGITISDEALDKAIADIAAQNRMTAAQMRSRLAADGLNYD 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            +++ +  + +  +V  N+   +   L  E+ +  +++ N T  +  +      IP  + 
Sbjct: 127 TYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQVGNQTSGDAELNLSHILIPLPEN 186

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +Q  V +    A+     +    +        ++    +  G+  +    +L   F + 
Sbjct: 187 PSQQQVDQAEDLAKRLVTEIKGGADFGKLAIANSADSQALKGGQMGWGKLQELPSLFAER 246

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKH 300
           L   ++ +   P  +  G   + + D R     +        ++  + +P   +  
Sbjct: 247 LQSANKGDVVGPIRSGVGFHILKVNDIRGADKTVSVTEVHARHILLKPSPVMTDDQ 302



 Score = 81.6 bits (199), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/168 (13%), Positives = 55/168 (32%), Gaps = 4/168 (2%)

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
                G   +++   +   K ++V E   R +L         +Q   +     A+    +
Sbjct: 259 IRSGVGFHILKVNDIRGADKTVSVTEVHARHILLKPSPVMTDDQARAKLTAAAADIKSGK 318

Query: 212 LPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEY 269
                   ++ +      +  G   +       P F++ + K S+   + P  +  G   
Sbjct: 319 -SSFATIAKEISQDPGSAMQGGDLGWASPDIYDPAFRDAVMKLSKGEISAPVHSSFGWHL 377

Query: 270 IAICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           I + D R +   + A K          K  +    ++++ R+ A +  
Sbjct: 378 IQLVDTRQVDKTDAAQKDKAYRMLFSRKFAEEAQTWMQEQRAAAYVKI 425


>gi|254247257|ref|ZP_04940578.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Burkholderia
           cenocepacia PC184]
 gi|124872033|gb|EAY63749.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Burkholderia
           cenocepacia PC184]
          Length = 454

 Score =  122 bits (305), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 39/302 (12%), Positives = 99/302 (32%), Gaps = 22/302 (7%)

Query: 32  SYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVE 83
             +   ++  +   +N +VIT  ++ +R+ L+  +             L    + ++++E
Sbjct: 34  GSQGAQLADEVVAVVNNDVITGRELDQRVGLIARRLQQQNAPVPPADQLRAQVLNQMVLE 93

Query: 84  TLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSI 143
            ++ Q+ +  GI  D  TV     + A+  G++ + +   L+ QG+  + F      + +
Sbjct: 94  RIQVQKAKDDGIRIDDATVQATLQRLAQANGMTLDQYRGRLEAQGVPWSIFTNDARTELM 153

Query: 144 WPDVVKNDFMLKYGNLEMEIPAN----KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQ 199
              + + +   K    + E+       +    +           + +  +    +    Q
Sbjct: 154 LSKLREREVDGKITVSDAEVANYIASQRGPNASQQQDLRFQHIFIKAPTNAPQADIEAAQ 213

Query: 200 KRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTN 259
           K+     +            +  +        G   +   S L     +   K +    N
Sbjct: 214 KKADALLQQAKSGADFERLAKNNSEANDAKKGGDLGFKSPSALPADVVDAASKLRPGQVN 273

Query: 260 P--YVTQKGVEYIAICDKRDLGGEIALK--------AYLSAQNTPTKIEKHEAEYVKKLR 309
           P       G E + + D+R   G  A           ++  +    K E    + +  +R
Sbjct: 274 PTLIRVPDGFEIVRLVDRRQSQGASAAAPKIVQTHVRHILLRVGEGKSEGQARQQLIDIR 333

Query: 310 SN 311
           + 
Sbjct: 334 NQ 335



 Score =  105 bits (262), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 29/287 (10%), Positives = 89/287 (31%), Gaps = 19/287 (6%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           ++G+ IT  D ++    +  Q+     ++  +       +K            +      
Sbjct: 162 VDGK-ITVSD-AEVANYIASQRGPNASQQQDL-RFQHIFIKAPTNAPQADIEAAQKKADA 218

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN--------------D 151
            +Q A++         +  +           + +  ++  DVV                 
Sbjct: 219 LLQQAKSGADFERLAKNNSEANDAKKGGDLGFKSPSALPADVVDAASKLRPGQVNPTLIR 278

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
               +  + +      Q       +          +   + +++G  ++++ D       
Sbjct: 279 VPDGFEIVRLVDRRQSQGASAAAPKIVQTHVRHILLRVGEGKSEGQARQQLIDIRNQVEA 338

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYI 270
                     ++        G   ++   +  P+F+  +        + P  T+ G   I
Sbjct: 339 GGDFAKFARTYSQDGSASQGGDLGWISPGETVPEFERAMNNLQDGQISQPIRTEYGYHLI 398

Query: 271 AICDKRDLGGEIALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            + ++R+  G +  +  +        K E+  A+++++LR ++ + Y
Sbjct: 399 QVLNRREAEGSVQQQMDIARQAIGQRKAEQAYADWLRELRDSSYVQY 445


>gi|167590259|ref|ZP_02382647.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Burkholderia
           ubonensis Bu]
          Length = 452

 Score =  122 bits (305), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 34/299 (11%), Positives = 95/299 (31%), Gaps = 22/299 (7%)

Query: 35  SWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVETLK 86
              ++  +   +N +VIT  ++ +R+ L+  +             +    + ++++E ++
Sbjct: 35  GAQLTDEVVAVVNNDVITGRELDQRVGLISRRLKQQNAPVPPLDQMRAQVLNQMVLERIQ 94

Query: 87  KQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPD 146
            Q+ +  GI  D   V     + A+  G++ + + + ++ QG+  + F      + +   
Sbjct: 95  VQKAKDDGIRIDDAAVQSTLQRLAQANGMTLDQYRARIEAQGVPWSVFTGDARTELMLSK 154

Query: 147 VVKNDFMLKYGNLEMEIPANKQKMK----NITVREYLIRTVLFSIPDNKLQNQGFVQKRI 202
           + + +   K    + E+ +     +    +           + +       +    QK+ 
Sbjct: 155 LREREVDSKITVSDAEVASYIASQRGPSASQQQDLRFQHIFVKAPTSAPQADIEAAQKKA 214

Query: 203 KDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNP-- 260
               +            +  +        G   +     L         + +    NP  
Sbjct: 215 DALLKQAQSGADFERLAKNNSEADDAKKGGDLGFKSPGALPADVVAAASQLRPGQVNPTL 274

Query: 261 YVTQKGVEYIAICDKRDLGGEIALK--------AYLSAQNTPTKIEKHEAEYVKKLRSN 311
                G E + + D+R   G  A           ++  +    K E    + +  +R  
Sbjct: 275 IRVPDGFEIVRLVDRRQSQGASAAAPKIVQTHVRHILLRVGEGKSEGQARQQLIDIRKQ 333



 Score =  102 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/283 (10%), Positives = 88/283 (31%), Gaps = 16/283 (5%)

Query: 48  GEVITDGDISKRIALLKLQKINGELEKIAVQ-ELIV--------ETLKKQEIEKSGITFD 98
              IT  D ++  + +  Q+     ++  ++ + I         +   +   +K+     
Sbjct: 161 DSKITVSD-AEVASYIASQRGPSASQQQDLRFQHIFVKAPTSAPQADIEAAQKKADALLK 219

Query: 99  SNTVNYFFVQHARNTGLSAEDFS--SFLDKQGIGDNHFKQYLAIQSIWPDVVKN--DFML 154
                  F + A+N   + +         K            A Q     V         
Sbjct: 220 QAQSGADFERLAKNNSEADDAKKGGDLGFKSPGALPADVVAAASQLRPGQVNPTLIRVPD 279

Query: 155 KYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
            +  + +      Q       +          +   + +++G  ++++ D  +       
Sbjct: 280 GFEIVRLVDRRQSQGASAAAPKIVQTHVRHILLRVGEGKSEGQARQQLIDIRKQVEAGGD 339

Query: 215 DCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAIC 273
                  ++        G   ++   +  P+F+  +        + P  T+ G   I + 
Sbjct: 340 FAKFARTYSQDGSASQGGDLGWISPGETVPEFERAMNNLQDGQVSIPVRTEYGYHLIQVL 399

Query: 274 DKRDLGGEIALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           ++R+  G +  +  +        K E+  A+++++LR ++ + 
Sbjct: 400 ERRESEGSVQQQMDIARQAIGQRKAEQAYADWLRELRDSSYVQ 442


>gi|300310041|ref|YP_003774133.1| parvulin-like peptidyl-prolyl cis-trans isomerase [Herbaspirillum
           seropedicae SmR1]
 gi|124483574|emb|CAM32660.1| Parvulin-like peptidyl-prolyl [Herbaspirillum seropedicae]
 gi|300072826|gb|ADJ62225.1| parvulin-like peptidyl-prolyl cis-trans isomerase protein
           [Herbaspirillum seropedicae SmR1]
          Length = 496

 Score =  122 bits (305), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 44/292 (15%), Positives = 99/292 (33%), Gaps = 20/292 (6%)

Query: 40  SRIRTTINGEVITDGDISKRIALLKLQK--------INGELEKIAVQELIVETLKKQEIE 91
             I   +N EVIT  +++ R+A +  +            +L +  V+ +IVE  + Q  +
Sbjct: 90  DSIMVVVNNEVITRQEVADRLASVVKRMSAQNVQLPPRDQLVRQLVERMIVERAQAQMAK 149

Query: 92  KSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
           ++GI  D   ++    + A    LS   F + L+ +G+    F++ +  + +   + + +
Sbjct: 150 ENGIVVDDAMLDRAMQRIADQNKLSMAQFRTRLEAEGMNYASFREEIRREILSQRLRERE 209

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
              K    E E+        N   +   +      I   +      + +R + AE+   +
Sbjct: 210 VDNKVVVTESEVDNYLAAEANAGGQRQELDIAQILIRVPENATPDQLAQRRERAEDVLRQ 269

Query: 212 LPKDCNKLEKFASKIHDV---SIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGV 267
           L    +  +  A+        S G   +     L   F   + K      +    +  G 
Sbjct: 270 LKTGADFAKTAAAYSDASDALSGGDLGWRPADRLPQLFLDGVAKLQDGQVSGLLKSGNGF 329

Query: 268 EYIAICDKRDLGGEIALK--------AYLSAQNTPTKIEKHEAEYVKKLRSN 311
             + +  +R   G  A           ++  +             + +L+  
Sbjct: 330 HILKLVGRRTADGAQAAAPAVQQTHVRHILIKVNQVVTAAEAKRKLTELKER 381



 Score =  102 bits (254), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 16/139 (11%), Positives = 48/139 (34%), Gaps = 2/139 (1%)

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLE 239
               +    +  +      +K  +  E             + +++ +     G   ++  
Sbjct: 354 HVRHILIKVNQVVTAAEAKRKLTELKERLDHGSATFEELAKLYSNDLSASKGGDLGWVYP 413

Query: 240 SDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKR-DLGGEIALKAYLSAQNTPTKI 297
            D  P+F+  + +      + P  T  G   I + +++ D   +   +          KI
Sbjct: 414 GDTVPEFERAMDQLKPGEVSQPIETPFGYHLIQVVERKTDDASKERARQAARQAIRERKI 473

Query: 298 EKHEAEYVKKLRSNAIIHY 316
           ++   ++++++R  A + Y
Sbjct: 474 DEATEDWMRQIRDRAYVEY 492


>gi|238797487|ref|ZP_04640985.1| Chaperone surA [Yersinia mollaretii ATCC 43969]
 gi|238718628|gb|EEQ10446.1| Chaperone surA [Yersinia mollaretii ATCC 43969]
          Length = 434

 Score =  122 bits (305), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 36/296 (12%), Positives = 106/296 (35%), Gaps = 16/296 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--------EL 72
           +++   +    ++ +     ++   ++  V+   D+   +  +KL              L
Sbjct: 7   LILGLVVCANTAFAAPQEVDKVAAVVDNGVVLQSDVDGLLQSVKLNAQQAGQQVPDDATL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ ++ Q  +K GIT     ++      A    ++     S L   G+  +
Sbjct: 67  RHQILERLIMDNIQLQMAKKMGITVSDEALDKAIADIAAQNRMTTAQMRSRLAADGLNYD 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            +++ +  + +  +V  N+   +   L  E+ +  +++ N T  +  +      IP  + 
Sbjct: 127 TYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQIGNQTSADAELNLSHILIPLPEN 186

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +Q  V +  + A +    +    +        ++    +  G+  +    +L   F + 
Sbjct: 187 PSQQQVDQAEELANKLVSDIKGGADFGKLAIANSADSQALKGGQMGWGKLQELPSLFAER 246

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKH 300
           L   ++ +   P  +  G   + + D R     +        ++  + +P   +  
Sbjct: 247 LQSANKGDVVGPIRSGVGFHILKVNDIRGADKTVSVTEVHARHILLKPSPVMTDDQ 302



 Score = 81.3 bits (198), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/168 (14%), Positives = 55/168 (32%), Gaps = 4/168 (2%)

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
                G   +++   +   K ++V E   R +L         +Q   +     A+    +
Sbjct: 259 IRSGVGFHILKVNDIRGADKTVSVTEVHARHILLKPSPVMTDDQARAKLTAAAADIKSGK 318

Query: 212 LPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEY 269
                N  ++ +      V  G   +       P F++  +K  +   + P  +  G   
Sbjct: 319 ATF-ANIAKEISQDPGSAVQGGDLGWASPDIYDPAFRDALMKLQKGEISAPVHSSFGWHL 377

Query: 270 IAICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           I + D R +   + A K          K  +    ++++ R+ A +  
Sbjct: 378 IQVVDTRQVDKTDAAQKDRAYRMLFSRKFAEEAQTWMQEQRAAAYVKI 425


>gi|329894605|ref|ZP_08270411.1| Survival protein SurA precursor (Peptidyl-prolyl cis-trans
           isomerase SurA) [gamma proteobacterium IMCC3088]
 gi|328922959|gb|EGG30287.1| Survival protein SurA precursor (Peptidyl-prolyl cis-trans
           isomerase SurA) [gamma proteobacterium IMCC3088]
          Length = 421

 Score =  122 bits (305), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 42/311 (13%), Positives = 108/311 (34%), Gaps = 12/311 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQK----- 67
           +K L      +        +  +  +  ++   ++ +VI + ++ +R+ ++K        
Sbjct: 1   MKQLVKLAAGLALGCAISGAQAAVEILDKVIAVVDDDVIMESELQERLIVVKNNITSRGL 60

Query: 68  ---INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +  LI+E+++ Q+  + GI  +   +     + A   GL+ + F   L
Sbjct: 61  EAPPEDALVRETLDRLILESIQLQKGVRYGIRIEDQQLAAAVGRLASQNGLTPQQFVDQL 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
           ++ G         +  + I   V   +   +      EI A     +   + +   R + 
Sbjct: 121 EQSGGSYGELLANIEREMIIQRVQGGNVNQRIDITTAEIEAFLDTEEGQQLIQPAYRLIH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +  +   +     +   ++   R+   ++ N++   ++  +    G      ESDL  
Sbjct: 181 ARLDVSDDIDLDA-ARTYVESLAERINAGEEFNEVIGASTDPYQFKGGDLGIRPESDLPS 239

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKRDLG--GEIALKAYLSAQNTPTKIEKHE 301
            F  +     Q +   P    +   +I + +KR            ++  + +     +  
Sbjct: 240 LFAPIAPTMEQGSFAGPIENGRSFHFIYLLEKRGGTQIIPQTSVRHILIKPSEILTNEQA 299

Query: 302 AEYVKKLRSNA 312
            E   +LR  A
Sbjct: 300 QELAAELRQRA 310



 Score = 97.4 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 32/275 (11%), Positives = 84/275 (30%), Gaps = 6/275 (2%)

Query: 46  INGEV-ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           +N  + IT  +I   +   + Q++     ++    L  +     +++ +    +S     
Sbjct: 148 VNQRIDITTAEIEAFLDTEEGQQLIQPAYRLIHARL--DVSDDIDLDAARTYVESLAERI 205

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP 164
              +       ++ D   F                   I P + +  F     N      
Sbjct: 206 NAGEEFNEVIGASTDPYQFKGGDLGIRPESDLPSLFAPIAPTMEQGSFAGPIENGRSFHF 265

Query: 165 ANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFAS 224
               + +  T            I  +++      Q+   +  +  L      +   +++ 
Sbjct: 266 IYLLEKRGGTQIIPQTSVRHILIKPSEILTNEQAQELAAELRQRALDGEDFADLAREYSE 325

Query: 225 KI-HDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEI 282
            I      G   +     + P F+  +  ++ N  T P+ +Q G   + + D+RD     
Sbjct: 326 DIGSAQEGGDLGWASPGQMVPVFEEQMSNAELNAITEPFQSQFGWHILQVMDRRDQDVTQ 385

Query: 283 -ALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
              +          K ++    +++++R  A +  
Sbjct: 386 IVNRNRAQDYLHNQKYQEELEAWLQQIRDEAFVDI 420


>gi|332160260|ref|YP_004296837.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|325664490|gb|ADZ41134.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
          Length = 434

 Score =  122 bits (305), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 37/296 (12%), Positives = 106/296 (35%), Gaps = 16/296 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--------EL 72
           +++   +    ++ +     ++   ++  V+   D+   +  +KL              L
Sbjct: 7   LILGLVVCANTAFAAPQEVDKVAAVVDNGVVLQSDVDGLLQSVKLNAQQAGQQVPDDATL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ ++ Q  +K GIT     ++      A    ++     S L   G+  +
Sbjct: 67  RHQILERLIMDNIQLQMAKKMGITISDEALDKAIADIAAQNRMTPAQMRSRLAADGLNYD 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            +++ +  + +  +V  N+   +   L  E+ +  +++ N T  +  +      IP  + 
Sbjct: 127 TYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQIGNQTSGDAELNLSHILIPLPEN 186

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +Q  V +    A++    +    +        ++    +  G+  +    +L   F + 
Sbjct: 187 PSQQQVDQAEDLAKKLVSDIKGGADFGKLAIANSADSQALKGGQMGWGKLQELPSLFAER 246

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKH 300
           L   S+ +   P  +  G   + + D R     +        ++  + +P   +  
Sbjct: 247 LQSASKGDVVGPIRSGVGFHILKVNDIRGTDKTISVTEVHARHILLKPSPVMTDDQ 302



 Score = 82.4 bits (201), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 23/168 (13%), Positives = 54/168 (32%), Gaps = 4/168 (2%)

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
                G   +++   +   K I+V E   R +L         +Q   +     A+    +
Sbjct: 259 IRSGVGFHILKVNDIRGTDKTISVTEVHARHILLKPSPVMTDDQARAKLTAAAADIKSGK 318

Query: 212 LPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEY 269
                   ++ +      +  G   +       P F++  +K  +   + P  +  G   
Sbjct: 319 ANF-ATIAKEISQDPGSAMQGGDLGWASPDIYDPAFRDALMKLQKGEISAPVHSSFGWHL 377

Query: 270 IAICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           I + D R +   + A K          K  +    ++++ R+ A +  
Sbjct: 378 IQVVDTRQVDKTDAAQKDRAYRMLFSRKFAEEAQTWMQEQRAAAYVKI 425


>gi|254688956|ref|ZP_05152210.1| Chaperone surA precursor [Brucella abortus bv. 6 str. 870]
 gi|260754445|ref|ZP_05866793.1| SurA domain-containing protein [Brucella abortus bv. 6 str. 870]
 gi|260674553|gb|EEX61374.1| SurA domain-containing protein [Brucella abortus bv. 6 str. 870]
          Length = 318

 Score =  122 bits (305), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 67/317 (21%), Positives = 130/317 (41%), Gaps = 9/317 (2%)

Query: 5   VFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK 64
           +  +      +L     L     V   ++ +     ++   ++G  IT+ DI  R+A LK
Sbjct: 1   MMFARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVI--VSGNAITNSDIKHRMAFLK 58

Query: 65  LQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
           LQ+ +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +
Sbjct: 59  LQRKSGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVM 118

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
           ++ G+   HFK+Y+ +Q  W  +V   F       E E      K               
Sbjct: 119 NQSGVTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQ 178

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
                   +    +  + +    +     ++C+   + A  I DV++     ++E  L  
Sbjct: 179 VIFVVPASKRSPALLAKRRQEANALRARFQNCDSKRQQAKGILDVTVRDLGRIIEPQLPG 238

Query: 245 QF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ------NTPTKI 297
           ++ +++     N TT P+ T+KGVE++A+C  R +  +   +   S +          K 
Sbjct: 239 EWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKA 298

Query: 298 EKHEAEYVKKLRSNAII 314
           E+   +YV++LR  A I
Sbjct: 299 EELSKKYVQELREKATI 315


>gi|326319525|ref|YP_004237197.1| SurA domain-containing protein [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323376361|gb|ADX48630.1| SurA domain protein [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 476

 Score =  122 bits (305), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 41/277 (14%), Positives = 98/277 (35%), Gaps = 16/277 (5%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALLKLQK--------INGELEKIAVQELIVETL 85
           ++   +  I   +N E IT+ ++  R+A ++ Q             L +  ++ LI E +
Sbjct: 64  QAARQADFIVAVVNTEPITNNEVQARLARVEHQLAAQGGERPPRQVLAREVLERLINEKI 123

Query: 86  KKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWP 145
           + Q   +SGI  D   ++      AR   +S  +    L   GI    F+  L  Q +  
Sbjct: 124 QVQMAIESGIKVDDYAISQAEQSVARQNSVSIPEMHRRLAADGISPERFRSELRNQMLIQ 183

Query: 146 DVVKNDFMLKYGNLEMEIPANKQKMKNI-----TVREYLIRTVLFSIPDNKLQNQGFVQK 200
            + + D   +    ++++    +  +       +  E  +  +L ++P+N        ++
Sbjct: 184 RLRERDVESRVRVTDLDVDQYMRDQQQSAISDPSKIELNLANILVAVPENATPEVVEQRR 243

Query: 201 RIKDAEESRLRLPKDCNK-LEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTT 258
           +       R+R  +D  K   + +        G+            F + + +       
Sbjct: 244 QRAQQAADRVRAGEDFAKVARELSDAPDAPIGGELGLRPADRYPDLFVRTVQQVPVGGIA 303

Query: 259 NPYVTQKGVEYIAICDK-RDLGGEIALKAYLSAQNTP 294
            P  +  G   + + ++ R      A++ ++      
Sbjct: 304 GPVRSPAGFHVLRVLERSRAGIPSSAVQTHVRHILLR 340



 Score = 97.4 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 14/106 (13%), Positives = 38/106 (35%), Gaps = 2/106 (1%)

Query: 213 PKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIA 271
                   + +        G   +       P+F+  ++    +  + P V++ GV  I 
Sbjct: 366 ADFATLAREHSQDGSAKQGGDLGWAGPGRYVPEFEEAVEALKPDEISQPIVSRFGVHLIQ 425

Query: 272 ICDKRDLGGEI-ALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           + ++R+        +  +       K+E+    + ++ R+ A + Y
Sbjct: 426 LLERREAKLTQREQRDMVRDAVREKKLEEAFTNWAQEARARAYVEY 471


>gi|238897972|ref|YP_002923652.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|229465730|gb|ACQ67504.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 322

 Score =  122 bits (305), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 53/311 (17%), Positives = 113/311 (36%), Gaps = 13/311 (4%)

Query: 19  YFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE------- 71
            +VL+         + +    ++I   +N  VI   D++ R+  +K+   N         
Sbjct: 6   IYVLVWLLCSHFTVFSAPKEINKIVAIVNDSVILLSDLNHRLKAIKINANNINQSLPDDA 65

Query: 72  -LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
            L    ++ LIVE+++ Q   K G+      ++      AR   L+ +   S L  + I 
Sbjct: 66  ILRHQILERLIVESIQLQIANKIGLKIPDEDLDKIIADIARKNRLTVDQIRSKLASENIN 125

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
              ++  +  Q +  +V+KN    +   L  E+ +  + + N   +   +      IP  
Sbjct: 126 YGTYRNEIRNQILISEVLKNAVQPRINILPQEVDSLSKLILNEKNQNMELNLSQILIPLT 185

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLE---KFASKIHDVSIGKAQYLLESDLHPQFQ 247
           +  +Q  + K  K A +   +L K  N  +    +++       G   +    +L   F 
Sbjct: 186 ENPSQKEIDKAEKKANKLVSQLKKGANFAKLAIAYSADSQAFKGGTMGWKKVQELPTLFS 245

Query: 248 NLLKKSQN-NTTNPYVTQKGVEYIAICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYV 305
             LK     +   P  +  G   + I D   +      +K          K  +    ++
Sbjct: 246 EKLKVIHKFDIIGPIRSGVGFHILRINDLHTIFENSEDIKNQAYKILFNRKFSEQAETWI 305

Query: 306 KKLRSNAIIHY 316
           ++ R++A +  
Sbjct: 306 QEQRASAYVKI 316


>gi|164685824|ref|ZP_01945801.2| putative peptidyl-prolyl cis-trans isomerase surA [Coxiella
           burnetii 'MSU Goat Q177']
 gi|165918731|ref|ZP_02218817.1| putative peptidyl-prolyl cis-trans isomerase surA [Coxiella
           burnetii RSA 334]
 gi|212219488|ref|YP_002306275.1| peptidyl-prolyl cis-trans isomerase [Coxiella burnetii CbuK_Q154]
 gi|164601340|gb|EAX33680.2| putative peptidyl-prolyl cis-trans isomerase surA [Coxiella
           burnetii 'MSU Goat Q177']
 gi|165917559|gb|EDR36163.1| putative peptidyl-prolyl cis-trans isomerase surA [Coxiella
           burnetii RSA 334]
 gi|212013750|gb|ACJ21130.1| peptidyl-prolyl cis-trans isomerase [Coxiella burnetii CbuK_Q154]
          Length = 321

 Score =  122 bits (305), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 61/327 (18%), Positives = 112/327 (34%), Gaps = 19/327 (5%)

Query: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDI---- 56
           M  K+ TS+   +    T         +P  +        +I   +N E+IT  ++    
Sbjct: 1   MWKKILTSMVIILS--VTSISAFAQSTLPAPNATHEQSLDQIVAVVNDEIITQSELNHAL 58

Query: 57  ----SKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
                + +            +K  + +LI + L+ Q  + + I   +N +N    + ++ 
Sbjct: 59  TAAKQQFMQRQISLPDQKTFKKQVLDQLIYQKLQLQVAKHNQIKVTNNEINAAVARISQA 118

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN 172
             LS       L ++GI    F+  L  Q I   +            + +I A +++   
Sbjct: 119 NHLSQTALKQKLTQEGISYKEFRSQLQKQLIISKLQHQALQDTISINKSDIAAFQKQHAG 178

Query: 173 IT-VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI 231
                EY I T+L  +P +  Q Q    K        +L+         K          
Sbjct: 179 QIASTEYHIATILIPLPASATQAQINHAKGKAALVLKQLQKGSSFETAMK-----MHPGS 233

Query: 232 GKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSA 290
               +    +L   F + +LK   N  T P     G   + + DK            +  
Sbjct: 234 ADLGWRSAKELPQVFVKTVLKMKPNEVTGPIQAPNGFHIVKLLDKE--AKNTVSDQQIQR 291

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIHYY 317
                K+EK   +++ +LRS+A IH Y
Sbjct: 292 IVYQQKVEKALQKWLTQLRSSAYIHIY 318


>gi|167568839|ref|ZP_02361713.1| survival protein SurA, putative [Burkholderia oklahomensis C6786]
          Length = 449

 Score =  122 bits (305), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 37/333 (11%), Positives = 105/333 (31%), Gaps = 23/333 (6%)

Query: 2   TSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIA 61
             K     +    L+ +   +        +  +  +++  +   +N +VIT  ++ +R+ 
Sbjct: 1   MKKTLRFAAVASGLVASLITVAPAASAQALRAQGASLADEVVAVVNNDVITGRELDQRVG 60

Query: 62  LLKLQKING--------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNT 113
           L+  +            +L    + ++++E ++ Q  +  GI  D+ TV     + A+  
Sbjct: 61  LIARRLQQQKAPVPPIDQLRAQVLNQMVLERIQIQRAKDDGIVVDNATVQATLGRLAQAN 120

Query: 114 GLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNI 173
           G+  + + + ++ QG+  + F +    + +   + + +   K    + E+ +     +  
Sbjct: 121 GMPLDQYKARIEAQGVPWDVFVRDARTELMLSKLREKEVDGKITVSDAEVASYIASQRGP 180

Query: 174 TVREYLIRTVLFSIPDNKLQNQG-----FVQKRIKDAEESRLRLPKDCNKLEKFASKIHD 228
                    +                    +K     +++           +  +     
Sbjct: 181 NAGSQQDLRLEHIFVKAPTSAPQADIDVAQKKAEGLLQQALASGADFERLAKNNSEADDA 240

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQNNTTNP--YVTQKGVEYIAICDKR--------DL 278
              G   +   S L     + + K +    NP       G E + + D+R          
Sbjct: 241 KKGGDLGFKSPSSLPSDVVDAVSKLRPGQVNPTLVRVPDGFEIVRLVDRRASQSVSAASP 300

Query: 279 GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
                   ++  +    K E    + +  +R  
Sbjct: 301 KIVQTHVRHILLRVGEGKSESQARQQLIDIRRQ 333



 Score =  102 bits (253), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 17/168 (10%), Positives = 57/168 (33%), Gaps = 2/168 (1%)

Query: 151 DFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRL 210
                +  + +      Q +   + +          +   + +++   ++++ D      
Sbjct: 276 RVPDGFEIVRLVDRRASQSVSAASPKIVQTHVRHILLRVGEGKSESQARQQLIDIRRQVE 335

Query: 211 RLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEY 269
                      ++        G   ++   +  P+F+  +        +NP  T+ G   
Sbjct: 336 AGGDFEKFARTYSQDGSASQGGDLGWISPGETVPEFERAMNSLQDGQVSNPVRTEYGYHL 395

Query: 270 IAICDKRDLGGEIALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           I +  +RD  G +  +  +        K E+  ++++++LR ++ +  
Sbjct: 396 IQVLGRRDAEGSVQQQMDIARQAIGQRKAEQAYSDWLRELRDSSYVQI 443


>gi|307300974|ref|ZP_07580743.1| SurA domain protein [Sinorhizobium meliloti BL225C]
 gi|307317709|ref|ZP_07597147.1| SurA domain protein [Sinorhizobium meliloti AK83]
 gi|306896471|gb|EFN27219.1| SurA domain protein [Sinorhizobium meliloti AK83]
 gi|306903929|gb|EFN34515.1| SurA domain protein [Sinorhizobium meliloti BL225C]
          Length = 315

 Score =  122 bits (305), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 88/307 (28%), Positives = 144/307 (46%), Gaps = 7/307 (2%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           I  L +   L     V   +  +   +S +   +N  VIT GD++KR+A LKLQ+ +G  
Sbjct: 8   IVRLLSAVALAGALSVAAGTVTTAMAASTVEVVVNSTVITSGDVAKRVAFLKLQRQSGGA 67

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            + A Q+L+ E LK+ EI +   +  ++ V+  F + A    LS E     LD+ G+G +
Sbjct: 68  AE-AKQQLVDEVLKRAEIARVQQSVSTDEVDAAFARFAAGNKLSPEQLGKILDQAGVGVD 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
           HFKQY+A+Q  WP VV   +         ++     +                     + 
Sbjct: 127 HFKQYIAVQMSWPRVVNFRYGSASRLSGGDLVKRMMQGGGNKPVTTEYFLQQVIFVIPES 186

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK 252
           +      KR  +A  SR + P   +  + FA+   DVSI     +L   L   ++ L++K
Sbjct: 187 KRGAITAKRQAEANASRSQFPGC-DTSKAFAANYRDVSIRSLGRILAQQLPEDWKPLVEK 245

Query: 253 S-QNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEK----HEAEYVKK 307
           +    TT   VT+KGVEY+AIC KR +  + A +    A++   K  +    + A+Y+++
Sbjct: 246 AGDGMTTGTRVTEKGVEYLAICKKRQVNDDAAAEIVFRAEDLGKKKSEGEDPNSAKYLEE 305

Query: 308 LRSNAII 314
           LRS A I
Sbjct: 306 LRSKAQI 312


>gi|254693438|ref|ZP_05155266.1| Chaperone surA precursor [Brucella abortus bv. 3 str. Tulya]
 gi|261213691|ref|ZP_05927972.1| SurA domain-containing protein [Brucella abortus bv. 3 str. Tulya]
 gi|260915298|gb|EEX82159.1| SurA domain-containing protein [Brucella abortus bv. 3 str. Tulya]
          Length = 318

 Score =  122 bits (305), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 67/317 (21%), Positives = 130/317 (41%), Gaps = 9/317 (2%)

Query: 5   VFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK 64
           +  +      +L     L     V   ++ +     ++   ++G  IT+ DI  R+A LK
Sbjct: 1   MMFARPLIASMLGAAVFLTALGTVAAPAFAAGESEVKVI--VSGNAITNSDIKHRMAFLK 58

Query: 65  LQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
           LQ+ +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +
Sbjct: 59  LQRKSGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVM 118

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
           ++ G+   HFK+Y+ +Q  W  +V   F       E E      K               
Sbjct: 119 NQSGVTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQ 178

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
                   +    +  + +    +     ++C+   + A  I DV++     ++E  L  
Sbjct: 179 VIFVVPASKRSPALLAKRRQEANALRARFQNCDSTRQQAKGILDVTVRDLGRIIEPQLPG 238

Query: 245 QF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ------NTPTKI 297
           ++ +++     N TT P+ T+KGVE++A+C  R +  +   +   S +          K 
Sbjct: 239 EWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKA 298

Query: 298 EKHEAEYVKKLRSNAII 314
           E+   +YV++LR  A I
Sbjct: 299 EELSKKYVQELREKATI 315


>gi|123440995|ref|YP_001004984.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122087956|emb|CAL10744.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318607170|emb|CBY28668.1| survival protein SurA precursor (Peptidyl-prolyl cis-trans
           isomerase SurA) [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 434

 Score =  122 bits (305), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 37/296 (12%), Positives = 106/296 (35%), Gaps = 16/296 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--------EL 72
           +++   +    ++ +     ++   ++  V+   D+   +  +KL              L
Sbjct: 7   LILGLVVCANTAFAAPQEVDKVAAVVDNGVVLQSDVDGLLQSVKLNAQQAGQQVPDDATL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ ++ Q  +K GIT     ++      A    ++     S L   G+  +
Sbjct: 67  RHQILERLIMDNIQLQMAKKMGITISDEALDKAIADIAAQNRMTPAQMRSRLAADGLNYD 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            +++ +  + +  +V  N+   +   L  E+ +  +++ N T  +  +      IP  + 
Sbjct: 127 TYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQIGNQTSGDAELNLSHILIPLPEN 186

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
            +Q  V +    A++    +    +        ++    +  G+  +    +L   F + 
Sbjct: 187 PSQQQVDQAEDLAKKLVSDIKGGADFGKLAIANSADSQALKGGQMGWGKLQELPSLFAER 246

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKH 300
           L   S+ +   P  +  G   + + D R     +        ++  + +P   +  
Sbjct: 247 LQSASKGDVVGPIRSGVGFHILKVNDIRGADKTISVTEVHARHILLKPSPVMTDDQ 302



 Score = 82.0 bits (200), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/168 (13%), Positives = 54/168 (32%), Gaps = 4/168 (2%)

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
                G   +++   +   K I+V E   R +L         +Q   +     A+    +
Sbjct: 259 IRSGVGFHILKVNDIRGADKTISVTEVHARHILLKPSPVMTDDQARAKLTAAAADIKSGK 318

Query: 212 LPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEY 269
                   ++ +      +  G   +       P F++  +K  +   + P  +  G   
Sbjct: 319 ANF-ATIAKEISQDPGSAMQGGDLGWASPDIYDPAFRDALMKLQKGEISAPVHSSFGWHL 377

Query: 270 IAICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           I + D R +   + A K          K  +    ++++ R+ A +  
Sbjct: 378 IQVVDTRQVDKTDAAQKDRAYRMLFSRKFAEEAQTWMQEQRAAAYVKI 425


>gi|215919309|ref|NP_820955.2| putative peptidyl-prolyl cis-trans isomerase surA [Coxiella
           burnetii RSA 493]
 gi|206584194|gb|AAO91469.2| peptidyl-prolyl cis-trans isomerase [Coxiella burnetii RSA 493]
          Length = 321

 Score =  122 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 62/327 (18%), Positives = 113/327 (34%), Gaps = 19/327 (5%)

Query: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDI---- 56
           M  K+ TS+   +    T         +P  +        +I   +N E+IT  ++    
Sbjct: 1   MWKKILTSMVIILS--VTSISAFAQSTLPAPNATHEQSLDQIVAVVNDEIITQSELNHAL 58

Query: 57  ----SKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
                + +            +K  + +LI + L+ Q  + + I   +N +N    + ++ 
Sbjct: 59  TAAKQQFMQRQISLPDQKTFKKQVLDQLIYQKLQLQVAKHNQIKVTNNEINAAVARISQA 118

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN 172
             LS       L ++GI    F+  L  Q I   +            + +I A +++   
Sbjct: 119 NHLSQTALKQKLTQEGISYKEFRSQLQKQLIISKLQHQALQDTISINKSDIAAFQKQHAG 178

Query: 173 IT-VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI 231
               +EY I T+L  +P +  Q Q    K        +L+         K          
Sbjct: 179 QIASKEYHIATILIPLPASATQAQINHAKGKAALVLKQLQKGSSFETAMK-----MHPGS 233

Query: 232 GKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSA 290
               +    +L   F + +LK   N  T P     G   I + DK            +  
Sbjct: 234 ADLGWRSAKELPQVFVKTVLKMKPNEVTGPIQAPNGFHIIKLLDKE--AKNTVSDQQIQR 291

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIHYY 317
                K+EK   +++ +LRS+A IH Y
Sbjct: 292 IVYQQKVEKALQKWLTQLRSSAYIHIY 318


>gi|167814327|ref|ZP_02446007.1| putative peptidyl-prolyl cis-trans isomerase [Burkholderia
           pseudomallei 91]
 gi|122070637|sp|Q63X78|SURA_BURPS RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
          Length = 448

 Score =  122 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 38/336 (11%), Positives = 112/336 (33%), Gaps = 35/336 (10%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMS-----------SRIRTTINGEVITDGDISKRIA 61
           +K +  +  +    +  +++    A +             +   +N +VIT  ++ +R+ 
Sbjct: 1   MKKILRFAAVASGLVASLITVAPSASAQALRAQGASLADEVVAVVNNDVITGRELDQRVG 60

Query: 62  LLKLQKING--------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNT 113
           L+  +            +L    + ++++E ++ Q  +  GI  D+ TV     + A+  
Sbjct: 61  LIARRLQQQKAPVPPTDQLRAQVLNQMVLERIQVQRAKDDGIVVDNATVQATLGRLAQAN 120

Query: 114 GLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMK-N 172
           G+  + + + ++ QG+  + F +    + +   + + +   K    + E+ +     +  
Sbjct: 121 GMQLDQYKARIEAQGVPWDLFVRDARTELMLSKLREKEVDSKITVSDAEVASYIASQRGP 180

Query: 173 ITVREYLIRTVLFSIPDNKLQNQGFV----QKRIKDAEESRLRLPKDCNKLEKFASKIHD 228
               +  +R     +       Q  +    +K     +++           +  +     
Sbjct: 181 NAGSQQDLRLEHIFVKAPANAPQADIDVAQKKAEGLLQQALASGANFERLAKNQSEADDA 240

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQNNTTNP--YVTQKGVEYIAICDKR----DLGGEI 282
              G   +   + L     + + K +    NP       G E + + ++R          
Sbjct: 241 KKGGDLGFKSPASLPSDVVDAVSKLRPGEVNPTLIRVPDGFEIVRLVERRASQNPAASPK 300

Query: 283 ALKAYLSAQNT---PTKIEKHEAEYVKKLRSNAIIH 315
            ++ ++          K E    + +  +R    I 
Sbjct: 301 IVQTHVRHILLRVGEGKSESQARQQLIDIRRQ--IE 334



 Score =  103 bits (255), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 16/156 (10%), Positives = 54/156 (34%), Gaps = 2/156 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +     +    + +          +   + +++   ++++ D                 +
Sbjct: 287 VERRASQNPAASPKIVQTHVRHILLRVGEGKSESQARQQLIDIRRQIESGGDFEKFARTY 346

Query: 223 ASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
           +        G   ++   +  P+F+  +        +NP  T+ G   I +  +RD  G 
Sbjct: 347 SQDGSASQGGDLGWISPGETVPEFERAMNTLQDGQVSNPVRTEYGYHLIQVLGRRDAEGS 406

Query: 282 IALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           +  +  +        K E+  ++++++LR ++ +  
Sbjct: 407 VQQQMDIARQAIGQRKAEQAYSDWLRELRDSSYVQI 442


>gi|262275062|ref|ZP_06052873.1| peptidyl-prolyl cis-trans isomerase SurA [Grimontia hollisae CIP
           101886]
 gi|262221625|gb|EEY72939.1| peptidyl-prolyl cis-trans isomerase SurA [Grimontia hollisae CIP
           101886]
          Length = 432

 Score =  122 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 38/289 (13%), Positives = 92/289 (31%), Gaps = 15/289 (5%)

Query: 40  SRIRTTINGEVITDGDISKRIALLKLQKINGE------LEKIAVQELIVETLKKQEIEKS 93
            R+   +N  VI   DI      + L            LE+  + +LI+E L+ QE ++ 
Sbjct: 28  DRVVAVVNDGVILSSDIDALEKTVALNADQANLPPKDVLEQQILDQLILEELQLQEAKRL 87

Query: 94  GITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFM 153
           GI  D   +       A+   LS       L + GI  + ++  +  +    +       
Sbjct: 88  GIRIDDTRLEQAINSIAKERNLSVSQLQERLKRNGISWSSYRDQIRREMTISEARNAQVR 147

Query: 154 LKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN---KLQNQGFVQKRIKDAEESRL 210
            +   L  E+ +   ++    +     R     +  N   + + +  V +      +   
Sbjct: 148 RRISILPQEVESLASQLNAKNLENVEYRLSHIQLRLNEGAEKEEREIVAETANRLVKELK 207

Query: 211 RLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS-QNNTTNPYVTQKGVEY 269
                       +     +  G   ++   ++   F + +K + +     P+ +  G   
Sbjct: 208 DGRDFAALALANSKGPKALQGGDWGWMRLEEMPTIFADQIKNNGKGAIIGPFRSGVGYHI 267

Query: 270 IAICDK---RDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           + I D    + +        ++  + +    +      + ++   A I 
Sbjct: 268 LKITDVKGLKSVAVTEVKARHILIKPSIVLSDDGAKRQLNQMI--AQIK 314



 Score = 86.7 bits (212), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 17/137 (12%), Positives = 51/137 (37%), Gaps = 3/137 (2%)

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLES 240
             +   P   L + G  ++  +   + +       +  +++++     V  G   +    
Sbjct: 287 RHILIKPSIVLSDDGAKRQLNQMIAQIKKGEKSFEDLAKQYSADPGSAVKGGDLGWQTSE 346

Query: 241 DLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTKIE 298
              P+F++ +    +   + P+ T  G   + + D+R     + A++          K  
Sbjct: 347 LYVPEFKDKVDTLPEGEISEPFKTVHGWHIVQVLDRRQADRTDTAMQNRAYGMLLNRKFN 406

Query: 299 KHEAEYVKKLRSNAIIH 315
           +    ++++LR+ A + 
Sbjct: 407 EEVQAWLQELRAGAYVE 423


>gi|242238056|ref|YP_002986237.1| peptidyl-prolyl cis-trans isomerase SurA [Dickeya dadantii Ech703]
 gi|242130113|gb|ACS84415.1| Peptidylprolyl isomerase [Dickeya dadantii Ech703]
          Length = 433

 Score =  122 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 30/308 (9%), Positives = 102/308 (33%), Gaps = 15/308 (4%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--------EL 72
           +++   +     + +  +  ++   ++  V+ + DI+  +  +K+              L
Sbjct: 7   LILGLALSANTVFAAPQVMDKVAAVVDNGVVLESDINSLMQSVKMNSQESGQQLPDDATL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ +  Q  +K G     + ++      A+   ++ +   S L  +GI  +
Sbjct: 67  RHQILERLIMDNIVLQMAQKMGAQVSDDQLDRAIANIAQQNHMTLDQLRSRLAAEGINYD 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI--RTVLFSIPDN 190
            ++  +       DV  ++   +   L  E+ A  Q++ +    + +   + +L    + 
Sbjct: 127 TYRSQIRKDMTIADVRNSEVRRRVTVLPQEVDALAQQIASQGSDKEVNLSQILLPLPENP 186

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNL 249
             +     +       +   +          +++    +  G+  +    +L   F + L
Sbjct: 187 SQEQVDKAESLANRLVKDARQGADFGKLAITYSADPQALKGGQMGWGRPQELPSLFAERL 246

Query: 250 LKKSQNNTTNPYVTQKGVEYIAICDKRD----LGGEIALKAYLSAQNTPTKIEKHEAEYV 305
               +     P  +  G   + + D R     +        ++  + +    +      +
Sbjct: 247 ANPEKGQVIGPIRSGVGFHILRVNDTRGGNQAISVTETHARHILLKTSVVMNDAQARTKL 306

Query: 306 KKLRSNAI 313
           + +     
Sbjct: 307 EDVARQIK 314



 Score = 84.0 bits (205), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 32/273 (11%), Positives = 76/273 (27%), Gaps = 17/273 (6%)

Query: 58  KRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSA 117
           + +  L  Q  +   +K     L    L   E         + ++    V+ AR      
Sbjct: 155 QEVDALAQQIASQGSDKEV--NLSQILLPLPENPSQEQVDKAESLANRLVKDARQGADFG 212

Query: 118 EDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND-----------FMLKYGNLEMEIPAN 166
           +   ++             +   Q +     +                  G   + +   
Sbjct: 213 KLAITYSADPQALKGGQMGWGRPQELPSLFAERLANPEKGQVIGPIRSGVGFHILRVNDT 272

Query: 167 KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI 226
           +   + I+V E   R +L          Q    K    A + +        + +  +   
Sbjct: 273 RGGNQAISVTETHARHILLKTSVVMNDAQART-KLEDVARQIKSGSTSFAAQAKLLSQDP 331

Query: 227 -HDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKRDL-GGEIA 283
                 G   +       P F++  ++  +   + P  +  G   I + D R +   + A
Sbjct: 332 GSANQGGDLGWASPDMYDPAFRDALMQLKKGEISAPVRSSFGWHLIQLLDTRQVDKTDAA 391

Query: 284 LKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            K          K  +    ++++ R++A +  
Sbjct: 392 QKERAYRMLFNRKFAEEAQTWMQEKRASAYVKI 424


>gi|209964864|ref|YP_002297779.1| peptidyl-prolyl cis-trans isomerase family protein, putative
           [Rhodospirillum centenum SW]
 gi|209958330|gb|ACI98966.1| peptidyl-prolyl cis-trans isomerase family protein, putative
           [Rhodospirillum centenum SW]
          Length = 433

 Score =  122 bits (304), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 45/300 (15%), Positives = 97/300 (32%), Gaps = 13/300 (4%)

Query: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSS----RIRTTINGEVITDGDI 56
           M   +  SL   +        +++   V +    + A       R    +N EVI+  D+
Sbjct: 1   MIRTLRQSLVRHLPTAAALCGVLLCAGVLLAGRPAAAQGQGPVERAAALVNEEVISMSDL 60

Query: 57  SKRIALLKLQKINGELEK-------IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQH 109
             R+ +        +  +         ++ LI E L+ QE  +  I      ++      
Sbjct: 61  MNRLQMALSSSGLPDTPETRQRLLPQVLRLLIDEVLQIQEARRLEIRVTEQDIDRALENL 120

Query: 110 ARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQK 169
           A+   LS  +F   LD  G+     +Q L     W  +V+          + E+ A  ++
Sbjct: 121 AQQNRLSLGEFQRLLDASGVPVASLRQQLLASVAWSRLVQRRIRPTVSVSDDEVQAQLER 180

Query: 170 MKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV 229
           +K    +   + + +F    +   N+  V +      E             +F+      
Sbjct: 181 IKANAGKPEYLVSEIFL-AVDDDANEAEVSRLADRLVEQIAGGANFGAVARQFSQSAGAF 239

Query: 230 SIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
           + G   +L +  L       +++      + P     G   + + D+R +         +
Sbjct: 240 TGGDLGWLQQGQLEQALDTAVQQLQPGQFSRPIRGVNGYHILWLRDQRAVAAGNPADIQV 299



 Score = 53.1 bits (125), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 37/272 (13%), Positives = 85/272 (31%), Gaps = 15/272 (5%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDS--NTVNYFFVQ 108
           ++D ++  ++  +K             + L+ E     + + +        + +      
Sbjct: 169 VSDDEVQAQLERIKANAGKP-------EYLVSEIFLAVDDDANEAEVSRLADRLVEQIAG 221

Query: 109 HARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIW---PDVVKNDFMLKYGNLEMEIPA 165
            A    ++ +   S     G      +Q    Q++      +    F      +      
Sbjct: 222 GANFGAVARQFSQSAGAFTGGDLGWLQQGQLEQALDTAVQQLQPGQFSRPIRGVNG--YH 279

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK 225
                    V       +  ++    L       +   +A     +    C+ L   A +
Sbjct: 280 ILWLRDQRAVAAGNPADIQVAVGQLVLPADPANPEAGLEAARQIAQEAASCDALSAAAQR 339

Query: 226 IHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIAL 284
           I     G+A      DL  +  +++        T P++T +G+  + +CD+    G I  
Sbjct: 340 IPGAQQGQAPLTRLGDLPAEISSIVGALGVGTPTQPFLTDRGIMILMVCDRMVPEGSIPP 399

Query: 285 KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
              +       +IE  +  Y++ LR +A I Y
Sbjct: 400 ADQVRDAIAGERIEMLQRRYLRDLRRDATIEY 431


>gi|161830191|ref|YP_001595995.1| putative peptidyl-prolyl cis-trans isomerase surA [Coxiella
           burnetii RSA 331]
 gi|161762058|gb|ABX77700.1| putative peptidyl-prolyl cis-trans isomerase surA [Coxiella
           burnetii RSA 331]
          Length = 321

 Score =  122 bits (304), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 62/327 (18%), Positives = 113/327 (34%), Gaps = 19/327 (5%)

Query: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDI---- 56
           M  K+ TS+   +    T         +P  +        +I   +N E+IT  ++    
Sbjct: 1   MWKKILTSMVIILS--VTSISAFAQSTLPAPNATHEQSLDQIVAVVNDEIITQSELNHAL 58

Query: 57  ----SKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
                + +            +K  + +LI + L+ Q  + + I   +N +N    + ++ 
Sbjct: 59  TAAKQQFMQRQISLPDQKTFKKQVLDQLIYQKLQLQVAKHNQIKVTNNEINAAVARISQA 118

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN 172
             LS       L ++GI    F+  L  Q I   +            + +I A +++   
Sbjct: 119 NHLSQTALKQKLTQEGISYKEFRSQLQKQLIISKLQHQALQDTISINKSDIAAFQKQHAG 178

Query: 173 IT-VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI 231
               +EY I T+L  +P +  Q Q    K        +L+         K          
Sbjct: 179 QIASKEYHIATILIPLPASATQAQINHAKGKAALILKQLQKGSSFETAMK-----MHPGS 233

Query: 232 GKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSA 290
               +    +L   F + +LK   N  T P     G   I + DK            +  
Sbjct: 234 ADLGWRSAKELPQVFVKTVLKMKPNEVTGPIQAPNGFHIIKLLDKE--AKNTVSDQQIQR 291

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIHYY 317
                K+EK   +++ +LRS+A IH Y
Sbjct: 292 IVYQQKVEKALQKWLTQLRSSAYIHIY 318


>gi|238764654|ref|ZP_04625599.1| Chaperone surA [Yersinia kristensenii ATCC 33638]
 gi|238697146|gb|EEP89918.1| Chaperone surA [Yersinia kristensenii ATCC 33638]
          Length = 424

 Score =  122 bits (304), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 37/292 (12%), Positives = 103/292 (35%), Gaps = 16/292 (5%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--------ELEKIA 76
             +    ++ +     ++   ++  V+   D+   +  +KL              L    
Sbjct: 1   MVVCANTAFAAPQEVDKVAAVVDNGVVLQSDVDGLLQSVKLNAQQAGQEVPDDATLRHQI 60

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           ++ LI++ ++ Q  +K GIT     ++      A    ++ +   S L   G+  + +++
Sbjct: 61  LERLIMDNIQLQMAKKMGITISDEALDKAIADIAAQNRMTPDQMRSRLAADGLNYDTYRE 120

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQG 196
            +  + +  +V  N+   +   L  E+ A  +++ N T  +  +      IP  +  +Q 
Sbjct: 121 QIRKEMLTSEVRNNEVRRRITILPQEVEALAKQVGNQTSGDTELNLSHILIPLPENPSQQ 180

Query: 197 FVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKK 252
            V +    A +    +    +        ++    +  G+  +    +L   F + L   
Sbjct: 181 QVDQAEDVANKLVSDIKGGADFGKLAIANSADSQALKGGQMGWGKLQELPSLFAERLQSA 240

Query: 253 SQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKH 300
           ++ +   P  +  G   + + D R     +        ++  + +P   +  
Sbjct: 241 NKGDVVGPIRSGVGFHILKVNDIRGGDNTVSVTEVHARHILLKPSPVMTDDQ 292



 Score = 83.6 bits (204), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 21/168 (12%), Positives = 53/168 (31%), Gaps = 4/168 (2%)

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
                G   +++   +     ++V E   R +L         +Q   +     A+    +
Sbjct: 249 IRSGVGFHILKVNDIRGGDNTVSVTEVHARHILLKPSPVMTDDQARAKLAAAAADIKSGK 308

Query: 212 LPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEY 269
                   ++ +      +  G   +       P F++  +K  +   + P  +  G   
Sbjct: 309 -TDFATIAKEISQDPGSAMQGGDLGWASPDIYDPAFRDALMKLKKGEISTPVHSSFGWHL 367

Query: 270 IAICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           I + D R +   + A K          K  +    ++++ R+ A +  
Sbjct: 368 IQVVDTRQVDKTDAAQKDRAYRMLFSRKFAEEAQTWMQEQRAAAYVKI 415


>gi|332703852|ref|ZP_08423940.1| SurA domain protein [Desulfovibrio africanus str. Walvis Bay]
 gi|332554001|gb|EGJ51045.1| SurA domain protein [Desulfovibrio africanus str. Walvis Bay]
          Length = 334

 Score =  122 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 44/312 (14%), Positives = 106/312 (33%), Gaps = 22/312 (7%)

Query: 19  YFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL------ 72
             ++    ++  +  ++  +  RI   +NG+VIT  D+ + +A   +Q    +L      
Sbjct: 29  VLLVTCALMLACLPARATEIVDRIVAVVNGQVITSYDLDRELAPYLMQLSGRKLNAQDEQ 88

Query: 73  -----EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
                 K  +  L+ + L   E ++  +  +   V     Q  ++  ++ ED    L ++
Sbjct: 89  QLTVVRKKLLDRLVDDILLLMEAKRLNLEVNDTEVENHIRQFRQSNSMTEEDLGRQLQRE 148

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI 187
            +    +K+ +    +   V+      K    + EI     + K+   +   +   L  +
Sbjct: 149 NMTREEYKRNIRESMLRHRVLSFMVRRKVLVTDEEILRYYDEHKSDYTQAKEVELGLILL 208

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
           P N+  +           +              K++      S G    L  S+L  Q++
Sbjct: 209 PPNEDSD--------GLVQRLGKAEISFEEAARKYSKGPGAQSGGSIGRLKWSELASQWR 260

Query: 248 NL-LKKSQNNTTNPYVTQKGVEYIAICDKRDLG--GEIALKAYLSAQNTPTKIEKHEAEY 304
               +      + P+        + +             ++  +  +    K     AEY
Sbjct: 261 EALAQIHPGEISEPFSIDGNKAILKLKAIIPGKERSLDEVREEIRQKLYDPKYAVQYAEY 320

Query: 305 VKKLRSNAIIHY 316
           ++ L++ AI+  
Sbjct: 321 MQDLKTKAIVDI 332


>gi|53718302|ref|YP_107288.1| putative peptidyl-prolyl cis-trans isomerase [Burkholderia
           pseudomallei K96243]
 gi|52208716|emb|CAH34652.1| putative peptidyl-prolyl cis-trans isomerase [Burkholderia
           pseudomallei K96243]
          Length = 450

 Score =  122 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 38/336 (11%), Positives = 112/336 (33%), Gaps = 35/336 (10%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMS-----------SRIRTTINGEVITDGDISKRIA 61
           +K +  +  +    +  +++    A +             +   +N +VIT  ++ +R+ 
Sbjct: 3   MKKILRFAAVASGLVASLITVAPSASAQALRAQGASLADEVVAVVNNDVITGRELDQRVG 62

Query: 62  LLKLQKING--------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNT 113
           L+  +            +L    + ++++E ++ Q  +  GI  D+ TV     + A+  
Sbjct: 63  LIARRLQQQKAPVPPTDQLRAQVLNQMVLERIQVQRAKDDGIVVDNATVQATLGRLAQAN 122

Query: 114 GLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMK-N 172
           G+  + + + ++ QG+  + F +    + +   + + +   K    + E+ +     +  
Sbjct: 123 GMQLDQYKARIEAQGVPWDLFVRDARTELMLSKLREKEVDSKITVSDAEVASYIASQRGP 182

Query: 173 ITVREYLIRTVLFSIPDNKLQNQGFV----QKRIKDAEESRLRLPKDCNKLEKFASKIHD 228
               +  +R     +       Q  +    +K     +++           +  +     
Sbjct: 183 NAGSQQDLRLEHIFVKAPANAPQADIDVAQKKAEGLLQQALASGANFERLAKNQSEADDA 242

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQNNTTNP--YVTQKGVEYIAICDKR----DLGGEI 282
              G   +   + L     + + K +    NP       G E + + ++R          
Sbjct: 243 KKGGDLGFKSPASLPSDVVDAVSKLRPGEVNPTLIRVPDGFEIVRLVERRASQNPAASPK 302

Query: 283 ALKAYLSAQNT---PTKIEKHEAEYVKKLRSNAIIH 315
            ++ ++          K E    + +  +R    I 
Sbjct: 303 IVQTHVRHILLRVGEGKSESQARQQLIDIRRQ--IE 336



 Score =  102 bits (254), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 16/156 (10%), Positives = 54/156 (34%), Gaps = 2/156 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +     +    + +          +   + +++   ++++ D                 +
Sbjct: 289 VERRASQNPAASPKIVQTHVRHILLRVGEGKSESQARQQLIDIRRQIESGGDFEKFARTY 348

Query: 223 ASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
           +        G   ++   +  P+F+  +        +NP  T+ G   I +  +RD  G 
Sbjct: 349 SQDGSASQGGDLGWISPGETVPEFERAMNTLQDGQVSNPVRTEYGYHLIQVLGRRDAEGS 408

Query: 282 IALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           +  +  +        K E+  ++++++LR ++ +  
Sbjct: 409 VQQQMDIARQAIGQRKAEQAYSDWLRELRDSSYVQI 444


>gi|15964904|ref|NP_385257.1| hypothetical protein SMc00581 [Sinorhizobium meliloti 1021]
 gi|15074083|emb|CAC45730.1| Hypothetical protein SMc00581 [Sinorhizobium meliloti 1021]
          Length = 316

 Score =  122 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 88/307 (28%), Positives = 144/307 (46%), Gaps = 7/307 (2%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           I  L +   L     V   +  +   +S +   +N  VIT GD++KR+A LKLQ+ +G  
Sbjct: 9   IVRLLSAVALAGALSVAAGTVTTAMAASTVEVVVNSTVITSGDVAKRVAFLKLQRQSGGA 68

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            + A Q+L+ E LK+ EI +   +  ++ V+  F + A    LS E     LD+ G+G +
Sbjct: 69  AE-AKQQLVDEVLKRAEIARVQQSVSTDEVDAAFARFAAGNKLSPEQLGKILDQAGVGVD 127

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
           HFKQY+A+Q  WP VV   +         ++     +                     + 
Sbjct: 128 HFKQYIAVQMSWPRVVNFRYGSASRLSGGDLVKRMMQGGGNKPVTTEYFLQQVIFVIPES 187

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK 252
           +      KR  +A  SR + P   +  + FA+   DVSI     +L   L   ++ L++K
Sbjct: 188 KRGAITAKRQAEANASRSQFPGC-DTSKAFAANYRDVSIRSLGRILAQQLPEDWKPLVEK 246

Query: 253 S-QNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEK----HEAEYVKK 307
           +    TT   VT+KGVEY+AIC KR +  + A +    A++   K  +    + A+Y+++
Sbjct: 247 AGDGMTTGTRVTEKGVEYLAICKKRQVNDDAAAEIVFRAEDLGKKKSEGEDPNSAKYLEE 306

Query: 308 LRSNAII 314
           LRS A I
Sbjct: 307 LRSKAQI 313


>gi|312883922|ref|ZP_07743639.1| survival protein SurA [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309368380|gb|EFP95915.1| survival protein SurA [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 428

 Score =  122 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 34/313 (10%), Positives = 108/313 (34%), Gaps = 12/313 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +KL     +  +   +     +      ++   +N  VI   DI   +  LK+       
Sbjct: 1   MKLWNYIILAFLSLNINHAVAQQEVALDQVAVIVNDGVILQSDIKTAMKTLKINAKKEGQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  LE+   ++LI++T+++Q+ ++ G+  D   +N    + A+N   +  +    L
Sbjct: 61  TLPSNSVLEEQVTEKLILDTIQQQQADRIGVKVDDGRLNEAIEEIAKNNQQTIAELKEEL 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            K+G+    F+  +  +    +        +   L  E+      +   +      +   
Sbjct: 121 QKEGLNYALFRDQVRKEISVSEARNAIVRRRINILPSEVDHLASLLSQESSATVQYKIGH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +      ++  ++++  D      +          F+     +  G   ++ + ++  
Sbjct: 181 IQLRVEDGDDKAQIKQQAMDIVSELEKGADFKTMAYTFSKGPKALKGGDWGWMRKEEMPT 240

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F +    +++ +   P+++  G   + I D +    +        ++  + +    ++ 
Sbjct: 241 IFADEIKMQNKGSIIGPFMSGSGFHILKIEDVKGLQTVAVTEVNARHILIKPSIILSDEG 300

Query: 301 EAEYVKKLRSNAI 313
             + + ++     
Sbjct: 301 VKKELIEITKRIK 313



 Score = 75.9 bits (184), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 30/269 (11%), Positives = 78/269 (28%), Gaps = 4/269 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++    +LL  +       KI   +L VE    +   K       + +        
Sbjct: 154 ILPSEVDHLASLLSQESSATVQYKIGHIQLRVEDGDDKAQIKQQAMDIVSELEKGADFKT 213

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
                S    +      G         +    I      +            I   +   
Sbjct: 214 MAYTFSKGPKALKGGDWGWMRKEEMPTIFADEIKMQNKGSIIGPFMSGSGFHILKIEDVK 273

Query: 171 KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK-LEKFASKI-HD 228
              TV    +      I  + + +   V+K + +  +         ++  ++++      
Sbjct: 274 GLQTVAVTEVNARHILIKPSIILSDEGVKKELIEITKRIKSGEVTFSQMAKQYSQDTGSG 333

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKA 286
              G+  +       P+F++ L        + P+ T  G   + +  ++ +   + +LK 
Sbjct: 334 TQGGELGFHTSDIYVPEFKHQLDTLPIGQISAPFKTVHGWHIVEVTGRKQVDRTDASLKN 393

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
                    K  +    +++++R+ A + 
Sbjct: 394 KAYRIIFNRKFNEEAGAWLQEIRAGAFVE 422


>gi|152995084|ref|YP_001339919.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Marinomonas sp.
           MWYL1]
 gi|150836008|gb|ABR69984.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Marinomonas sp.
           MWYL1]
          Length = 416

 Score =  122 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 44/305 (14%), Positives = 104/305 (34%), Gaps = 11/305 (3%)

Query: 15  LLTTYFVLIIFCIVPIVSY-KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI----N 69
            L ++F LIIF +  + +   +      I   ++ + I + DI  R  ++K +       
Sbjct: 2   KLFSFFSLIIFALASVQTLHAAPTKIDGISAIVDSKPILESDIMSRFQIVKDRVPGGVMT 61

Query: 70  GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
             + +    ++I E L+     K G+   S+ V+   +  A+N  L  +   + L  +GI
Sbjct: 62  DNIHRQIQNQMIDEALQVNYARKVGMRASSSEVDNAILGVAKNMNLDLQGLKNVLADKGI 121

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPD 189
               +++ +  + +  ++ +     +    E EI        +IT  +  +      I  
Sbjct: 122 NYERYREQIEQEILINNIKREIVKKRIAISEQEIDDYLSSDTSITKEKDQVHLRHIII-- 179

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
            +  N      +IK              +  + +     +  G   +   + L P F   
Sbjct: 180 -RASNPEEAAAKIKTIAGKIHSENDFVQQAIENSDGQFAIEGGDLGWRPLNQLPPLFVRA 238

Query: 250 LKKSQNNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEYVK 306
           L+  +     P  +  G   + + +KR       +     ++  +    +  +       
Sbjct: 239 LESEKGPLIGPLQSNAGFHLLWVIEKRSPDVTLQQQTKTRHILVRANEIRNMEQTKVLAD 298

Query: 307 KLRSN 311
           +L   
Sbjct: 299 ELYKK 303



 Score = 86.7 bits (212), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 18/141 (12%), Positives = 54/141 (38%), Gaps = 3/141 (2%)

Query: 179 LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYL 237
             +T    +  N+++N    +    +  +            ++++      +  G   ++
Sbjct: 274 QTKTRHILVRANEIRNMEQTKVLADELYKKLENGADFAQLAKEYSEDQGSTLQGGDLGWV 333

Query: 238 LESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPT 295
               + P+F+  + K +  + + P+ TQ G   + +  +R+    +   ++      T  
Sbjct: 334 TLGAMVPEFEEVMKKTNIGDISKPFRTQFGWHILQVEGRREADISDKVKRSNAERALTAQ 393

Query: 296 KIEKHEAEYVKKLRSNAIIHY 316
           K +     ++ +LR++A I  
Sbjct: 394 KQDIVLGNWLDELRADAFIDI 414


>gi|207742369|ref|YP_002258761.1| peptidyl-prolyl cis-trans isomerase (rotamase c) protein [Ralstonia
           solanacearum IPO1609]
 gi|206593759|emb|CAQ60686.1| peptidyl-prolyl cis-trans isomerase (rotamase c) protein [Ralstonia
           solanacearum IPO1609]
          Length = 473

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 44/303 (14%), Positives = 95/303 (31%), Gaps = 20/303 (6%)

Query: 29  PIVSYKSWAMSSRIRTTINGEVITDGDISKRI----ALLKLQKINGELEK----IAVQEL 80
                    +   +   +N ++IT  ++  R       L+ Q              +++L
Sbjct: 55  TASGAARSQLVDEVVAVVNTDIITRRELLDRADLVERTLQAQNRPMPARADLLGEVLEQL 114

Query: 81  IVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAI 140
           I+E ++ Q  ++SGI      V+      A+   LS     S L + G+  + +++ L  
Sbjct: 115 ILERVQAQTAKESGIRVSDADVDRAVESVAQRNNLSVPQLKSKLAQSGLAYDKYREDLRQ 174

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKM---KNITVREYLIRTVLFSIPDNKLQNQGF 197
           + +   +   +   K    + EI     +         +EY +  +L  + ++    Q  
Sbjct: 175 EILLARLRDREVDSKVQVFDGEIDNFLAQQGGGATGEAQEYNVAQILVPVAEDASAEQKA 234

Query: 198 VQKRIKDA-EESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQN 255
             +   ++  +               +S       G+        L  QF N +      
Sbjct: 235 AARGKAESLLKQAQGGADFAKLARDSSSGPEAAQGGELGLRSIGRLPTQFANAVVDLKPG 294

Query: 256 NTTN-PYVTQKGVEYIAICDKRDLGGEIALK------AYLSAQNTPTKIEKHEAEYVKKL 308
                   +  G   + + DKR  G   + K       ++  +  PT         +  L
Sbjct: 295 QLAGQVIESPAGFHVLKLVDKRAPGTAASAKVAQTQVRHILIKTGPTMSADDARRQLAGL 354

Query: 309 RSN 311
           R  
Sbjct: 355 RDR 357



 Score =  112 bits (279), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 19/178 (10%), Positives = 61/178 (34%), Gaps = 2/178 (1%)

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQK 200
                 +         G   +++   +      + +    +     I      +    ++
Sbjct: 290 DLKPGQLAGQVIESPAGFHVLKLVDKRAPGTAASAKVAQTQVRHILIKTGPTMSADDARR 349

Query: 201 RIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTN 259
           ++    +  +      +   +++      + G+  ++    L P+F+  +        + 
Sbjct: 350 QLAGLRDRIVHGYDFSDAARRYSQDTSASAGGELGWVSPGQLVPEFEQAMNLLKPGEVSQ 409

Query: 260 PYVTQKGVEYIAICDKRDLGGEIAL-KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           P  +Q GV  I +  +RD    +   + Y  +     K++    +++++LR +A + Y
Sbjct: 410 PVQSQFGVHLIQVEGRRDAEVPVDRQRDYARSVIREQKVQAAYEDWLRQLRDSAHVEY 467


>gi|83749338|ref|ZP_00946335.1| Peptidyl-prolyl cis-trans isomerase [Ralstonia solanacearum UW551]
 gi|83724016|gb|EAP71197.1| Peptidyl-prolyl cis-trans isomerase [Ralstonia solanacearum UW551]
          Length = 495

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 44/303 (14%), Positives = 95/303 (31%), Gaps = 20/303 (6%)

Query: 29  PIVSYKSWAMSSRIRTTINGEVITDGDISKRI----ALLKLQKINGELEK----IAVQEL 80
                    +   +   +N ++IT  ++  R       L+ Q              +++L
Sbjct: 77  TASGAARSQLVDEVVAVVNTDIITRRELLDRADLVERTLQAQNRPMPARADLLGEVLEQL 136

Query: 81  IVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAI 140
           I+E ++ Q  ++SGI      V+      A+   LS     S L + G+  + +++ L  
Sbjct: 137 ILERVQAQTAKESGIRVSDADVDRAVESVAQRNNLSVPQLKSKLAQSGLAYDKYREDLRQ 196

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKM---KNITVREYLIRTVLFSIPDNKLQNQGF 197
           + +   +   +   K    + EI     +         +EY +  +L  + ++    Q  
Sbjct: 197 EILLARLRDREVDSKVQVFDGEIDNFLAQQGGGATGEAQEYNVAQILVPVAEDASAEQKA 256

Query: 198 VQKRIKDA-EESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQN 255
             +   ++  +               +S       G+        L  QF N +      
Sbjct: 257 AARGKAESLLKQAQGGADFAKLARDSSSGPEAAQGGELGLRSIGRLPTQFANAVVDLKPG 316

Query: 256 NTTN-PYVTQKGVEYIAICDKRDLGGEIALK------AYLSAQNTPTKIEKHEAEYVKKL 308
                   +  G   + + DKR  G   + K       ++  +  PT         +  L
Sbjct: 317 QLAGQVIESPAGFHVLKLVDKRAPGTAASAKVAQTQVRHILIKTGPTMSADDARRQLAGL 376

Query: 309 RSN 311
           R  
Sbjct: 377 RDR 379



 Score =  112 bits (279), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 19/178 (10%), Positives = 61/178 (34%), Gaps = 2/178 (1%)

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQK 200
                 +         G   +++   +      + +    +     I      +    ++
Sbjct: 312 DLKPGQLAGQVIESPAGFHVLKLVDKRAPGTAASAKVAQTQVRHILIKTGPTMSADDARR 371

Query: 201 RIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTN 259
           ++    +  +      +   +++      + G+  ++    L P+F+  +        + 
Sbjct: 372 QLAGLRDRIVHGYDFSDAARRYSQDTSASAGGELGWVSPGQLVPEFEQAMNLLKPGEVSQ 431

Query: 260 PYVTQKGVEYIAICDKRDLGGEIAL-KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           P  +Q GV  I +  +RD    +   + Y  +     K++    +++++LR +A + Y
Sbjct: 432 PVQSQFGVHLIQVEGRRDAEVPVDRQRDYARSVIREQKVQAAYEDWLRQLRDSAHVEY 489


>gi|207727966|ref|YP_002256360.1| peptidyl-prolyl cis-trans isomerase (rotamase c) protein [Ralstonia
           solanacearum MolK2]
 gi|206591209|emb|CAQ56821.1| peptidyl-prolyl cis-trans isomerase (rotamase c) protein [Ralstonia
           solanacearum MolK2]
          Length = 473

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 44/303 (14%), Positives = 96/303 (31%), Gaps = 20/303 (6%)

Query: 29  PIVSYKSWAMSSRIRTTINGEVITDGDISKRI----ALLKLQKINGELEK----IAVQEL 80
                    +   +   +N ++IT  ++  R       L+ Q              +++L
Sbjct: 55  TASGAARSQLVDEVVAVVNTDIITRRELLDRADLVERTLQAQNRPMPARADLLGEVLEQL 114

Query: 81  IVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAI 140
           I+E ++ Q  ++SGI      V+      A+   LS     S L + G+  + +++ L  
Sbjct: 115 ILERVQAQTAKESGIRVSDADVDRAVESVAQRNNLSVPQLKSKLAQSGLAYDKYREDLRQ 174

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKM---KNITVREYLIRTVLFSIPDNKLQNQGF 197
           + +   +   +   K    + EI     +         +EY +  +L  + ++    Q  
Sbjct: 175 EILLARLRDREVDSKVQVFDGEIDNFLAQQGGGATGEAQEYNVAQILVPVAEDASAEQKA 234

Query: 198 VQK-RIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQN 255
             + + ++  +               +S       G+        L  QF N +      
Sbjct: 235 AARGKAENLLKQAQGGADFAKLARDNSSGPEAAQGGELGLRSIGRLPTQFANAVVDLKPG 294

Query: 256 NTTN-PYVTQKGVEYIAICDKRDLGGEIALK------AYLSAQNTPTKIEKHEAEYVKKL 308
                   +  G   + + DKR  G   + K       ++  +  PT         +  L
Sbjct: 295 QLAGQVIESPAGFHVLKLVDKRAPGTAASAKVAQTQVRHILIKTGPTMSADDARRQLAGL 354

Query: 309 RSN 311
           R  
Sbjct: 355 RDR 357



 Score =  112 bits (280), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 30/272 (11%), Positives = 80/272 (29%), Gaps = 10/272 (3%)

Query: 55  DISKRIALLKLQKINGELEKIAVQELI------VETLKKQEIEKSGITFDSNTVNYFFVQ 108
           +I   +A           E    Q L+          K     K+            F +
Sbjct: 196 EIDNFLAQQGGGATGEAQEYNVAQILVPVAEDASAEQKAAARGKAENLLKQAQGGADFAK 255

Query: 109 HARNTGLSAEDFS--SFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN 166
            AR+     E         +             +      +         G   +++   
Sbjct: 256 LARDNSSGPEAAQGGELGLRSIGRLPTQFANAVVDLKPGQLAGQVIESPAGFHVLKLVDK 315

Query: 167 KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI 226
           +      + +    +     I      +    ++++    +  +      +   +++   
Sbjct: 316 RAPGTAASAKVAQTQVRHILIKTGPTMSADDARRQLAGLRDRIVHGYDFSDAARRYSQDT 375

Query: 227 HDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIAL- 284
              + G+  ++    L P+F+  +        + P  +Q GV  I +  +RD    +   
Sbjct: 376 SASAGGELGWVSPGQLVPEFEQAMNLLKPGEVSQPVQSQFGVHLIQVEGRRDAEVPVDRQ 435

Query: 285 KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           + Y  +     K++    +++++LR +A + Y
Sbjct: 436 RDYARSVIREQKVQAAYEDWLRQLRDSAHVEY 467


>gi|327188010|gb|EGE55240.1| putative peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           etli CNPAF512]
          Length = 314

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 76/287 (26%), Positives = 138/287 (48%), Gaps = 10/287 (3%)

Query: 38  MSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITF 97
            +S ++  +NG  IT GD++KR A L+LQ    +  K A ++LI ETLK+QE+ +  ++ 
Sbjct: 29  AASEVQAVVNGTAITSGDVAKRQAFLRLQHTAADA-KTAKEQLIDETLKRQEVARVHMSV 87

Query: 98  DSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYG 157
               V+  F + +    LS    S  LD+ G+G +HFK ++A+Q  WP VV   +     
Sbjct: 88  SQQDVDASFARFSAGNKLSVAQMSQILDRAGVGVDHFKGFIAVQMSWPRVVNARYGSTTR 147

Query: 158 NLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCN 217
               ++ +   +                     + +      KR  +AE SR + P   +
Sbjct: 148 LSNYDLVSRMMQNNKQKPVTTEYMLQQIIFVIPEAKRGAITGKRKGEAEASRSKFPGC-D 206

Query: 218 KLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRD 277
           + + FA+ + DV++     +L  ++ P ++ L+++++ NTT   VT KGVEY+AIC +R 
Sbjct: 207 QAKVFAATMRDVAVRDLGRMLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEYLAICSQRQ 266

Query: 278 LGGEIALKAYLSAQNTPTKI--------EKHEAEYVKKLRSNAIIHY 316
           +  + A +     ++              ++  +Y+ +LR  A I Y
Sbjct: 267 VSDDQAAEMVFRQEDLDKSKAGKNGPPENENSKKYLDELRKKAQIAY 313


>gi|221200089|ref|ZP_03573132.1| chaperone SurA (Peptidyl-prolyl cis-trans isomerase surA) (PPIase
           surA) (Rotamase surA) [Burkholderia multivorans CGD2M]
 gi|221206758|ref|ZP_03579770.1| chaperone SurA (Peptidyl-prolyl cis-trans isomerase surA) (PPIase
           surA) (Rotamase surA) [Burkholderia multivorans CGD2]
 gi|221173413|gb|EEE05848.1| chaperone SurA (Peptidyl-prolyl cis-trans isomerase surA) (PPIase
           surA) (Rotamase surA) [Burkholderia multivorans CGD2]
 gi|221180328|gb|EEE12732.1| chaperone SurA (Peptidyl-prolyl cis-trans isomerase surA) (PPIase
           surA) (Rotamase surA) [Burkholderia multivorans CGD2M]
          Length = 453

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 42/306 (13%), Positives = 101/306 (33%), Gaps = 24/306 (7%)

Query: 32  SYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVE 83
             +   ++  +   +N +VIT  ++ +R+ L+  +             L    + ++++E
Sbjct: 34  GSQGAQLADEVVAVVNNDVITGRELDQRVGLISRRLQQQNAPVPPIDQLRAQVLNQMVLE 93

Query: 84  TLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSI 143
            ++ Q+ +  GI  D  TV     + A+  G++ + + S L+ QG+  + F      + +
Sbjct: 94  RIQVQKAKDDGIRVDDATVQATLQRLAQANGMTLDQYRSRLEAQGVPWSIFTADARTELM 153

Query: 144 WPDVVKNDFMLKYGNLEMEIPAN----KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQ 199
              + + +   K    + E+ +     +    +           + +  +         Q
Sbjct: 154 LSKLREREVDSKITVSDAEVASYIASQRGPNASQQQDLRFQHIFIKAPTNAPQTQIEAAQ 213

Query: 200 KRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTN 259
           K+ +   +            +  +        G   +   S L     +   K +    N
Sbjct: 214 KKAEALLQQATSGADFEKLAKNNSEADDAKKGGDLGFKSPSALPADVVDAAAKLRPGQVN 273

Query: 260 P--YVTQKGVEYIAICDKRDLGGEIALK--------AYLSAQNTPTKIEKHEAEYVKKLR 309
           P       G E I + D+R   G  A           ++  +    K E    + +  +R
Sbjct: 274 PTLIRVPDGFEIIRLVDRRQSQGATAAAPKIVQTHVRHILLRVGEGKSEGQARQQLIDIR 333

Query: 310 SNAIIH 315
               I 
Sbjct: 334 RQ--IE 337



 Score =  103 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/285 (10%), Positives = 86/285 (30%), Gaps = 18/285 (6%)

Query: 48  GEVITDGDISKRIALLKLQKINGELEKIAVQELIV--------ETLKKQEIEKSGITFDS 99
              IT  D      +   +  N   ++    + I         +T  +   +K+      
Sbjct: 163 DSKITVSDAEVASYIASQRGPNASQQQDLRFQHIFIKAPTNAPQTQIEAAQKKAEALLQQ 222

Query: 100 NTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD------NHFKQYLAIQSIWPDVVKNDFM 153
            T    F + A+N   + +                         L    + P +++    
Sbjct: 223 ATSGADFEKLAKNNSEADDAKKGGDLGFKSPSALPADVVDAAAKLRPGQVNPTLIR--VP 280

Query: 154 LKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP 213
             +  + +      Q       +          +   + +++G  ++++ D         
Sbjct: 281 DGFEIIRLVDRRQSQGATAAAPKIVQTHVRHILLRVGEGKSEGQARQQLIDIRRQIEAGG 340

Query: 214 KDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAI 272
                   ++        G   ++   +  P+F+  +        + P  T+ G   I +
Sbjct: 341 DFEKFARTYSQDGSASQGGDLGWISPGETVPEFERAMNALQDGQISQPVRTEYGYHLIQV 400

Query: 273 CDKRDLGGEIALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
             +R+  G +  +  +        K E+  A+++++LR ++ + Y
Sbjct: 401 VGRREAEGSVQQQMDIARQAIGQRKAEQAYADWLRELRDSSYVQY 445


>gi|261408078|ref|YP_003244319.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Paenibacillus sp.
           Y412MC10]
 gi|261284541|gb|ACX66512.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Paenibacillus sp.
           Y412MC10]
          Length = 390

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 42/303 (13%), Positives = 97/303 (32%), Gaps = 25/303 (8%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEK 74
           ++ +  +     +V IV   +    +     +N   IT  ++   +  +          K
Sbjct: 87  MIASLVLAAALIVVLIVPPFAKGSGNEAIAKVNDVNITKDNLYDELVSVGG--------K 138

Query: 75  IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF 134
             +  +I E L +QE++   IT     VN        +   S E F+  L + G+  ++ 
Sbjct: 139 QTLNSMITEELIQQELKNKSITVTDADVNKEVDALKASF-PSEEQFNMALQQNGMTLDNL 197

Query: 135 KQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQN 194
           K+    Q     ++      K    + E+     + K        +R     +   +   
Sbjct: 198 KEQTKTQVELKKLM----ADKIKVTDEEVKEVYDQNKESFATPEQVRASHILVETKEEAE 253

Query: 195 QGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-S 253
                       +            ++        + G   +    ++ P F+    K  
Sbjct: 254 AI---------VKQLKEGADFATIAKEKNQDATKDTGGDLNFFGRGEMDPAFEEAAFKLK 304

Query: 254 QNNTTNPYVTQKGVEYIAICDKRDLGGE--IALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
           ++  + P  +  G   I + D+++         K  + +Q    K+      Y+++L+  
Sbjct: 305 KDEISEPVKSSFGYHIIKVTDRKEATNPTLEDKKEEIRSQLENQKVYAESTAYIQELKDK 364

Query: 312 AII 314
           A I
Sbjct: 365 ATI 367


>gi|332305313|ref|YP_004433164.1| SurA domain protein [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172642|gb|AEE21896.1| SurA domain protein [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 431

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 38/312 (12%), Positives = 102/312 (32%), Gaps = 15/312 (4%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--- 71
           +  T     +   +   ++        +   ++  V+ +  I + ++ +K   I      
Sbjct: 1   MKLTVVTFALLAFISFSTFAKQTRLDNVAVIVDQGVVLESQIKELVSTVKRNAITNNQTL 60

Query: 72  -----LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDK 126
                L   A++ LIV++L+ Q  ++ GI      ++      AR  G + E     L  
Sbjct: 61  PSDRVLRTQAIERLIVDSLQSQMADRMGIQISDPQLDQTIDNIAREDGTTVEQLRQSLAS 120

Query: 127 QGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
           +G+    +++ +  + I  +V + +   +      EI    + +     ++         
Sbjct: 121 EGVSFEVYREQVRKELISGEVRRANVRRRIYITPQEISNLVKLIDEQGGQQAEYHLGHIL 180

Query: 187 IPDNKLQNQGFVQKRIK---DAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLH 243
           I          V K         E      +        +S    +  G   ++  + + 
Sbjct: 181 IGFPPEPTDADVSKAKDTAEKVLELLNNGSEFAKIATASSSGSKALEGGDLGWMNINSMP 240

Query: 244 PQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK---AYLSAQNTPTKIEK 299
             F + +   S+++   P  +  G   + I D R +      +    ++  + +    ++
Sbjct: 241 TLFAEAVQGTSKDDLIGPIRSGAGFHVLKIIDIRGIEKVEVAELKSRHILIKPSVILSDE 300

Query: 300 HEAEYVKKLRSN 311
              + + + R  
Sbjct: 301 KAEKMLIEFRKQ 312



 Score = 80.9 bits (197), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 16/138 (11%), Positives = 40/138 (28%), Gaps = 4/138 (2%)

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLE 239
           R +L          +          ++            ++ ++     +  G   +   
Sbjct: 287 RHILIKPSVILSDEKAEKMLIEF-RKQLLAGEADFAELAKEHSADPGSALRGGDLGWADP 345

Query: 240 SDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK-AYLSAQNTPTKI 297
           +   P F++   K      + P  +  G   + + DKR        K           K 
Sbjct: 346 NVYVPAFRDTLQKLEVGEISQPVRSTHGWHLMQLMDKRVQDATEKRKEDKAYQLLFQRKF 405

Query: 298 EKHEAEYVKKLRSNAIIH 315
            +    ++K++R +A + 
Sbjct: 406 AEETEAWLKEMRDSAYVE 423


>gi|161523769|ref|YP_001578781.1| SurA domain-containing protein [Burkholderia multivorans ATCC
           17616]
 gi|189351470|ref|YP_001947098.1| peptidyl-prolyl cis-trans isomerase [Burkholderia multivorans ATCC
           17616]
 gi|160341198|gb|ABX14284.1| SurA domain [Burkholderia multivorans ATCC 17616]
 gi|189335492|dbj|BAG44562.1| peptidyl-prolyl cis-trans isomerase [Burkholderia multivorans ATCC
           17616]
          Length = 451

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 42/306 (13%), Positives = 101/306 (33%), Gaps = 24/306 (7%)

Query: 32  SYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVE 83
             +   ++  +   +N +VIT  ++ +R+ L+  +             L    + ++++E
Sbjct: 32  GSQGAQLADEVVAVVNNDVITGRELDQRVGLISRRLQQQNAPVPPIDQLRAQVLNQMVLE 91

Query: 84  TLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSI 143
            ++ Q+ +  GI  D  TV     + A+  G++ + + S L+ QG+  + F      + +
Sbjct: 92  RIQVQKAKDDGIRVDDATVQATLQRLAQANGMTLDQYRSRLEAQGVPWSIFTADARTELM 151

Query: 144 WPDVVKNDFMLKYGNLEMEIPAN----KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQ 199
              + + +   K    + E+ +     +    +           + +  +         Q
Sbjct: 152 LSKLREREVDSKITVSDAEVASYIASQRGPNASQQQDLRFQHIFIKAPTNAPQTQIEAAQ 211

Query: 200 KRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTN 259
           K+ +   +            +  +        G   +   S L     +   K +    N
Sbjct: 212 KKAEALLQQATSGADFEKLAKNNSEADDAKKGGDLGFKSPSALPADVVDAAAKLRPGQVN 271

Query: 260 P--YVTQKGVEYIAICDKRDLGGEIALK--------AYLSAQNTPTKIEKHEAEYVKKLR 309
           P       G E I + D+R   G  A           ++  +    K E    + +  +R
Sbjct: 272 PTLIRVPDGFEIIRLVDRRQSQGATAAAPKIVQTHVRHILLRVGEGKSEGQARQQLIDIR 331

Query: 310 SNAIIH 315
               I 
Sbjct: 332 RQ--IE 335



 Score =  103 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/285 (10%), Positives = 86/285 (30%), Gaps = 18/285 (6%)

Query: 48  GEVITDGDISKRIALLKLQKINGELEKIAVQELIV--------ETLKKQEIEKSGITFDS 99
              IT  D      +   +  N   ++    + I         +T  +   +K+      
Sbjct: 161 DSKITVSDAEVASYIASQRGPNASQQQDLRFQHIFIKAPTNAPQTQIEAAQKKAEALLQQ 220

Query: 100 NTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD------NHFKQYLAIQSIWPDVVKNDFM 153
            T    F + A+N   + +                         L    + P +++    
Sbjct: 221 ATSGADFEKLAKNNSEADDAKKGGDLGFKSPSALPADVVDAAAKLRPGQVNPTLIR--VP 278

Query: 154 LKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP 213
             +  + +      Q       +          +   + +++G  ++++ D         
Sbjct: 279 DGFEIIRLVDRRQSQGATAAAPKIVQTHVRHILLRVGEGKSEGQARQQLIDIRRQIEAGG 338

Query: 214 KDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAI 272
                   ++        G   ++   +  P+F+  +        + P  T+ G   I +
Sbjct: 339 DFEKFARTYSQDGSASQGGDLGWISPGETVPEFERAMNALQDGQISQPIRTEYGYHLIQV 398

Query: 273 CDKRDLGGEIALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
             +R+  G +  +  +        K E+  A+++++LR ++ + Y
Sbjct: 399 VGRREAEGSVQQQMDIARQAIGQRKAEQAYADWLRELRDSSYVQY 443


>gi|212213438|ref|YP_002304374.1| peptidyl-prolyl cis-trans isomerase [Coxiella burnetii CbuG_Q212]
 gi|212011848|gb|ACJ19229.1| peptidyl-prolyl cis-trans isomerase [Coxiella burnetii CbuG_Q212]
          Length = 321

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 62/327 (18%), Positives = 112/327 (34%), Gaps = 19/327 (5%)

Query: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDI---- 56
           M  K+ TS+   +    T         +P  +        +I   +N E+IT  ++    
Sbjct: 1   MWKKILTSMVVILS--VTSISAFAQSTLPAPNATHEQSLDQIVAVVNDEIITQSELNHAL 58

Query: 57  ----SKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
                + +            +K  + +LI + L+ Q  + + I   +N +N    + ++ 
Sbjct: 59  TAAKQQFMQRQISLPDQKTFKKKVLDQLIYQKLQLQVAKHNQIKVTNNEINAAVARISQA 118

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN 172
             LS       L ++GI    F+  L  Q I   +            + +I A +++   
Sbjct: 119 NHLSQTALKQKLTQEGISYKEFRSQLQKQLIISKLQHQALQDTISINKSDIAAFQKQHAG 178

Query: 173 IT-VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI 231
                EY I T+L  +P +  Q Q    K        +L+         K          
Sbjct: 179 QIASTEYHIATILIPLPASATQAQINHAKGKAALVLKQLQKGSSFETAMK-----MHPGS 233

Query: 232 GKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSA 290
               +    +L   F + +LK   N  T P     G   I + DK            +  
Sbjct: 234 ADLGWRSAKELPQVFVKTVLKMKPNEVTGPIQAPNGFHIIKLLDKE--AKNTVSDQQIQR 291

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIHYY 317
                K+EK   +++ +LRS+A IH Y
Sbjct: 292 IVYQQKVEKALQKWLTQLRSSAYIHIY 318


>gi|121611714|ref|YP_999521.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Verminephrobacter
           eiseniae EF01-2]
 gi|121556354|gb|ABM60503.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Verminephrobacter
           eiseniae EF01-2]
          Length = 482

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 43/297 (14%), Positives = 92/297 (30%), Gaps = 19/297 (6%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVETL 85
            +   +  I   +N E +T+ ++  R+   + Q             L    ++ LI+E +
Sbjct: 69  SATGWADFIVAVVNSEPVTNNEVRSRLVRAEAQIARQGASMPSREWLAHEVLERLILERV 128

Query: 86  KKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWP 145
           + Q+  +SGI  D   +       AR  G++ E F + L++ GIG   F+  L  Q +  
Sbjct: 129 QLQQARESGIRVDDFALAQAEQGVARQNGMTLEQFYARLERDGIGKERFRAELRDQLLEQ 188

Query: 146 DVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI-----RTVLFSIPDNKLQNQGFVQK 200
            + + +   +    E +I            +   +       ++    D         + 
Sbjct: 189 RLREREVDARVQVSEQDIDQYLHAEPPAGAQAKPMEINLGHVLVLVPEDATPAQVAERRA 248

Query: 201 RIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQF-QNLLKKSQNNTT 258
           R + A E             +F+         G             F  +       +  
Sbjct: 249 RAQQAAERLRSGADFATVAREFSDAPEGQRAGGMLGLRPVDRYPELFVSSTRGLPVGSLV 308

Query: 259 NPYVTQKGVEYIAICDK----RDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
            P  +  G   + +  +    +      +   ++  +  P   E   AE +   R  
Sbjct: 309 GPVRSPAGFHLLKVEQRVIAGQPATVLQSHARHILLRTGPRMSETAAAERLADYRRR 365



 Score = 95.9 bits (236), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 16/140 (11%), Positives = 41/140 (29%), Gaps = 3/140 (2%)

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLL 238
               +      ++      ++                    + +         G   +  
Sbjct: 338 HARHILLRTGPRMSETAAAERLADYRRRVLAGQADFAALAREHSQDDGSAKKGGDLGWAN 397

Query: 239 ESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEI-ALKAYLSAQNTPTK 296
                P+F+  L+     + + P VT+ GV  I + ++R         +          K
Sbjct: 398 PGQYVPEFEQALQALQPGDISAPLVTRFGVHLIELLERRQASLTAREQRDMARQAVREKK 457

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
           +++    + + LR+ A + Y
Sbjct: 458 LDQAYISWTQDLRARAYVEY 477


>gi|299067923|emb|CBJ39137.1| peptidyl-prolyl cis-trans isomerase (PPIase), involved in
           maturation of outer membrane proteins [Ralstonia
           solanacearum CMR15]
          Length = 496

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 45/304 (14%), Positives = 96/304 (31%), Gaps = 21/304 (6%)

Query: 29  PIVSYKSWAMSSRIRTTINGEVITDGDISKRI----ALLKLQKIN----GELEKIAVQEL 80
              S     +   +   +N ++IT  ++  R       L+ Q        +L    +++L
Sbjct: 77  TASSAARSQLVDEVVAVVNTDIITRRELLDRADLVERTLQSQNRQIPARPDLLGEVLEQL 136

Query: 81  IVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAI 140
           I+E ++ Q  ++SGI      V+      A+   LS     S L + G+  + +++ L  
Sbjct: 137 ILERVQAQTAKESGIRVSDADVDRAVESVAQRNNLSVSQLKSKLAQSGLAYDKYREDLRQ 196

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVR----EYLIRTVLFSIPDNKLQNQG 196
           + +   +   +   K    + EI     +           EY +  +L  + ++    Q 
Sbjct: 197 EILLARLRDREVDSKVQVFDGEIDNFLAQQGGSAASGGALEYNVAQILVPVAEDASAEQK 256

Query: 197 FVQKRIKDA-EESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQ 254
              +   ++  +               +        G+        L  QF N +     
Sbjct: 257 AAARGKAESLLKQVQGGADFAKLARDSSGAPEAAQGGELGLRPIGRLPAQFANAVVDLKP 316

Query: 255 NNTT-NPYVTQKGVEYIAICDKRDLGGEIALK------AYLSAQNTPTKIEKHEAEYVKK 307
                    +  G   + + DKR  G  +  K       ++  +  PT         +  
Sbjct: 317 GQVVDQVIESPAGFHVLKLVDKRAQGTAVTAKVAQTQVRHILIKTGPTMSADDARRQLAG 376

Query: 308 LRSN 311
           LR  
Sbjct: 377 LRDR 380



 Score =  113 bits (281), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 20/178 (11%), Positives = 64/178 (35%), Gaps = 2/178 (1%)

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQK 200
                 VV        G   +++   + +   +T +    +     I      +    ++
Sbjct: 313 DLKPGQVVDQVIESPAGFHVLKLVDKRAQGTAVTAKVAQTQVRHILIKTGPTMSADDARR 372

Query: 201 RIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTN 259
           ++    +  +      +   +++      + G+  ++    L P+F+  +        + 
Sbjct: 373 QLAGLRDRIVHGYDFGDAARRYSQDNSASAGGELGWVSPGQLVPEFEQAMGLLKPGEVSQ 432

Query: 260 PYVTQKGVEYIAICDKRDLGGEIAL-KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           P  +Q G+  I +  +R+    +   + Y  +     K++    +++++LR +A + Y
Sbjct: 433 PVQSQFGLHLIQVEGRREAEVPVDRQRDYARSVIREQKVQAAYEDWLRQLRDSAHVEY 490


>gi|221211271|ref|ZP_03584250.1| chaperone SurA (Peptidyl-prolyl cis-trans isomerase surA) (PPIase
           surA) (Rotamase surA) [Burkholderia multivorans CGD1]
 gi|221168632|gb|EEE01100.1| chaperone SurA (Peptidyl-prolyl cis-trans isomerase surA) (PPIase
           surA) (Rotamase surA) [Burkholderia multivorans CGD1]
          Length = 453

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 42/306 (13%), Positives = 101/306 (33%), Gaps = 24/306 (7%)

Query: 32  SYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVE 83
             +   ++  +   +N +VIT  ++ +R+ L+  +             L    + ++++E
Sbjct: 34  GSQGAQLADEVVAVVNNDVITGRELDQRVGLISRRLQQQNAPVPPIDQLRAQVLNQMVLE 93

Query: 84  TLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSI 143
            ++ Q+ +  GI  D  TV     + A+  G++ + + S L+ QG+  + F      + +
Sbjct: 94  RIQVQKAKDDGIRVDDATVQATLQRLAQANGMTLDQYRSRLEAQGVPWSIFTADARTELM 153

Query: 144 WPDVVKNDFMLKYGNLEMEIPAN----KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQ 199
              + + +   K    + E+ +     +    +           + +  +         Q
Sbjct: 154 LSKLREREVDSKITVSDAEVASYIASQRGPNASQQQDLRFQHIFIKAPTNAPQTQIEAAQ 213

Query: 200 KRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTN 259
           K+ +   +            +  +        G   +   S L     +   K +    N
Sbjct: 214 KKAEALLQQATSGADFEKLAKNNSEADDAKKGGDLGFKSPSALPADVVDAAAKLRPGQVN 273

Query: 260 P--YVTQKGVEYIAICDKRDLGGEIALK--------AYLSAQNTPTKIEKHEAEYVKKLR 309
           P       G E I + D+R   G  A           ++  +    K E    + +  +R
Sbjct: 274 PTLIRVPDGFEIIRLVDRRQSQGATAAAPKIVQTHVRHILLRVGEGKSEGQARQQLIDIR 333

Query: 310 SNAIIH 315
               I 
Sbjct: 334 RQ--IE 337



 Score =  103 bits (255), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 31/285 (10%), Positives = 86/285 (30%), Gaps = 18/285 (6%)

Query: 48  GEVITDGDISKRIALLKLQKINGELEKIAVQELIV--------ETLKKQEIEKSGITFDS 99
              IT  D      +   +  N   ++    + I         +T  +   +K+      
Sbjct: 163 DSKITVSDAEVASYIASQRGPNASQQQDLRFQHIFIKAPTNAPQTQIEAAQKKAEALLQQ 222

Query: 100 NTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD------NHFKQYLAIQSIWPDVVKNDFM 153
            T    F + A+N   + +                         L    + P +++    
Sbjct: 223 ATSGADFEKLAKNNSEADDAKKGGDLGFKSPSALPADVVDAAAKLRPGQVNPTLIR--VP 280

Query: 154 LKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP 213
             +  + +      Q       +          +   + +++G  ++++ D         
Sbjct: 281 DGFEIIRLVDRRQSQGATAAAPKIVQTHVRHILLRVGEGKSEGQARQQLIDIRRQIEAGG 340

Query: 214 KDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAI 272
                   ++        G   ++   +  P+F+  +        + P  T+ G   I +
Sbjct: 341 DFEKFARTYSQDGSASQGGDLGWISPGETVPEFERAMNALQDGQISQPIRTEYGYHLIQV 400

Query: 273 CDKRDLGGEIALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
             +R+  G +  +  +        K E+  A+++++LR ++ + Y
Sbjct: 401 VGRREAEGSVQQQMDIARQAIGQRKAEQAYADWLRELRDSSYVQY 445


>gi|218661101|ref|ZP_03517031.1| peptidyl-prolyl cis-trans isomerase protein [Rhizobium etli IE4771]
          Length = 295

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 77/295 (26%), Positives = 140/295 (47%), Gaps = 10/295 (3%)

Query: 30  IVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQE 89
           +        +S ++  +NG  IT GD++KR A L+LQ    +  K A ++LI ETLK+QE
Sbjct: 2   MGLAGPALAASEVQAVVNGTAITSGDVAKRQAFLRLQHTKADA-KTAKEQLIDETLKRQE 60

Query: 90  IEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVK 149
           + +  ++     V+  F + +    LS E  S  LD+ G+G +HFK ++A+Q  WP VV 
Sbjct: 61  VARVRMSVSQQDVDASFARFSAGNKLSVEQMSQILDRAGVGVDHFKGFIAVQMSWPRVVN 120

Query: 150 NDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESR 209
             +         ++ +   +                     + +      KR  +AE SR
Sbjct: 121 ARYGSTSRLSNYDLVSRMMQNNKQKPVTTEYMLQQIIFVIPQAKRAAITGKRKGEAEASR 180

Query: 210 LRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEY 269
            + P   ++ + FA+ + DV++     +L  ++ P ++ L+++++ NTT   VT KGVEY
Sbjct: 181 SKFPGC-DQSKVFAATMRDVAVRDLGRMLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEY 239

Query: 270 IAICDKRDLGGEIALKAYLSAQNTPTKI--------EKHEAEYVKKLRSNAIIHY 316
           +AIC +R +  + A +     ++              ++  +Y+ +LR  A I Y
Sbjct: 240 LAICSQRQVSDDQAAEMVFRQEDLDKSKAGKNGPPENENSKKYLDELRKKAQIAY 294


>gi|251767814|ref|ZP_02268497.2| putative survival protein SurA [Burkholderia mallei PRL-20]
 gi|254360242|ref|ZP_04976512.1| putative survival protein SurA [Burkholderia mallei 2002721280]
 gi|148029482|gb|EDK87387.1| putative survival protein SurA [Burkholderia mallei 2002721280]
 gi|243061646|gb|EES43832.1| putative survival protein SurA [Burkholderia mallei PRL-20]
          Length = 450

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 40/337 (11%), Positives = 113/337 (33%), Gaps = 31/337 (9%)

Query: 8   SLSDFIKLLTTYFVLIIFCIVPIVSYKSWAM-------SSRIRTTINGEVITDGDISKRI 60
           ++   ++       L+   I    S  + A+       +  +   +N +VIT  ++ +R+
Sbjct: 2   AMKKTLRFAAVASGLVASLITVAPSASAQALRAQGASLADEVVAVVNNDVITGRELDQRV 61

Query: 61  ALLKLQKING--------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
            L+  +            +L    + ++++E ++ Q  +  GI  D+ TV     + A+ 
Sbjct: 62  GLIARRLQQQKAPVPPTDQLRAQVLNQMVLERIQVQRAKDDGIVVDNATVQATLGRLAQA 121

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMK- 171
            G+  + + + ++ QG+  + F +    + +   + + +   K    + E+ +     + 
Sbjct: 122 NGMQLDQYKARIEAQGVPWDLFVRDARTELMLSKLREKEVDSKITVSDAEVASYIASQRG 181

Query: 172 NITVREYLIRTVLFSIPDNKLQNQGFV----QKRIKDAEESRLRLPKDCNKLEKFASKIH 227
                +  +R     +       Q  +    +K     +++           +  +    
Sbjct: 182 PNAGSQQDLRLEHIFVKAPANAPQADIDVAQKKAEGLLQQALASGANFERLAKNQSEADD 241

Query: 228 DVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNP--YVTQKGVEYIAICDKR----DLGGE 281
               G   +   + L     + + K +    NP       G E + + ++R         
Sbjct: 242 AKKGGDLGFKSPASLPSDVVDAVSKLRPGEVNPTLIRVPDGFEIVRLVERRASQNPAASP 301

Query: 282 IALKAYLSAQNT---PTKIEKHEAEYVKKLRSNAIIH 315
             ++ ++          K E    + +  +R    I 
Sbjct: 302 KIVQTHVRHILLRVGEGKSESQARQQLIDIRRQ--IE 336



 Score =  103 bits (255), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 16/156 (10%), Positives = 54/156 (34%), Gaps = 2/156 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +     +    + +          +   + +++   ++++ D                 +
Sbjct: 289 VERRASQNPAASPKIVQTHVRHILLRVGEGKSESQARQQLIDIRRQIESGGDFEKFARTY 348

Query: 223 ASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
           +        G   ++   +  P+F+  +        +NP  T+ G   I +  +RD  G 
Sbjct: 349 SQDGSASQGGDLGWISPGEPVPEFERAMNTLQDGQVSNPVRTEYGYHLIQVLGRRDAEGS 408

Query: 282 IALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           +  +  +        K E+  ++++++LR ++ +  
Sbjct: 409 VQQQMDIARQAIGQRKAEQAYSDWLRELRDSSYVQI 444


>gi|121956451|sp|Q8Y220|SURA_RALSO RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
          Length = 496

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 44/304 (14%), Positives = 95/304 (31%), Gaps = 21/304 (6%)

Query: 29  PIVSYKSWAMSSRIRTTINGEVITDGDISKRI----ALLKLQKINGELEK----IAVQEL 80
                    +   +   +N ++IT  ++  R       L+ Q     +        +++L
Sbjct: 77  TASGAARSQLVDEVVAVVNTDIITRRELLDRADLVERTLQSQNRQVPVRADLLGEVLEQL 136

Query: 81  IVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAI 140
           I+E ++ Q  ++SGI      V+      A+   LS     S L + G+  + +++ L  
Sbjct: 137 ILERVQAQTAKESGIRVSDADVDRAVESVAQRNNLSVSQLKSKLAQSGLAYDKYREDLRQ 196

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITV----REYLIRTVLFSIPDNKLQNQG 196
           + +   +   +   K    + EI     +          +EY +  +L  + ++    Q 
Sbjct: 197 EILLARLRDREVDSKVQVFDGEIDNFLAQQGGSAASSGVQEYNVAQILVPVAEDASAEQK 256

Query: 197 FVQKRIKDA-EESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQ 254
              +   ++  +               +        G+        L  QF N +     
Sbjct: 257 AAARGKAESLLKQVQGGADFAKLARDSSGAPEAAQGGELGLRPIGRLPAQFANAVVDLKP 316

Query: 255 NNTT-NPYVTQKGVEYIAICDKRDLGGEIALK------AYLSAQNTPTKIEKHEAEYVKK 307
                    +  G   + + DKR  G  I  K       ++  +  PT         +  
Sbjct: 317 GQVVDQVIESPAGFHVLKLVDKRAQGTAITAKVAQTQVRHILIKTGPTMSADDARRQLAG 376

Query: 308 LRSN 311
           LR  
Sbjct: 377 LRDR 380



 Score =  113 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 21/178 (11%), Positives = 64/178 (35%), Gaps = 2/178 (1%)

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQK 200
                 VV        G   +++   + +   IT +    +     I      +    ++
Sbjct: 313 DLKPGQVVDQVIESPAGFHVLKLVDKRAQGTAITAKVAQTQVRHILIKTGPTMSADDARR 372

Query: 201 RIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTN 259
           ++    +  +      +   +++      + G+  ++    L P+F+  +        + 
Sbjct: 373 QLAGLRDRIVHGYDFGDAARRYSQDTSASAGGELGWVSPGQLVPEFEQAMGLLKPGEVSQ 432

Query: 260 PYVTQKGVEYIAICDKRDLGGEIAL-KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           P  +Q G+  I +  +R+    +   + Y  +     K++    +++++LR +A + Y
Sbjct: 433 PVQSQFGLHLIQVEGRREAEVPVDRQRDYARSVIREQKVQAAYEDWLRQLRDSAHVEY 490


>gi|17545235|ref|NP_518637.1| peptidyl-prolyl cis-trans isomerase [Ralstonia solanacearum
           GMI1000]
 gi|17427526|emb|CAD14044.1| probable peptidyl-prolyl cis-trans isomerase (rotamase c) protein
           [Ralstonia solanacearum GMI1000]
          Length = 498

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 44/304 (14%), Positives = 95/304 (31%), Gaps = 21/304 (6%)

Query: 29  PIVSYKSWAMSSRIRTTINGEVITDGDISKRI----ALLKLQKINGELEK----IAVQEL 80
                    +   +   +N ++IT  ++  R       L+ Q     +        +++L
Sbjct: 79  TASGAARSQLVDEVVAVVNTDIITRRELLDRADLVERTLQSQNRQVPVRADLLGEVLEQL 138

Query: 81  IVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAI 140
           I+E ++ Q  ++SGI      V+      A+   LS     S L + G+  + +++ L  
Sbjct: 139 ILERVQAQTAKESGIRVSDADVDRAVESVAQRNNLSVSQLKSKLAQSGLAYDKYREDLRQ 198

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITV----REYLIRTVLFSIPDNKLQNQG 196
           + +   +   +   K    + EI     +          +EY +  +L  + ++    Q 
Sbjct: 199 EILLARLRDREVDSKVQVFDGEIDNFLAQQGGSAASSGVQEYNVAQILVPVAEDASAEQK 258

Query: 197 FVQKRIKDA-EESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQ 254
              +   ++  +               +        G+        L  QF N +     
Sbjct: 259 AAARGKAESLLKQVQGGADFAKLARDSSGAPEAAQGGELGLRPIGRLPAQFANAVVDLKP 318

Query: 255 NNTT-NPYVTQKGVEYIAICDKRDLGGEIALK------AYLSAQNTPTKIEKHEAEYVKK 307
                    +  G   + + DKR  G  I  K       ++  +  PT         +  
Sbjct: 319 GQVVDQVIESPAGFHVLKLVDKRAQGTAITAKVAQTQVRHILIKTGPTMSADDARRQLAG 378

Query: 308 LRSN 311
           LR  
Sbjct: 379 LRDR 382



 Score =  113 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 21/178 (11%), Positives = 64/178 (35%), Gaps = 2/178 (1%)

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQK 200
                 VV        G   +++   + +   IT +    +     I      +    ++
Sbjct: 315 DLKPGQVVDQVIESPAGFHVLKLVDKRAQGTAITAKVAQTQVRHILIKTGPTMSADDARR 374

Query: 201 RIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTN 259
           ++    +  +      +   +++      + G+  ++    L P+F+  +        + 
Sbjct: 375 QLAGLRDRIVHGYDFGDAARRYSQDTSASAGGELGWVSPGQLVPEFEQAMGLLKPGEVSQ 434

Query: 260 PYVTQKGVEYIAICDKRDLGGEIAL-KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           P  +Q G+  I +  +R+    +   + Y  +     K++    +++++LR +A + Y
Sbjct: 435 PVQSQFGLHLIQVEGRREAEVPVDRQRDYARSVIREQKVQAAYEDWLRQLRDSAHVEY 492


>gi|120613390|ref|YP_973068.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Acidovorax citrulli
           AAC00-1]
 gi|120591854|gb|ABM35294.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Acidovorax citrulli
           AAC00-1]
          Length = 476

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 42/273 (15%), Positives = 95/273 (34%), Gaps = 16/273 (5%)

Query: 38  MSSRIRTTINGEVITDGDISKRIALLKLQK--------INGELEKIAVQELIVETLKKQE 89
            +  I   +N E IT+ ++  R+A ++ Q             + +  ++ LI E ++ Q 
Sbjct: 68  QADYIVAVVNTEPITNNEVQARVARVEHQLAAQGGERPPRRVIAREVLERLINEKIQVQM 127

Query: 90  IEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVK 149
             +SGI  D   V+      AR   +S  +    L   GI    F+  L  Q +   + +
Sbjct: 128 ATESGIKVDDYAVSQAEQSVARQNSVSIPEMHRRLAADGISPERFRSELRNQLLIQRLRE 187

Query: 150 NDFMLKYGNLEMEIPANKQKMKNITVREYLIR-----TVLFSIPDNKLQNQGFVQKRIKD 204
            D   +    ++++    +  +   + +          +L S+P+N        +++   
Sbjct: 188 RDVESRVRVSDLDVDQYMRDQQQSAMSDPSKIELNLGHILVSVPENASPEVVEQRRQRAQ 247

Query: 205 AEESRLRLPKDCNK-LEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYV 262
               R+R  +D  K     +      + G+            F + + +        P  
Sbjct: 248 QAADRVRAGEDFAKVARDLSDAPEAPTGGELGLRPADRYPDLFLRTVQQVPVGGIAGPVR 307

Query: 263 TQKGVEYIAICDK-RDLGGEIALKAYLSAQNTP 294
           +  G   + + ++ R      AL+ ++      
Sbjct: 308 SPAGFHVLRVIERSRAGIPATALQNHVRHILLR 340



 Score = 97.1 bits (239), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 14/106 (13%), Positives = 37/106 (34%), Gaps = 2/106 (1%)

Query: 213 PKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIA 271
                   + +        G   +       P+F+  +     +  + P V++ GV  I 
Sbjct: 366 ADFATLAREHSQDGSAKQGGDLGWAGPGRYVPEFEEAVDALKPDEISQPVVSRFGVHLIQ 425

Query: 272 ICDKRDLGGEI-ALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           + ++R+        +  +       K+E+    + ++ R+ A + Y
Sbjct: 426 LLERREAKLTQREQRDMVRDAVREKKLEEAFTNWAQEARARAYVEY 471


>gi|114328860|ref|YP_746017.1| peptidyl-prolyl cis-trans isomerase [Granulibacter bethesdensis
           CGDNIH1]
 gi|114317034|gb|ABI63094.1| peptidyl-prolyl cis-trans isomerase [Granulibacter bethesdensis
           CGDNIH1]
          Length = 468

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 41/267 (15%), Positives = 94/267 (35%), Gaps = 9/267 (3%)

Query: 32  SYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEK-------IAVQELIVET 84
           +  S    + I   +NG+VI+ GD+  R  L  +       ++         +++L+ E 
Sbjct: 62  APASSPDETSIVAVVNGDVISKGDVDARRRLFAMSTGLPMSKEVLDRLTPQVLRQLVDEK 121

Query: 85  LKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIW 144
           L+ QEI++ GI    + + +      +  G+  +     L   G+        + +Q  W
Sbjct: 122 LRLQEIQRRGIVITDSDIAHSIQGMEQRNGMQPDALRHKLAADGVSMRTLIDQIRVQLGW 181

Query: 145 PDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKD 204
             V++     +    + EI   ++ + +   +     + +F   D+  + Q         
Sbjct: 182 TRVLRQQLGERVRISDKEIQDEEELLASQKGQTEYRVSEIFIPVDDPSRAQAAHDFADT- 240

Query: 205 AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDL-HPQFQNLLKKSQNNTTNPYVT 263
             +             +F+     +  G   ++  + L       L +      +NP   
Sbjct: 241 VIQQLRSGAPFPVVAAQFSQSQTALEGGDLGWVQPNQLDPQVVSVLKEMPPGAISNPIDV 300

Query: 264 QKGVEYIAICDKRDLGGEIALKAYLSA 290
             G+E +A+  KR +G +      +  
Sbjct: 301 AGGIEIVALRGKRIIGNDQGTALSIRQ 327



 Score = 47.4 bits (110), Expect = 0.003,   Method: Composition-based stats.
 Identities = 30/255 (11%), Positives = 69/255 (27%), Gaps = 4/255 (1%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I+D +I     LL  QK   E     +   + +  + Q       T      +       
Sbjct: 195 ISDKEIQDEEELLASQKGQTEYRVSEIFIPVDDPSRAQAAHDFADTVIQQLRSGAPFPVV 254

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQS--IWPDVVKNDFMLKYGNLEMEIPANKQ 168
                 ++      D   +  N     +      + P  + N   +  G   + +   + 
Sbjct: 255 AAQFSQSQTALEGGDLGWVQPNQLDPQVVSVLKEMPPGAISNPIDVAGGIEIVALRGKRI 314

Query: 169 KMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHD 228
              +      + +                 Q++  +  ++      DC  +E  +  +  
Sbjct: 315 IGNDQGTALSIRQVFYPFTTPLNPAAPTDQQRKTLEHAKAAAAAMHDCAAVEAASKAMGG 374

Query: 229 VSIGKAQYLLESDL--HPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA 286
                   L    +        L        + P V+Q G+  + +C +      +  K 
Sbjct: 375 SRPSDPGELRLESINPPQFRALLASLPVGQPSQPIVSQDGIAIMMVCSRTQKNFGLPGKE 434

Query: 287 YLSAQNTPTKIEKHE 301
            +S Q    ++E   
Sbjct: 435 DISNQILGERVETAS 449


>gi|53725016|ref|YP_102044.1| survival protein SurA [Burkholderia mallei ATCC 23344]
 gi|67641452|ref|ZP_00440230.1| chaperone SurA [Burkholderia mallei GB8 horse 4]
 gi|121598370|ref|YP_994032.1| putative survival protein SurA [Burkholderia mallei SAVP1]
 gi|124385555|ref|YP_001028304.1| putative survival protein SurA [Burkholderia mallei NCTC 10229]
 gi|126449043|ref|YP_001081948.1| putative survival protein SurA [Burkholderia mallei NCTC 10247]
 gi|254176840|ref|ZP_04883497.1| putative survival protein SurA [Burkholderia mallei ATCC 10399]
 gi|254203730|ref|ZP_04910090.1| putative survival protein SurA [Burkholderia mallei FMH]
 gi|254208705|ref|ZP_04915053.1| putative survival protein SurA [Burkholderia mallei JHU]
 gi|81685183|sp|Q62MM4|SURA_BURMA RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|52428439|gb|AAU49032.1| survival protein SurA, putative [Burkholderia mallei ATCC 23344]
 gi|121227180|gb|ABM49698.1| putative survival protein SurA [Burkholderia mallei SAVP1]
 gi|124293575|gb|ABN02844.1| putative survival protein SurA [Burkholderia mallei NCTC 10229]
 gi|126241913|gb|ABO05006.1| putative survival protein SurA [Burkholderia mallei NCTC 10247]
 gi|147745242|gb|EDK52322.1| putative survival protein SurA [Burkholderia mallei FMH]
 gi|147750581|gb|EDK57650.1| putative survival protein SurA [Burkholderia mallei JHU]
 gi|160697881|gb|EDP87851.1| putative survival protein SurA [Burkholderia mallei ATCC 10399]
 gi|238522391|gb|EEP85835.1| chaperone SurA [Burkholderia mallei GB8 horse 4]
          Length = 448

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 40/336 (11%), Positives = 112/336 (33%), Gaps = 31/336 (9%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAM-------SSRIRTTINGEVITDGDISKRIA 61
           +   ++       L+   I    S  + A+       +  +   +N +VIT  ++ +R+ 
Sbjct: 1   MKKTLRFAAVASGLVASLITVAPSASAQALRAQGASLADEVVAVVNNDVITGRELDQRVG 60

Query: 62  LLKLQKING--------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNT 113
           L+  +            +L    + ++++E ++ Q  +  GI  D+ TV     + A+  
Sbjct: 61  LIARRLQQQKAPVPPTDQLRAQVLNQMVLERIQVQRAKDDGIVVDNATVQATLGRLAQAN 120

Query: 114 GLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMK-N 172
           G+  + + + ++ QG+  + F +    + +   + + +   K    + E+ +     +  
Sbjct: 121 GMQLDQYKARIEAQGVPWDLFVRDARTELMLSKLREKEVDSKITVSDAEVASYIASQRGP 180

Query: 173 ITVREYLIRTVLFSIPDNKLQNQGFV----QKRIKDAEESRLRLPKDCNKLEKFASKIHD 228
               +  +R     +       Q  +    +K     +++           +  +     
Sbjct: 181 NAGSQQDLRLEHIFVKAPANAPQADIDVAQKKAEGLLQQALASGANFERLAKNQSEADDA 240

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQNNTTNP--YVTQKGVEYIAICDKR----DLGGEI 282
              G   +   + L     + + K +    NP       G E + + ++R          
Sbjct: 241 KKGGDLGFKSPASLPSDVVDAVSKLRPGEVNPTLIRVPDGFEIVRLVERRASQNPAASPK 300

Query: 283 ALKAYLSAQNT---PTKIEKHEAEYVKKLRSNAIIH 315
            ++ ++          K E    + +  +R    I 
Sbjct: 301 IVQTHVRHILLRVGEGKSESQARQQLIDIRRQ--IE 334



 Score =  103 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 16/156 (10%), Positives = 54/156 (34%), Gaps = 2/156 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +     +    + +          +   + +++   ++++ D                 +
Sbjct: 287 VERRASQNPAASPKIVQTHVRHILLRVGEGKSESQARQQLIDIRRQIESGGDFEKFARTY 346

Query: 223 ASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
           +        G   ++   +  P+F+  +        +NP  T+ G   I +  +RD  G 
Sbjct: 347 SQDGSASQGGDLGWISPGEPVPEFERAMNTLQDGQVSNPVRTEYGYHLIQVLGRRDAEGS 406

Query: 282 IALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           +  +  +        K E+  ++++++LR ++ +  
Sbjct: 407 VQQQMDIARQAIGQRKAEQAYSDWLRELRDSSYVQI 442


>gi|149186120|ref|ZP_01864434.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Erythrobacter sp.
           SD-21]
 gi|148830151|gb|EDL48588.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Erythrobacter sp.
           SD-21]
          Length = 448

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 47/279 (16%), Positives = 88/279 (31%), Gaps = 11/279 (3%)

Query: 44  TTINGEVITDGDISKRIALLKLQKIN-------GELEKIAVQELIVETLKKQEIEKSGIT 96
             +NG VIT  D+ +R+ALL               +    ++ LI ETL+ Q  E   I 
Sbjct: 59  AVVNGYVITGTDLDQRLALLVNANQTEIPAEELQRVRAQVLRNLIDETLQIQAAEAEEIV 118

Query: 97  FDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKY 156
                V   F + A       ED  ++L   G      K+ +  +  W  +++       
Sbjct: 119 ISDAEVEQTFARVAAQNNQRPEDMENYLASIGSSSASLKRQIRGELAWQRLLRQKVSFFV 178

Query: 157 GNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDC 216
                E+    ++++     +      +        +N   VQ   +   E   +     
Sbjct: 179 NVSAEEVNELMERLEAAKGTDEYWLWEI--FMSATPENDAAVQANAQKIMEQLRQGGSFV 236

Query: 217 NKLEKFASKIHDVSIGKAQYLLESDL--HPQFQNLLKKSQNNTTNPYVTQKGVEYIAICD 274
               +F+        G   ++  + L        + +        P     G   + + D
Sbjct: 237 AYARQFSEASTAAVGGDLDWIHLAQLGDPQLETVVAQMEAGQLVGPIKIPGGYWIVYLRD 296

Query: 275 KRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAI 313
           KR +       A LS +      +   A  V K + +A 
Sbjct: 297 KRQVLMADPRDAMLSLKQIQIDFDPAAAPEVNKQKLDAF 335



 Score = 56.6 bits (134), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 37/83 (44%), Gaps = 3/83 (3%)

Query: 237 LLESDLHPQFQNLLKK-SQNNTTNPYVT-QKGVEYIAICDKRDLGGEI-ALKAYLSAQNT 293
           +    L  Q QN++       TT P+ + ++GV  + +C + D           L AQ  
Sbjct: 365 IRARALPEQLQNIMLSLQIGETTPPFGSLEEGVRVLMLCGRDDPESSEGPNFDELMAQIE 424

Query: 294 PTKIEKHEAEYVKKLRSNAIIHY 316
             +I K    Y++ LR++A I Y
Sbjct: 425 DERINKAAQRYLRDLRNDAYIEY 447


>gi|301059205|ref|ZP_07200143.1| SurA N-terminal domain protein [delta proteobacterium NaphS2]
 gi|300446695|gb|EFK10522.1| SurA N-terminal domain protein [delta proteobacterium NaphS2]
          Length = 324

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 45/319 (14%), Positives = 121/319 (37%), Gaps = 20/319 (6%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMS----SRIRTTINGEVITDGDISKRIALL------- 63
           +  +   +++F  V   ++     +    +R+   +N +V+T  +++ R+  +       
Sbjct: 1   MRKSTIFVLMFLFVGANAFLQGKANGEIYNRVVAIVNADVVTLYELNTRLTQMTGMAPDA 60

Query: 64  ---KLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
              K +    E+ +  ++ LI E +  ++I++  I    + V+       R   ++ ED 
Sbjct: 61  LKRKSESQYLEMRRKVLEMLIEEKIAIEKIKEMKINVPQSEVDAAIETLKRENDMTQEDL 120

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180
            + L  QG+  + +++ L  +     ++  +   K    + E+ A     K+    +  +
Sbjct: 121 VAGLKAQGLSLDEYRKRLKTELERRRLINYEVRSKIIITDEEVQAYYDTHKDNYSTKGKV 180

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYL 237
              +  +      N+   +   + A++   ++    N      +F++       G     
Sbjct: 181 HLAMIFLKQEDPGNREEARALRRKADQIIGKIKAGENFGTLAAQFSNGPGAKDGGDLGVF 240

Query: 238 LESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRD--LGGEIALKAYLSAQNTP 294
             S+L+ +    +K  S      P V   G++ I + +K +        +K  + +    
Sbjct: 241 NISELNSEMAASIKDLSSGEIGTPIVRPNGIQIIKVVEKDEGGEKSFEKVKNAIRSTLYR 300

Query: 295 TKIEKHEAEYVKKLRSNAI 313
            K+ +    ++K LR  + 
Sbjct: 301 EKMNQAYDAWIKDLREKSY 319


>gi|126441500|ref|YP_001057745.1| putative survival protein SurA [Burkholderia pseudomallei 668]
 gi|134279812|ref|ZP_01766524.1| putative survival protein SurA [Burkholderia pseudomallei 305]
 gi|217419752|ref|ZP_03451258.1| putative chaperone surA [Burkholderia pseudomallei 576]
 gi|226830776|ref|YP_001064989.2| putative survival protein SurA [Burkholderia pseudomallei 1106a]
 gi|237810895|ref|YP_002895346.1| chaperone SurA [Burkholderia pseudomallei MSHR346]
 gi|254258573|ref|ZP_04949627.1| putative chaperone surA [Burkholderia pseudomallei 1710a]
 gi|126220993|gb|ABN84499.1| putative chaperone surA [Burkholderia pseudomallei 668]
 gi|134249012|gb|EBA49094.1| putative survival protein SurA [Burkholderia pseudomallei 305]
 gi|210148311|gb|ABN91359.2| putative chaperone SurA [Burkholderia pseudomallei 1106a]
 gi|217397056|gb|EEC37072.1| putative chaperone surA [Burkholderia pseudomallei 576]
 gi|237504702|gb|ACQ97020.1| chaperone SurA [Burkholderia pseudomallei MSHR346]
 gi|254217262|gb|EET06646.1| putative chaperone surA [Burkholderia pseudomallei 1710a]
          Length = 450

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 40/337 (11%), Positives = 113/337 (33%), Gaps = 31/337 (9%)

Query: 8   SLSDFIKLLTTYFVLIIFCIVPIVSYKSWAM-------SSRIRTTINGEVITDGDISKRI 60
           ++   ++       L+   I    S  + A+       +  +   +N +VIT  ++ +R+
Sbjct: 2   AMKKTLRFAAVASGLVASLITVAPSASAQALRAQGASLADEVVAVVNNDVITGRELDQRV 61

Query: 61  ALLKLQKING--------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
            L+  +            +L    + ++++E ++ Q  +  GI  D+ TV     + A+ 
Sbjct: 62  GLIARRLQQQKAPVPPTDQLRAQVLNQMVLERIQVQRAKDDGIVVDNATVQATLGRLAQA 121

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMK- 171
            G+  + + + ++ QG+  + F +    + +   + + +   K    + E+ +     + 
Sbjct: 122 NGMQLDQYKARIEAQGVPWDLFVRDARTELMLSKLREKEVDSKITVSDAEVASYIASQRG 181

Query: 172 NITVREYLIRTVLFSIPDNKLQNQGFV----QKRIKDAEESRLRLPKDCNKLEKFASKIH 227
                +  +R     +       Q  +    +K     +++           +  +    
Sbjct: 182 PNAGSQQDLRLEHIFVKAPANAPQADIDVAQKKAEGLLQQALASGANFERLAKNQSEADD 241

Query: 228 DVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNP--YVTQKGVEYIAICDKR----DLGGE 281
               G   +   + L     + + K +    NP       G E + + ++R         
Sbjct: 242 AKKGGDLGFKSPASLPSDVVDAVSKLRPGEVNPTLIRVPDGFEIVRLVERRASQNPAASP 301

Query: 282 IALKAYLSAQNT---PTKIEKHEAEYVKKLRSNAIIH 315
             ++ ++          K E    + +  +R    I 
Sbjct: 302 KIVQTHVRHILLRVGEGKSESQARQQLIDIRRQ--IE 336



 Score =  103 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 16/156 (10%), Positives = 54/156 (34%), Gaps = 2/156 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +     +    + +          +   + +++   ++++ D                 +
Sbjct: 289 VERRASQNPAASPKIVQTHVRHILLRVGEGKSESQARQQLIDIRRQIESGGDFEKFARTY 348

Query: 223 ASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
           +        G   ++   +  P+F+  +        +NP  T+ G   I +  +RD  G 
Sbjct: 349 SQDGSASQGGDLGWISPGETVPEFERAMNTLQDGQVSNPVRTEYGYHLIQVLGRRDAEGS 408

Query: 282 IALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           +  +  +        K E+  ++++++LR ++ +  
Sbjct: 409 VQQQMDIARQAIGQRKAEQAYSDWLRELRDSSYVQI 444


>gi|76810003|ref|YP_332285.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Burkholderia
           pseudomallei 1710b]
 gi|167718164|ref|ZP_02401400.1| putative survival protein SurA [Burkholderia pseudomallei DM98]
 gi|167737195|ref|ZP_02409969.1| putative survival protein SurA [Burkholderia pseudomallei 14]
 gi|167822803|ref|ZP_02454274.1| putative survival protein SurA [Burkholderia pseudomallei 9]
 gi|167844378|ref|ZP_02469886.1| putative survival protein SurA [Burkholderia pseudomallei B7210]
 gi|167901377|ref|ZP_02488582.1| putative survival protein SurA [Burkholderia pseudomallei NCTC
           13177]
 gi|167909606|ref|ZP_02496697.1| putative survival protein SurA [Burkholderia pseudomallei 112]
 gi|167917621|ref|ZP_02504712.1| putative survival protein SurA [Burkholderia pseudomallei BCC215]
 gi|226196777|ref|ZP_03792357.1| putative chaperone surA [Burkholderia pseudomallei Pakistan 9]
 gi|242314929|ref|ZP_04813945.1| putative chaperone surA [Burkholderia pseudomallei 1106b]
 gi|254181756|ref|ZP_04888353.1| putative survival protein SurA [Burkholderia pseudomallei 1655]
 gi|254196558|ref|ZP_04902982.1| putative survival protein SurA [Burkholderia pseudomallei S13]
 gi|254296203|ref|ZP_04963660.1| putative survival protein SurA [Burkholderia pseudomallei 406e]
 gi|122070636|sp|Q3JVW8|SURA_BURP1 RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|76579456|gb|ABA48931.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Burkholderia
           pseudomallei 1710b]
 gi|157805631|gb|EDO82801.1| putative survival protein SurA [Burkholderia pseudomallei 406e]
 gi|169653301|gb|EDS85994.1| putative survival protein SurA [Burkholderia pseudomallei S13]
 gi|184212294|gb|EDU09337.1| putative survival protein SurA [Burkholderia pseudomallei 1655]
 gi|225931308|gb|EEH27315.1| putative chaperone surA [Burkholderia pseudomallei Pakistan 9]
 gi|242138168|gb|EES24570.1| putative chaperone surA [Burkholderia pseudomallei 1106b]
          Length = 448

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 40/336 (11%), Positives = 112/336 (33%), Gaps = 31/336 (9%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAM-------SSRIRTTINGEVITDGDISKRIA 61
           +   ++       L+   I    S  + A+       +  +   +N +VIT  ++ +R+ 
Sbjct: 1   MKKTLRFAAVASGLVASLITVAPSASAQALRAQGASLADEVVAVVNNDVITGRELDQRVG 60

Query: 62  LLKLQKING--------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNT 113
           L+  +            +L    + ++++E ++ Q  +  GI  D+ TV     + A+  
Sbjct: 61  LIARRLQQQKAPVPPTDQLRAQVLNQMVLERIQVQRAKDDGIVVDNATVQATLGRLAQAN 120

Query: 114 GLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMK-N 172
           G+  + + + ++ QG+  + F +    + +   + + +   K    + E+ +     +  
Sbjct: 121 GMQLDQYKARIEAQGVPWDLFVRDARTELMLSKLREKEVDSKITVSDAEVASYIASQRGP 180

Query: 173 ITVREYLIRTVLFSIPDNKLQNQGFV----QKRIKDAEESRLRLPKDCNKLEKFASKIHD 228
               +  +R     +       Q  +    +K     +++           +  +     
Sbjct: 181 NAGSQQDLRLEHIFVKAPANAPQADIDVAQKKAEGLLQQALASGANFERLAKNQSEADDA 240

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQNNTTNP--YVTQKGVEYIAICDKR----DLGGEI 282
              G   +   + L     + + K +    NP       G E + + ++R          
Sbjct: 241 KKGGDLGFKSPASLPSDVVDAVSKLRPGEVNPTLIRVPDGFEIVRLVERRASQNPAASPK 300

Query: 283 ALKAYLSAQNT---PTKIEKHEAEYVKKLRSNAIIH 315
            ++ ++          K E    + +  +R    I 
Sbjct: 301 IVQTHVRHILLRVGEGKSESQARQQLIDIRRQ--IE 334



 Score =  103 bits (256), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 16/156 (10%), Positives = 54/156 (34%), Gaps = 2/156 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +     +    + +          +   + +++   ++++ D                 +
Sbjct: 287 VERRASQNPAASPKIVQTHVRHILLRVGEGKSESQARQQLIDIRRQIESGGDFEKFARTY 346

Query: 223 ASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
           +        G   ++   +  P+F+  +        +NP  T+ G   I +  +RD  G 
Sbjct: 347 SQDGSASQGGDLGWISPGETVPEFERAMNTLQDGQVSNPVRTEYGYHLIQVLGRRDAEGS 406

Query: 282 IALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           +  +  +        K E+  ++++++LR ++ +  
Sbjct: 407 VQQQMDIARQAIGQRKAEQAYSDWLRELRDSSYVQI 442


>gi|167892891|ref|ZP_02480293.1| putative survival protein SurA [Burkholderia pseudomallei 7894]
 gi|254187685|ref|ZP_04894197.1| putative survival protein SurA [Burkholderia pseudomallei Pasteur
           52237]
 gi|157935365|gb|EDO91035.1| putative survival protein SurA [Burkholderia pseudomallei Pasteur
           52237]
          Length = 448

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 40/336 (11%), Positives = 112/336 (33%), Gaps = 31/336 (9%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAM-------SSRIRTTINGEVITDGDISKRIA 61
           +   ++       L+   I    S  + A+       +  +   +N +VIT  ++ +R+ 
Sbjct: 1   MKKTLRFAAAASGLVASLITVAPSASAQALRAQGASLADEVVAVVNNDVITGRELDQRVG 60

Query: 62  LLKLQKING--------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNT 113
           L+  +            +L    + ++++E ++ Q  +  GI  D+ TV     + A+  
Sbjct: 61  LIARRLQQQKAPVPPTDQLRAQVLNQMVLERIQVQRAKDDGIVVDNATVQATLGRLAQAN 120

Query: 114 GLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMK-N 172
           G+  + + + ++ QG+  + F +    + +   + + +   K    + E+ +     +  
Sbjct: 121 GMQLDQYKARIEAQGVPWDLFVRDARTELMLSKLREKEVDSKITVSDAEVASYIASQRGP 180

Query: 173 ITVREYLIRTVLFSIPDNKLQNQGFV----QKRIKDAEESRLRLPKDCNKLEKFASKIHD 228
               +  +R     +       Q  +    +K     +++           +  +     
Sbjct: 181 NAGSQQDLRLEHIFVKAPANAPQADIDVAQKKAEGLLQQALASGANFERLAKNQSEADDA 240

Query: 229 VSIGKAQYLLESDLHPQFQNLLKKSQNNTTNP--YVTQKGVEYIAICDKR----DLGGEI 282
              G   +   + L     + + K +    NP       G E + + ++R          
Sbjct: 241 KKGGDLGFKSPASLPSDVVDAVSKLRPGEVNPTLIRVPDGFEIVRLVERRASQNPAASPK 300

Query: 283 ALKAYLSAQNT---PTKIEKHEAEYVKKLRSNAIIH 315
            ++ ++          K E    + +  +R    I 
Sbjct: 301 IVQTHVRHILLRVGEGKSESQARQQLIDIRRQ--IE 334



 Score =  103 bits (256), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 16/156 (10%), Positives = 54/156 (34%), Gaps = 2/156 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +     +    + +          +   + +++   ++++ D                 +
Sbjct: 287 VERRASQNPAASPKIVQTHVRHILLRVGEGKSESQARQQLIDIRRQIESGGDFEKFARTY 346

Query: 223 ASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
           +        G   ++   +  P+F+  +        +NP  T+ G   I +  +RD  G 
Sbjct: 347 SQDGSASQGGDLGWISPGETVPEFERAMNTLQDGQVSNPVRTEYGYHLIQVLGRRDAEGS 406

Query: 282 IALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           +  +  +        K E+  ++++++LR ++ +  
Sbjct: 407 VQQQMDIARQAIGQRKAEQAYSDWLRELRDSSYVQI 442


>gi|148264649|ref|YP_001231355.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter
           uraniireducens Rf4]
 gi|146398149|gb|ABQ26782.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter
           uraniireducens Rf4]
          Length = 326

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 38/286 (13%), Positives = 84/286 (29%), Gaps = 14/286 (4%)

Query: 44  TTINGEVITDGDISKRIALLKLQKI--------NGELEKIAVQELIVETLKKQEIEKSGI 95
             +NG  I+  + +  +  LK  +           E+++ A+  LI   L  QE  K GI
Sbjct: 37  AVVNGAPISREECNGELERLKRSRSVRLFSPALLKEIQQEALDNLIRRELIYQESRKGGI 96

Query: 96  TFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLK 155
              +  V+    +         E  S+         +               +   F  +
Sbjct: 97  GVAATAVDEELARLKTRFANEMEFSSALSSLHVSEASLRNIVER-GIAVRTYIDRQFAGQ 155

Query: 156 YGNLEMEIPANKQKMKNITVREYLIR--TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP 213
               + E     +   +   R   +R   +L        + +   +K+I+   E   +  
Sbjct: 156 STVTDEEKKGYYRSHPDTFKRPLQVRISHILVRTGGMTGKARAEAEKKIEGIREKVGKGE 215

Query: 214 KDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAI 272
                   ++        G   +    ++    ++ +       T+     + G+  I +
Sbjct: 216 SFDALARAYSECGSKEQGGDLGFFRRGEMARVVEDAVMDLKVGETSGIVEDRFGLHLIRL 275

Query: 273 CDKRDLGG--EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            D++        A +  +S      K  +    Y   LR  A +  
Sbjct: 276 TDRKPEQVIAYEAAEGKISEYLKQEKAMEKANRYAGDLRKKARVEI 321


>gi|190891133|ref|YP_001977675.1| peptidyl-prolyl cis-trans isomerase [Rhizobium etli CIAT 652]
 gi|218517103|ref|ZP_03513943.1| probable peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           etli 8C-3]
 gi|190696412|gb|ACE90497.1| probable peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           etli CIAT 652]
          Length = 314

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 76/287 (26%), Positives = 137/287 (47%), Gaps = 10/287 (3%)

Query: 38  MSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITF 97
            +S ++  +NG  IT GD++KR A L+LQ    +  K A ++LI ETLK+QE+ +  ++ 
Sbjct: 29  AASEVQAVVNGTAITSGDVAKRQAFLRLQHTAADA-KTAKEQLIDETLKRQEVARVHMSV 87

Query: 98  DSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYG 157
               V+  F + +    LS    S  LD+ G+G +HFK ++A+Q  WP VV   +     
Sbjct: 88  SQQDVDASFARFSAGNKLSVAQMSQILDRAGVGVDHFKGFIAVQMSWPRVVNARYGSTSR 147

Query: 158 NLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCN 217
               ++ +   +                     + +      KR  +AE SR + P   +
Sbjct: 148 LSNYDLVSRMMQNNKQKPVTTEYMLQQIIFVIPEAKRGAITGKRKGEAEASRSKFPGC-D 206

Query: 218 KLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRD 277
           + + FA+ + DV++     +L  ++ P ++ L+++++ NTT   VT KGVEY+AIC +R 
Sbjct: 207 QAKVFAATMRDVAVRDLGRMLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEYLAICSQRQ 266

Query: 278 LGGEIALKAYLSAQNTPTKI--------EKHEAEYVKKLRSNAIIHY 316
           +  + A +     ++               +  +Y+ +LR  A I Y
Sbjct: 267 VSDDQAAEMVFRQEDLDKSKAGKNGPPENDNSKKYLDELRKKAQIAY 313


>gi|218671035|ref|ZP_03520706.1| probable peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           etli GR56]
          Length = 314

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 77/287 (26%), Positives = 139/287 (48%), Gaps = 10/287 (3%)

Query: 38  MSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITF 97
            +S ++  +NG  IT GD++KR A L+LQ    +  K A ++LI ETLK+QE+ +  ++ 
Sbjct: 29  AASEVQAVVNGTAITSGDVAKRQAFLRLQHTKADA-KTAKEQLIDETLKRQEVARVRMSV 87

Query: 98  DSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYG 157
               V+  F + +    LS E  S  LD+ G+G +HFK ++A+Q  WP VV   +     
Sbjct: 88  SQQDVDASFARFSAGNKLSVEQMSQILDRAGVGVDHFKGFIAVQMSWPRVVNARYGSTSR 147

Query: 158 NLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCN 217
               ++ +   +                     + +      KR  +AE SR + P   +
Sbjct: 148 LSNYDLVSRMMQNNKQKPVTTEYMLQQIIFVIPQAKRAAITGKRKGEAEASRSKFPGC-D 206

Query: 218 KLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRD 277
           + + FA+ + DV++     +L  ++ P ++ L+++++ NTT   VT KGVEY+AIC +R 
Sbjct: 207 QAKVFAATMRDVAVRDLGRMLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEYLAICSQRQ 266

Query: 278 LGGEIALKAYLSAQNTPTKI--------EKHEAEYVKKLRSNAIIHY 316
           +  + A +     ++              ++  +Y+ +LR  A I Y
Sbjct: 267 VSDDQAAEMVFRQEDLDKSKAAKNGPPENENSKKYLDELRKKAQIAY 313


>gi|300692473|ref|YP_003753468.1| peptidyl-prolyl cis-trans isomerase (PPIase), involved in
           maturation of outer membrane proteins [Ralstonia
           solanacearum PSI07]
 gi|299079533|emb|CBJ52211.1| peptidyl-prolyl cis-trans isomerase (PPIase), involved in
           maturation of outer membrane proteins [Ralstonia
           solanacearum PSI07]
          Length = 475

 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 44/304 (14%), Positives = 93/304 (30%), Gaps = 21/304 (6%)

Query: 29  PIVSYKSWAMSSRIRTTINGEVITDGDISKRI----ALLKLQKINGELEK----IAVQEL 80
                    +   +   +N ++IT  ++  R       L+ Q              +++L
Sbjct: 56  TASGAARSQLVDEVVAVVNTDIITRRELLDRADLVERTLQSQNRPMPARADLLGEVLEQL 115

Query: 81  IVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAI 140
           I+E ++ Q  ++SGI      V+      A+   LS     S L + G+  + +++ L  
Sbjct: 116 ILERVQAQTAKESGIRVSDADVDRAVESVAQRNNLSVSQLKSKLVQSGLAYDKYREDLRQ 175

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNIT----VREYLIRTVLFSIPDNKLQNQG 196
           + +   +   +   K    + EI     +          +EY +  +L  + ++    Q 
Sbjct: 176 EILLARLRDREVDSKVQVFDGEIDNFLAQQGGAAASGGSQEYNVAQILVPVAEDASAEQK 235

Query: 197 FVQKRIKDA-EESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQ 254
              +   +   +               +        G+        L  QF N +     
Sbjct: 236 AAARGKAEGLLKQVQGGADFAKLARDHSGAPEAAQGGELGLRPIGRLPAQFANAVVDLKP 295

Query: 255 NNTTN-PYVTQKGVEYIAICDKRDLGGEIALK------AYLSAQNTPTKIEKHEAEYVKK 307
                    +  G   + + DKR  G  I  K       ++  +  PT         +  
Sbjct: 296 GQVVGQVIESPAGFHVLKLVDKRVQGTAITAKVAQTQVRHILIKTGPTMPADDARRQLAG 355

Query: 308 LRSN 311
           LR  
Sbjct: 356 LRDR 359



 Score =  114 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 23/178 (12%), Positives = 63/178 (35%), Gaps = 2/178 (1%)

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQK 200
                 VV        G   +++   + +   IT +    +     I           ++
Sbjct: 292 DLKPGQVVGQVIESPAGFHVLKLVDKRVQGTAITAKVAQTQVRHILIKTGPTMPADDARR 351

Query: 201 RIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTN 259
           ++    +  +      +   +++      + G+  ++    L P+F+  +        + 
Sbjct: 352 QLAGLRDRIVHGYDFGDAARRYSQDASASAGGELGWVSPGQLVPEFEQAMNLLKPGEVSQ 411

Query: 260 PYVTQKGVEYIAICDKRDLGGEIAL-KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           P  +Q GV  I +  +R+    +   + Y  +     KI+    +++++LR +A + Y
Sbjct: 412 PVQSQFGVHLIQVEGRREAEVPVDRQRDYARSAIREQKIQAAYEDWLRQLRDSAHVEY 469


>gi|118581987|ref|YP_903237.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pelobacter
           propionicus DSM 2379]
 gi|118504697|gb|ABL01180.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pelobacter
           propionicus DSM 2379]
          Length = 300

 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 41/315 (13%), Positives = 88/315 (27%), Gaps = 53/315 (16%)

Query: 14  KLLTTYFVLIIFCIVPIV-------SYKSWAMSSRIRTTINGEVITDGDISKRIA----L 62
            +  T  + +  C V +        S  +     ++   +NG+ IT GD S+ +      
Sbjct: 3   SITRTKCIAVALCSVALFACQGTPGSSTATKQEGQVLAEVNGKKITSGDFSREVKNLPEY 62

Query: 63  LKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSS 122
           L+      +  K  +  +++  L  Q+  K G+                           
Sbjct: 63  LRAMATTPQGRKEMLDTMVIRELILQKASKDGLDKGPEIE-------------------- 102

Query: 123 FLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRT 182
                        Q L  + I    +K          + ++     +  +       IR 
Sbjct: 103 ----------EKLQELKKRLIVEAFLKKKVETDAQISDADLKKFYDQNIDKFKAGEQIRA 152

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDL 242
                           +K  K+                K +        G   +  +  +
Sbjct: 153 SHIL---------VKTEKEAKEILAQLKGGAAFEELARKHSVDSSSAKGGDLGWFGKGAM 203

Query: 243 HPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLG--GEIALKAYLSAQNTPTKIEK 299
            P F+       +   ++   +  G   I +  KR  G      +K  + A   P+K ++
Sbjct: 204 VPAFERAALALKEGQVSDVVKSDFGFHIIKLTGKRPAGTRPFDEVKDQIKAALMPSKQQE 263

Query: 300 HEAEYVKKLRSNAII 314
              +   +L+ +A I
Sbjct: 264 IFQKIKDELKKSAKI 278


>gi|261250209|ref|ZP_05942785.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio orientalis CIP
           102891]
 gi|260939325|gb|EEX95311.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio orientalis CIP
           102891]
          Length = 432

 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 38/313 (12%), Positives = 107/313 (34%), Gaps = 12/313 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--- 69
           +K      + ++      +          +   +N  V+   DI   I  LK        
Sbjct: 1   MKFWKQTLLALMIASPINLVQAEPVALDTVAVIVNTSVVLQSDIDTSIKTLKANAKKKGQ 60

Query: 70  -----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +   ++LIV+T+++QE E+ G+  D N +N    + A+N   + E   + +
Sbjct: 61  SLPSEEILTEQVTEKLIVDTIQQQEAERLGVRIDDNRLNEAISEIAKNNQQTVEQLRASI 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
             +G+    F++ +  +    +        +   L  E+    + +   T      +   
Sbjct: 121 ASEGLNYAEFREQIRKEIAASEARNALVRRRINILPAEVDNLSELLAQETNATVQYKIGH 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             +  N   ++  ++ + K+  +              ++     +  G   ++ + ++  
Sbjct: 181 IQLRVNDGDDKSEIEAQAKELVKELNNGADFSTMAYTYSKGPKALQGGDWGWMRKEEMPT 240

Query: 245 QFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKH 300
            F + +K +++ +   P+ +  G   + I D +    +        ++  + T    ++ 
Sbjct: 241 IFADQIKLQNKGSVIGPFRSGVGFHILKIEDVKGLETVAVTEVNARHILIKPTVILSDEG 300

Query: 301 EAEYVKKLRSNAI 313
               +  +     
Sbjct: 301 VKNTLNNIIRQIK 313



 Score = 76.6 bits (186), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 16/112 (14%), Positives = 44/112 (39%), Gaps = 3/112 (2%)

Query: 207 ESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQ 264
           + +          ++++         G+  Y       P+F++ +        + P+ T 
Sbjct: 311 QIKAGDATFGELAQQYSQDPGSAAQNGELGYQTSDLYVPEFKHQIDTLPVGQISEPFKTV 370

Query: 265 KGVEYIAICDKRDLG-GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            G   + I D+R++   + ALK          K  +  + +++++R++A + 
Sbjct: 371 HGWHIVEILDRREVDRTDSALKNKAYRILFNRKFNEEASAWLQEIRASAYVE 422


>gi|329923149|ref|ZP_08278648.1| putative foldase protein PrsA [Paenibacillus sp. HGF5]
 gi|328941591|gb|EGG37877.1| putative foldase protein PrsA [Paenibacillus sp. HGF5]
          Length = 398

 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 42/303 (13%), Positives = 96/303 (31%), Gaps = 25/303 (8%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEK 74
           ++ +  +     +V IV   +    +     +N   IT  ++   +  +          K
Sbjct: 87  MIASLVLAAALIVVLIVPPFAKGSGNEAIAKVNDVNITKDNLYDELVSVGG--------K 138

Query: 75  IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF 134
             +  +I E L +QE++   IT     VN        +   S E F+  L + G+  ++ 
Sbjct: 139 QTLNSMITEELIQQELKNKSITVTDADVNKEVDALKASF-PSEEQFNMALQQNGMTLDNL 197

Query: 135 KQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQN 194
           K+    Q     ++      K      E+     + K        +R     +   +   
Sbjct: 198 KEQTKTQVELKKLM----ADKIKVTGEEVKEVYDQNKESFATPEQVRASHILVETKEEAE 253

Query: 195 QGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-S 253
                       +            ++        + G   +    ++ P F+    K  
Sbjct: 254 AI---------VKQLKEGADFATIAKEKNQDATKDTGGDLNFFGRGEMDPAFEEAAFKLK 304

Query: 254 QNNTTNPYVTQKGVEYIAICDKRDLGGE--IALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
           ++  + P  +  G   I + D+++         K  + +Q    K+      Y+++L+  
Sbjct: 305 KDEISEPVKSSFGYHIIKVTDRKEATNPTLEDKKEEIRSQLENQKVYAESTAYIQELKDK 364

Query: 312 AII 314
           A I
Sbjct: 365 ATI 367


>gi|116251332|ref|YP_767170.1| hypothetical protein RL1566 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115255980|emb|CAK07061.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 314

 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 78/285 (27%), Positives = 137/285 (48%), Gaps = 10/285 (3%)

Query: 40  SRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDS 99
           S ++  +NG  IT GD++KR A L+LQ    +  K A ++LI E LK+QE+ +  ++   
Sbjct: 31  SEVKAVVNGTAITSGDVAKRQAFLRLQHTKADA-KTAEEQLIDEALKRQEVARVRMSVSQ 89

Query: 100 NTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNL 159
             V+  F + +    LS E  S  LD+ G+G +HFK ++A+Q  WP VV   +       
Sbjct: 90  QDVDASFARFSSGNKLSPEQMSQILDRAGVGVDHFKGFIAVQMSWPRVVNARYGSTSRLS 149

Query: 160 EMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKL 219
             ++ +   +                     + +      KR  +AE SR + P   ++ 
Sbjct: 150 NYDLVSRMMQNNKQKPVTTEYMLQQIIFVIPQAKRGAITGKRKGEAEASRSKFPGC-DQA 208

Query: 220 EKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLG 279
           + FA+ + DVS+     LL  ++ P ++ L+++++ NTT   VT KGVEY+AIC +R + 
Sbjct: 209 KVFAATMRDVSVRDLGRLLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEYLAICSQRQVS 268

Query: 280 GEIALKAYLSAQNTPTKI--------EKHEAEYVKKLRSNAIIHY 316
            + A +     ++              ++  +Y+ +LR  A I Y
Sbjct: 269 DDQAAEMVFRQEDLDKSKAGKDASPENENSKKYLDELRKKAQIAY 313


>gi|304405097|ref|ZP_07386757.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Paenibacillus
           curdlanolyticus YK9]
 gi|304345976|gb|EFM11810.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Paenibacillus
           curdlanolyticus YK9]
          Length = 365

 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 47/321 (14%), Positives = 104/321 (32%), Gaps = 20/321 (6%)

Query: 2   TSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIA 61
             K  +S S  +  + +  +L+I  +V  +SY           ++NG  IT+  +   + 
Sbjct: 28  KEKPKSSGSGALGWVVSAALLVILILVATLSYAGDDKGEN-VASVNGVAITEKQLYDALL 86

Query: 62  LLKL--QKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAED 119
           L+K   Q    ++ ++ + +LI   L  QE++K G+      ++       +  GL  E 
Sbjct: 87  LIKGGGQNGQQKMSEVTLDDLINVELMNQELQKQGLVVAEADIDKELDALKKAYGLDDEK 146

Query: 120 FSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYL 179
               L +           L         ++     K    + +I     + K        
Sbjct: 147 LKQTLAQS----GMTVADLRPDLEKQAKLRKLLSSKATVTDKDIQDYYDQNKESFSTPEQ 202

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFA-SKIHDVSIGKAQYLL 238
           +R     +   +  +            +            ++ +       + G   Y  
Sbjct: 203 VRASHILVKTKEEADAI---------LKQLKDGADFATIAKEKSLDTGTKDAGGDLNYFG 253

Query: 239 ESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDL--GGEIALKAYLSAQNTPT 295
           +  + P F+    +     T+ P  +  G   I + D +          K  +      +
Sbjct: 254 KGQMDPAFEKAAFELKVGETSQPVQSAYGFHIIKVTDHKQAASPTFEEKKEDIKNILMMS 313

Query: 296 KIEKHEAEYVKKLRSNAIIHY 316
           KI +    ++++L+S A I  
Sbjct: 314 KINELAQPFIEELKSKAKIEN 334


>gi|23015619|ref|ZP_00055390.1| COG0760: Parvulin-like peptidyl-prolyl isomerase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 421

 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 43/276 (15%), Positives = 99/276 (35%), Gaps = 10/276 (3%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIAL-LKLQKING 70
            +         ++F  VP+ S+ S     RI   +N E+I+  D+  R+ L + +  +  
Sbjct: 1   MLARAAIVLNALLFACVPL-SWASAQDVDRIAAVVNDEIISIRDLDARLKLAITVSGLPD 59

Query: 71  ELEK------IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
            +E         +++++ E ++ QE  +  ++  +  V            +      + L
Sbjct: 60  NIESRRRAVPQVLRKMVDERIQAQEAARLKVSAGTEDVARGLANVENQNRMPPGSLLTSL 119

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
            K G+  +  K  +    IW  ++           E EI    + ++    +   +   +
Sbjct: 120 AKAGVDPDAVKDQIRADIIWVKLIMRSLQPTIKVGEDEITERLETIRQQFGQPEFMLAEI 179

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
           F   D+  Q     ++  +   E             +F+      + G   +L  S L  
Sbjct: 180 FLPVDSPRQE-EESKRLGERLIEQLRAGAPFQALARQFSQSGSASNGGVLGWLSPSTLED 238

Query: 245 QFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKRDLG 279
           + ++  +  ++   ++   T  G   +A+ DKR  G
Sbjct: 239 EVRDTVMSMNKGQVSSLIRTGSGYAILALIDKRVAG 274



 Score = 55.1 bits (130), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 29/276 (10%), Positives = 79/276 (28%), Gaps = 10/276 (3%)

Query: 44  TTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVN 103
             +  + IT+     R+  ++ Q    E     +   +    +++E ++ G         
Sbjct: 151 IKVGEDEITE-----RLETIRQQFGQPEFMLAEIFLPVDSPRQEEESKRLGERLIEQLRA 205

Query: 104 YFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEI 163
               Q        +   S+      +  +  +  +    +  +  K              
Sbjct: 206 GAPFQALARQFSQSGSASNGGVLGWLSPSTLEDEVRDTVMSMN--KGQVSSLIRTGSGYA 263

Query: 164 PANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFA 223
                  +           +        +        ++ +         K C +LE   
Sbjct: 264 ILALIDKRVAGETFVGDPLLSIVQVFFPIPPGAPPISQLIEKAAELTAPLKSCPELEDMG 323

Query: 224 SKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRD--LGG 280
            K++    G+   +  S +    ++L+     N  + P  T   +  + +C + +    G
Sbjct: 324 RKLNSEQSGRRDGVTLSVMPQNLRSLVTNLPINKASPPVSTGNALMVVMVCSRDENATKG 383

Query: 281 EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            +  +  +       ++E     Y++ LR  A I +
Sbjct: 384 GLPSRDAMRRMIEDERLELLSKRYLRDLRRAAFIDF 419


>gi|329903502|ref|ZP_08273518.1| Survival protein SurA precursor (Peptidyl-prolyl cis-trans
           isomerase SurA) [Oxalobacteraceae bacterium IMCC9480]
 gi|327548325|gb|EGF33013.1| Survival protein SurA precursor (Peptidyl-prolyl cis-trans
           isomerase SurA) [Oxalobacteraceae bacterium IMCC9480]
          Length = 475

 Score =  120 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 43/302 (14%), Positives = 99/302 (32%), Gaps = 24/302 (7%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVETL 85
               +   I   +N +VIT  D++ R+AL++ +             LEK  ++ +IV+  
Sbjct: 58  SEPQVIDSIVAVVNSDVITRLDLNSRVALVETRMKQQGSQLPQRALLEKQILERMIVDRA 117

Query: 86  KKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWP 145
           + Q    SGI  D   ++    + A    LS +DF + L+++G   + F++ +  +    
Sbjct: 118 QLQLAADSGIKIDDVMLDRAMARLAEQNKLSMQDFRNQLEREGTPFSRFREEIREEIAMQ 177

Query: 146 DVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDA 205
            + + +   K    E E+       KN    +         I   +      +  R   A
Sbjct: 178 RIREREVDNKLQITESEVDNYLDAEKNAPQIQPEYNLAQILIRIPENATAEQIAARRARA 237

Query: 206 EESRLR---LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPY 261
           ++   +             ++  I  +  G+  +     L   F   + + ++   +   
Sbjct: 238 DDVARQLRSGADFAKLAASYSDSIEALKGGELGWRTADRLPQLFVDAVARLNEGELSAVI 297

Query: 262 VTQKGVEYIAICDKRD------------LGGEIALKAYLSAQNTPTKIEKHEAEYVKKLR 309
            +  G   + +  KR                +     ++  +             +  L+
Sbjct: 298 KSASGFHILKVAGKRTRSADSSTASAAAPAVQQTRARHILIKVNTIVTAAEALRKLTDLK 357

Query: 310 SN 311
             
Sbjct: 358 QR 359



 Score =  102 bits (254), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 32/288 (11%), Positives = 80/288 (27%), Gaps = 18/288 (6%)

Query: 46  INGE-VITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           ++ +  IT+ ++   +   K          +A Q LI         + +     ++ V  
Sbjct: 184 VDNKLQITESEVDNYLDAEKNAPQIQPEYNLA-QILIRIPENATAEQIAARRARADDVAR 242

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFML---------- 154
                A    L+A    S    +G            Q     V + +             
Sbjct: 243 QLRSGADFAKLAASYSDSIEALKGGELGWRTADRLPQLFVDAVARLNEGELSAVIKSASG 302

Query: 155 ----KYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRL 210
               K          +          +      +    +  +     ++K     +    
Sbjct: 303 FHILKVAGKRTRSADSSTASAAAPAVQQTRARHILIKVNTIVTAAEALRKLTDLKQRLDN 362

Query: 211 RLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEY 269
           +        + +++ +     G   ++   D  P+F+  +        + P  T  G   
Sbjct: 363 KAATFEELAKLYSNDLSASKGGDLGWIYPGDTVPEFERAMNLLKPGEVSAPIETPFGYHL 422

Query: 270 IAICDKRDLGGEIALKA-YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           I + +++        K           K+E+   +++++LR  A + Y
Sbjct: 423 IEVIERKSQDVSQERKRLSARQALRERKLEEATQDWIRQLRDRAYVEY 470


>gi|21675072|ref|NP_663137.1| peptidyl-prolyl cis-trans isomerase SurA [Chlorobium tepidum TLS]
 gi|21648311|gb|AAM73479.1| peptidyl-prolyl cis-trans isomerase SurA [Chlorobium tepidum TLS]
          Length = 438

 Score =  120 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 101/310 (32%), Gaps = 15/310 (4%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN---- 69
           K+L      ++  +       +     RI   +  E+I   D++++  +L LQ       
Sbjct: 3   KVLFAVLAALMIAMNGFADAAASTGLDRIVAIVGNEIILASDVNEQELMLHLQYPETRKD 62

Query: 70  GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
            +L K  ++ +I + +   + +   +  D  +V+        +        S+   + G+
Sbjct: 63  PQLRKRILENMINQKIILTKAKIDTVKVDEKSVDDQAAARYSSLRAGFPSVSAMESRFGM 122

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFMLK-----YGNLEMEIPANKQKMKNITVREYLIRTVL 184
             N  KQ++        +++               E     N++K       E +  + +
Sbjct: 123 PVNRLKQHIREDIRDQQMIEAFRRKNFHEVTVSYDETMAFYNQEKGALPEAPETVSVSQI 182

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLESDLH 243
             +P      +     +IK  ++             +++         G   +  + +L 
Sbjct: 183 IKMPLVSEAARQAALDKIKAVQQQLEAGGSFATLAREYSDDPGSREKGGDLGFTRKGELV 242

Query: 244 PQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEK-HE 301
           P F+           +    T+ G   I + DK    G+     ++ A    +K +    
Sbjct: 243 PSFEEAASVLKPGQISGIVETRFGYHIIQLIDK---EGDRIHTRHILALFDRSKTDIPAT 299

Query: 302 AEYVKKLRSN 311
              +K +R +
Sbjct: 300 IALLKSIRKD 309



 Score = 37.0 bits (83), Expect = 4.2,   Method: Composition-based stats.
 Identities = 9/160 (5%), Positives = 37/160 (23%), Gaps = 20/160 (12%)

Query: 165 ANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFAS 224
            +  ++ +        R +L     +K      +       ++            +K++ 
Sbjct: 267 YHIIQLIDKEGDRIHTRHILALFDRSKTDIPATIALLKSIRKDVLSGKATFAEMAKKYSD 326

Query: 225 KIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-----------NNTTNP--YVTQKG---VE 268
                + G    +     +P  +    +              + + P    + K      
Sbjct: 327 DPASATNG--GLITSGSGNPDLEVATLRPDLRKIIDGLKSKGDISQPEKIESDKSAPFYA 384

Query: 269 YIAICDKRDLGGEIALKA--YLSAQNTPTKIEKHEAEYVK 306
              +  +              +       K ++    +++
Sbjct: 385 LFMLNSRTPAHVLTPEHDFAQIQELALNHKSQELFNAWIE 424


>gi|108810078|ref|YP_653994.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia pestis Antiqua]
 gi|167401555|ref|ZP_02307049.1| chaperone SurA [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|121956548|sp|Q1C0H3|SURA_YERPA RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|108781991|gb|ABG16049.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia pestis Antiqua]
 gi|167048937|gb|EDR60345.1| chaperone SurA [Yersinia pestis biovar Antiqua str. UG05-0454]
          Length = 434

 Score =  120 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 37/296 (12%), Positives = 102/296 (34%), Gaps = 16/296 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   I    ++ +     ++   ++  V+   DI   +  +K+              L
Sbjct: 7   LILGLVICANTAFAAPQEVDKVAAVVDNGVVLQSDIDGLLQSVKMNAQQSGLQVPDDSTL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ ++ Q  +K GIT     ++      A    ++     S L   G+  +
Sbjct: 67  RHQILERLIMDNIQLQMAKKMGITITDQALDKAIADIAAQNRMTLAQMRSRLAADGLSYD 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            +++ +  + +  +V  N+   +   L  E+ +  ++M N    +  +      IP  + 
Sbjct: 127 TYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQMGNQVSGDTELNLSHILIPLPEN 186

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQF-QN 248
             Q  V +    A +    +    +        ++    +  G+  +    +L   F + 
Sbjct: 187 PTQQQVDQAEDLANKLVADIKGGADFGKLAIANSADSQALKGGQMGWGKLQELPSLFAER 246

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKH 300
           L    +     P  +  G   + + D R     +        ++  + +P   ++ 
Sbjct: 247 LQSAHKGEIVGPIRSGVGFHILKVNDMRGADQTISVTEVNARHILLKPSPMMTDEQ 302



 Score = 80.9 bits (197), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/168 (13%), Positives = 54/168 (32%), Gaps = 4/168 (2%)

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
                G   +++   +   + I+V E   R +L          Q   +     AE    +
Sbjct: 259 IRSGVGFHILKVNDMRGADQTISVTEVNARHILLKPSPMMTDEQARAKLEAAAAEIKSGK 318

Query: 212 LPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEY 269
                   ++ +      +  G+  +       P F++  +K  +   + P  +  G   
Sbjct: 319 -TSFATIAKEISQDPGSAMQGGELGWASPDIYDPAFRDALMKLKKGEISAPVHSSFGWHL 377

Query: 270 IAICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           I + D R +   + A K          K  +    ++++ R+ A +  
Sbjct: 378 IQLVDTRQVDKTDAAQKERAYRMLFNRKFAEEAQTWMQEQRAAAYVKI 425


>gi|103486961|ref|YP_616522.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Sphingopyxis
           alaskensis RB2256]
 gi|98977038|gb|ABF53189.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Sphingopyxis
           alaskensis RB2256]
          Length = 446

 Score =  120 bits (299), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 49/257 (19%), Positives = 95/257 (36%), Gaps = 11/257 (4%)

Query: 44  TTINGEVITDGDISKRIALLKLQKIN--------GELEKIAVQELIVETLKKQEIEKSGI 95
            T+NGE+IT  DI +R+AL+++   N          L       LI E L+ QE   + I
Sbjct: 57  ATVNGEIITATDIEQRMALIRIANNNVELPPEEEQRLRNQVFSNLIDEKLQIQEARAADI 116

Query: 96  TFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLK 155
           T D N VN  F + A     + E F+++L  +G      KQ +  +  W  ++  +    
Sbjct: 117 TIDENVVNEQFARLAARFKQTPEQFAAYLASKGSSAAAVKQQIRGEFAWDRLLSRNIQST 176

Query: 156 YGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKD 215
                 E+    ++M+    ++      ++        N   V +  +   ++       
Sbjct: 177 TNVSTEEVDLIVKQMEAAKGQDEFHLGEIYLSATP--DNIAAVTENARKIIQALQAGGSF 234

Query: 216 CNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICD 274
                +F+     V  G   ++  + L     +  ++        P     G+  + + D
Sbjct: 235 AAYARQFSEASTAVVGGDLGWVKGAQLPASMAEAAMQMQPGQLVGPIEVPGGISIMLLID 294

Query: 275 KRDLGGEIALKAYLSAQ 291
           +R +       A LS +
Sbjct: 295 RRQVLTADPRDAILSLK 311



 Score = 55.5 bits (131), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 15/75 (20%), Positives = 28/75 (37%), Gaps = 2/75 (2%)

Query: 244 PQFQNLLKKSQNNTTNPYVTQK-GVEYIAICDKR-DLGGEIALKAYLSAQNTPTKIEKHE 301
           P    L+      TT P+     G+  + +C +             +  +    K+ K  
Sbjct: 371 PLQATLVDLQVGQTTQPFGAANEGISVLVLCGRDMPETATAPNLEQIEQKLLEEKVNKRA 430

Query: 302 AEYVKKLRSNAIIHY 316
             Y++ LR +A+I Y
Sbjct: 431 QRYLRDLRRDAVIEY 445


>gi|254476741|ref|ZP_05090127.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Ruegeria sp. R11]
 gi|214030984|gb|EEB71819.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Ruegeria sp. R11]
          Length = 283

 Score =  119 bits (298), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 42/304 (13%), Positives = 89/304 (29%), Gaps = 51/304 (16%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN---GEL 72
             +   L     +P+ +  +   +  I  T+NGE IT G +    A L  Q        L
Sbjct: 7   FLSGLALATALTLPLQATAAP-HADTIVATVNGEEITIGHMIIARATLPQQYQQLPDDVL 65

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               + +LI +T  K                                      +      
Sbjct: 66  FDAILDQLIQQTALK---------------------------------QQLNGEVPKYVE 92

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
              +  +   +  DV++          E+     +Q        E+    +L    ++  
Sbjct: 93  LSLENESRSLLAADVIEKVMENAATEEEVRAAYEEQYSDGNGGDEFNASHILVESEEDAE 152

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK 252
           + +  +++                    + ++     + G+  +  +  + P+F+  +  
Sbjct: 153 EIRAELEE-----------GADFATTARERSTGPSGPNGGELGWFTKGRMVPEFEEAVIA 201

Query: 253 -SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
            S    + P  TQ G   I + ++R         A +  Q      E+   E V+ L + 
Sbjct: 202 LSAGEISAPVQTQFGWHVIKLNERRKSAA--PEFAEIRDQLAAQIREEAVEESVRTLTTE 259

Query: 312 AIIH 315
           A I 
Sbjct: 260 AEIE 263


>gi|311696171|gb|ADP99044.1| survival protein surA [marine bacterium HP15]
          Length = 446

 Score =  119 bits (298), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 38/293 (12%), Positives = 105/293 (35%), Gaps = 20/293 (6%)

Query: 40  SRIRTTINGEVITDGDISKRIALLKLQK--------INGELEKIAVQELIVETLKKQEIE 91
            ++   ++ +VI   ++  RI  +  +             LE+  + +LI E+++ Q  +
Sbjct: 32  DQVVAIVDEDVILQTELEARINTITSRLGAQGTALPPRQVLEERVLDQLITESIQMQMAD 91

Query: 92  KSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
           ++G+    N +N      A   G+S   F + L+ +G+  N  ++ +  + +   V +  
Sbjct: 92  RAGMRISDNELNETMANIAERNGMSLPQFENQLEAEGVTYNQAREQIRKEMLTSRVQQRQ 151

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
              +    + E+    + ++         R     +  +   ++  V    + AE  R  
Sbjct: 152 VGNRVRVTDREVENYLESLEARGGNNAQYRLAYIFVSVDDPSDEAEVDAAREKAERLRSE 211

Query: 212 LPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGV 267
           +    +        +   + +  G   +  E  L      ++ +      ++      G 
Sbjct: 212 IANGRDFREVAVAESDASNALEGGDMGWRAEGQLPSLVAPVVPELPVGEPSDVLENNSGF 271

Query: 268 EYIAICDKRDLGGEIALKAY-LSAQN-------TPTKIEKHEAEYVKKLRSNA 312
             + + DKR    +  ++ + +           T ++ E    +  ++L++ A
Sbjct: 272 HLVMVMDKRGGEQQQMIQQHRVRHILVRPSEATTDSQAETVIRDLYQQLQNGA 324



 Score = 98.6 bits (243), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/285 (8%), Positives = 73/285 (25%), Gaps = 20/285 (7%)

Query: 46  INGEV-ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           +   V +TD ++   +  L+ +  N    ++A            +        D+     
Sbjct: 152 VGNRVRVTDREVENYLESLEARGGNNAQYRLA------YIFVSVDDPSDEAEVDAAREKA 205

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP 164
             ++     G    + +                   +   P +V             ++ 
Sbjct: 206 ERLRSEIANGRDFREVAVAESDASNALEGGDMGWRAEGQLPSLVAPVVPELPVGEPSDVL 265

Query: 165 ANKQKMK----------NITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
            N                        R     +  ++       +  I+D  +       
Sbjct: 266 ENNSGFHLVMVMDKRGGEQQQMIQQHRVRHILVRPSEATTDSQAETVIRDLYQQLQNGAS 325

Query: 215 DCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAI 272
                 +++         G   ++    + P F+  +          P+ +Q G   + +
Sbjct: 326 FSALAREYSDDPVSGSDGGNLGWVSPGQMVPAFEQAMLDADIGELRGPFRSQFGWHILQV 385

Query: 273 CDKRDLGGEIALKA-YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            ++R       ++           K E     +++++R  A + +
Sbjct: 386 QERRQKDISGDVRDAEARQAIYRRKFETELQNWLQEIRDEAFVEF 430


>gi|126664692|ref|ZP_01735676.1| Parvulin-like peptidyl-prolyl isomerase [Marinobacter sp. ELB17]
 gi|126631018|gb|EBA01632.1| Parvulin-like peptidyl-prolyl isomerase [Marinobacter sp. ELB17]
          Length = 481

 Score =  119 bits (298), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 43/297 (14%), Positives = 102/297 (34%), Gaps = 20/297 (6%)

Query: 37  AMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVETLKKQ 88
            +  ++   ++ +VI   ++  RI  +  +  + E        L++  + +LI E+++ Q
Sbjct: 60  QLLDQVVAIVDDDVILATELDARINSIVTRLQSQETTLPPRSLLQERVLDQLITESVQLQ 119

Query: 89  EIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVV 148
              K G+    N +N   V  A   G+S E F   L  +G+     ++ +  + +   V 
Sbjct: 120 MAGKMGMRISDNELNETMVSIAGRNGMSLEQFEQQLANEGVSYRDAREQIRNELLTSRVQ 179

Query: 149 KNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEES 208
           +     +    + E+   +Q  +         R     I      +   VQ     AE  
Sbjct: 180 QRQVGSRIRVTDREVENYQQAQQAGGGNTAEYRLAYIFIETEDPSSDASVQTARSKAEAL 239

Query: 209 RLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS-QNNTTNPYVTQ 264
           R ++ +  +        +   + +  G   + +ES L      ++        +      
Sbjct: 240 RQQIVEGRDFRAVAVAESDASNALEGGDMGWRVESQLPSLVAPVVPDLVVGQPSEVLQNS 299

Query: 265 KGVEYIAICDKR----DLGGEIALKAYLS----AQNTPTKIEKHEAEYVKKLRSNAI 313
            G   + + ++R        +     ++        T  + E    +  +KL++ A 
Sbjct: 300 SGFHLVMVMEQRGGEQQKLVQQNRVRHILVQPSDAITEAEAEDKVRDLFEKLQNGAD 356



 Score = 97.1 bits (239), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 15/157 (9%), Positives = 50/157 (31%), Gaps = 3/157 (1%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +   +Q+           R     +  +    +   + +++D  E            +  
Sbjct: 305 VMVMEQRGGEQQKLVQQNRVRHILVQPSDAITEAEAEDKVRDLFEKLQNGADFAELAKAE 364

Query: 223 ASKI-HDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG- 279
           +         G   ++    + P+F+  ++ +       P  +Q G   + + ++R    
Sbjct: 365 SDDTVSGSDGGNLGWVNPGQMVPEFEQAMQNATVGQIEGPVRSQFGWHLLQVQERRQKDM 424

Query: 280 GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            +   ++         K E     +++++R  A + +
Sbjct: 425 SDEFRESETRQTLYQRKFENELQNWLREIRDEAFVEF 461


>gi|124265396|ref|YP_001019400.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Methylibium
           petroleiphilum PM1]
 gi|124258171|gb|ABM93165.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Methylibium
           petroleiphilum PM1]
          Length = 437

 Score =  119 bits (298), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 39/300 (13%), Positives = 93/300 (31%), Gaps = 13/300 (4%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK--------LQKINGELEKIA 76
           F    +        +  I   ++ E++T+ ++ +R+A L+            + EL +  
Sbjct: 22  FVANAVAQPSPVRSADYIVAIVDRELVTNAEVQQRLAALRREAAQSGQALPPDDELRRRM 81

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           +  LI E  +     +SG+  D   ++      A    ++       L + GI  + F+ 
Sbjct: 82  LDTLIDERAQLSAARESGVRIDEAELDRTVGNVAAQNRITLAQLRERLQRDGIEFSRFRS 141

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQG 196
            L  Q +   V + +   +    + E+        +           L            
Sbjct: 142 NLRDQLLLERVREREVQSRIKISDSEVETLLASRASGVAPPQFNVAQLLIGVPEGAGEAE 201

Query: 197 FVQKRI-KDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQN 255
             Q+R+  +    R R  +D  +L    S       G         L   F + ++  + 
Sbjct: 202 LAQRRVLAEQALQRARGGEDFARLVNELSTGSKEQGGALGLRTLDRLPDLFADAVRDLRG 261

Query: 256 N--TTNPYVTQKGVEYIAICDKRDLG--GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
                    +  G   + + ++RD G         ++  + +    +      + + +  
Sbjct: 262 GAIVPQVLQSGAGFHVLKVVERRDGGMMVPQTRARHILLRTSAQLTQSAAVARLAEFKQQ 321



 Score = 97.4 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 17/122 (13%), Positives = 44/122 (36%), Gaps = 2/122 (1%)

Query: 196 GFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS-Q 254
             V +  +  ++             + +        G+  +       P+F+  +K    
Sbjct: 310 AAVARLAEFKQQVDSGKASFAQLARENSEDGSAAQGGELGWASPGQFVPEFEEAMKALGI 369

Query: 255 NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAI 313
           N  ++P V++ GV  I + ++R +  +   +  +        K E    E+ + +R+ A 
Sbjct: 370 NQVSDPVVSRFGVHLIQVLERRSVPVDRKQQREIARNVLREQKFESAYQEWARDVRARAY 429

Query: 314 IH 315
           + 
Sbjct: 430 VE 431


>gi|22127555|ref|NP_670978.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia pestis KIM 10]
 gi|45443417|ref|NP_994956.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51594986|ref|YP_069177.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia
           pseudotuberculosis IP 32953]
 gi|108810533|ref|YP_646300.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia pestis Nepal516]
 gi|145600395|ref|YP_001164471.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia pestis Pestoides
           F]
 gi|150260469|ref|ZP_01917197.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia pestis CA88-4125]
 gi|153949109|ref|YP_001402397.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia
           pseudotuberculosis IP 31758]
 gi|165928093|ref|ZP_02223925.1| chaperone SurA [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165937810|ref|ZP_02226371.1| chaperone SurA [Yersinia pestis biovar Orientalis str. IP275]
 gi|166008803|ref|ZP_02229701.1| chaperone SurA [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166212220|ref|ZP_02238255.1| chaperone SurA [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167422012|ref|ZP_02313765.1| chaperone SurA [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167426071|ref|ZP_02317824.1| chaperone SurA [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|167470553|ref|ZP_02335257.1| chaperone SurA [Yersinia pestis FV-1]
 gi|170025786|ref|YP_001722291.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia
           pseudotuberculosis YPIII]
 gi|186893987|ref|YP_001871099.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia
           pseudotuberculosis PB1/+]
 gi|218927692|ref|YP_002345567.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia pestis CO92]
 gi|229836923|ref|ZP_04457088.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Yersinia pestis
           Pestoides A]
 gi|229840382|ref|ZP_04460541.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229842462|ref|ZP_04462617.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229900721|ref|ZP_04515845.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Yersinia pestis
           Nepal516]
 gi|270487908|ref|ZP_06204982.1| PPIC-type PPIASE domain protein [Yersinia pestis KIM D27]
 gi|294502589|ref|YP_003566651.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia pestis Z176003]
 gi|81691900|sp|Q66EQ7|SURA_YERPS RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|121956556|sp|Q7CG87|SURA_YERPE RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|121956562|sp|Q1CMT0|SURA_YERPN RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|21960659|gb|AAM87229.1|AE013971_5 survival protein [Yersinia pestis KIM 10]
 gi|45438286|gb|AAS63833.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia pestis biovar Microtus str. 91001]
 gi|51588268|emb|CAH19875.1| peptidyl-prolyl cis-trans isomerase, survival protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|108774181|gb|ABG16700.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia pestis Nepal516]
 gi|115346303|emb|CAL19174.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia pestis CO92]
 gi|145212091|gb|ABP41498.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia pestis Pestoides F]
 gi|149289877|gb|EDM39954.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia pestis CA88-4125]
 gi|152960604|gb|ABS48065.1| chaperone SurA [Yersinia pseudotuberculosis IP 31758]
 gi|165914222|gb|EDR32838.1| chaperone SurA [Yersinia pestis biovar Orientalis str. IP275]
 gi|165919954|gb|EDR37255.1| chaperone SurA [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165992142|gb|EDR44443.1| chaperone SurA [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166206966|gb|EDR51446.1| chaperone SurA [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166960149|gb|EDR56170.1| chaperone SurA [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167054994|gb|EDR64794.1| chaperone SurA [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|169752320|gb|ACA69838.1| SurA domain [Yersinia pseudotuberculosis YPIII]
 gi|186697013|gb|ACC87642.1| SurA domain protein [Yersinia pseudotuberculosis PB1/+]
 gi|229682060|gb|EEO78152.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Yersinia pestis
           Nepal516]
 gi|229690772|gb|EEO82826.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229696748|gb|EEO86795.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229705866|gb|EEO91875.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Yersinia pestis
           Pestoides A]
 gi|262360619|gb|ACY57340.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia pestis D106004]
 gi|262364565|gb|ACY61122.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia pestis D182038]
 gi|270336412|gb|EFA47189.1| PPIC-type PPIASE domain protein [Yersinia pestis KIM D27]
 gi|294353048|gb|ADE63389.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia pestis Z176003]
 gi|320016865|gb|ADW00437.1| peptidyl-prolyl cis-trans isomerase C [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 434

 Score =  119 bits (298), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 37/296 (12%), Positives = 102/296 (34%), Gaps = 16/296 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--------EL 72
           +++   I    ++ +     ++   ++  V+   DI   +  +K+              L
Sbjct: 7   LILGLVICANTAFAAPQEVDKVAAVVDNGVVLQSDIDGLLQSVKMNAQQSGQQVPDDSTL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ ++ Q  +K GIT     ++      A    ++     S L   G+  +
Sbjct: 67  RHQILERLIMDNIQLQMAKKMGITITDQALDKAIADIAAQNRMTLAQMRSRLAADGLSYD 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            +++ +  + +  +V  N+   +   L  E+ +  ++M N    +  +      IP  + 
Sbjct: 127 TYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQMGNQVSGDTELNLSHILIPLPEN 186

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
             Q  V +    A +    +    +        ++    +  G+  +    +L   F   
Sbjct: 187 PTQQQVDQAEDLANKLVADIKGGADFGKLAIANSADSQALKGGQMGWGKLQELPSLFAER 246

Query: 250 LKKSQ-NNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKH 300
           L+ +       P  +  G   + + D R     +        ++  + +P   ++ 
Sbjct: 247 LQSAHKGEIVGPIRSGVGFHILKVNDMRGADQTISVTEVNARHILLKPSPMMTDEQ 302



 Score = 80.5 bits (196), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/168 (13%), Positives = 54/168 (32%), Gaps = 4/168 (2%)

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
                G   +++   +   + I+V E   R +L          Q   +     AE    +
Sbjct: 259 IRSGVGFHILKVNDMRGADQTISVTEVNARHILLKPSPMMTDEQARAKLEAAAAEIKSGK 318

Query: 212 LPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEY 269
                   ++ +      +  G+  +       P F++  +K  +   + P  +  G   
Sbjct: 319 -TSFATIAKEISQDPGSAMQGGELGWASPDIYDPAFRDALMKLKKGEISAPVHSSFGWHL 377

Query: 270 IAICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           I + D R +   + A K          K  +    ++++ R+ A +  
Sbjct: 378 IQLVDTRQVDKTDAAQKERAYRMLFNRKFAEEAQTWMQEQRAAAYVKI 425


>gi|330863030|emb|CBX73162.1| chaperone surA [Yersinia enterocolitica W22703]
          Length = 424

 Score =  119 bits (298), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 37/292 (12%), Positives = 103/292 (35%), Gaps = 16/292 (5%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--------ELEKIA 76
             +    ++ +     ++   ++  V+   D+   +  +KL              L    
Sbjct: 1   MVVCANTAFAAPQEVDKVAAVVDNGVVLQSDVDGLLQSVKLNAQQAGQQVPDDATLRHQI 60

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           ++ LI++ ++ Q  +K GIT     ++      A    ++     S L   G+  + +++
Sbjct: 61  LERLIMDNIQLQMAKKMGITISDEALDKAIADIAAQNRMTPAQMRSRLAADGLNYDTYRE 120

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQG 196
            +  + +  +V  N+   +   L  E+ +  +++ N T  +  +      IP  +  +Q 
Sbjct: 121 QIRKEMLTSEVRNNEVRRRITILPQEVESLAKQIGNQTSGDAELNLSHILIPLPENPSQQ 180

Query: 197 FVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKK 252
            V +    A++    +    +        ++    +  G+  +    +L   F + L   
Sbjct: 181 QVDQAEDLAKKLVSDIKGGADFGKLAIANSADSQALKGGQMGWGKLQELPSLFAERLQSA 240

Query: 253 SQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKH 300
           S+ +   P  +  G   + + D R     +        ++  + +P   +  
Sbjct: 241 SKGDVVGPIRSGVGFHILKVNDIRGTDKTISVTEVHARHILLKPSPVMTDDQ 292



 Score = 82.0 bits (200), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/168 (13%), Positives = 54/168 (32%), Gaps = 4/168 (2%)

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
                G   +++   +   K I+V E   R +L         +Q   +     A+    +
Sbjct: 249 IRSGVGFHILKVNDIRGTDKTISVTEVHARHILLKPSPVMTDDQARAKLTAAAADIKSGK 308

Query: 212 LPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEY 269
                   ++ +      +  G   +       P F++  +K  +   + P  +  G   
Sbjct: 309 ANF-ATIAKEISQDPGSAMQGGDLGWASPDIYDPAFRDALMKLQKGEISAPVHSSFGWHL 367

Query: 270 IAICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           I + D R +   + A K          K  +    ++++ R+ A +  
Sbjct: 368 IQVVDTRQVDKTDAAQKDRAYRMLFSRKFAEEAQTWMQEQRAAAYVKI 415


>gi|315500015|ref|YP_004088818.1| ppic-type peptidyl-prolyl cis-trans isomerase [Asticcacaulis
           excentricus CB 48]
 gi|315418027|gb|ADU14667.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Asticcacaulis
           excentricus CB 48]
          Length = 423

 Score =  119 bits (298), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 39/263 (14%), Positives = 105/263 (39%), Gaps = 8/263 (3%)

Query: 31  VSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL-------QKINGELEKIAVQELIVE 83
            + ++  +   +   +N ++I+  D+ +R+ LL +       Q+     ++ A++ LI E
Sbjct: 32  PAAQARPLGEGVVALVNDKLISSYDLKQRMLLLIITSGVQVTQQNYAAFQQQALRALIDE 91

Query: 84  TLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSI 143
            L+  E +   +      ++      A+ +GLS +   + L + GI     +  +  +  
Sbjct: 92  HLQLAEADHFKLNVSDEEIDEEIANMAQQSGLSKDQLLAELKRAGIEAQTLRDQIKAEIA 151

Query: 144 WPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIK 203
           W  +V   F  K    + ++ A   K+   + +   +   +   P+     +       +
Sbjct: 152 WGQLVNGRFRPKARVGKDQVDAFMTKLTEDSQKPQYLVAEILIDPEVAGGQKEAEAGAQQ 211

Query: 204 DAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYV 262
             ++    +    +   +F++     + G A +L+   + P+ + +    +    T P V
Sbjct: 212 LFDQIAQGVAPFQSVARQFSNAPSAANGGDAGWLVSGTIDPKIETVLKGMNPGQMTRPIV 271

Query: 263 TQKGVEYIAICDKRDLGGEIALK 285
           T +GV    + +K++   +  ++
Sbjct: 272 TDEGVYIYYLREKKEGKADAKVR 294



 Score = 63.2 bits (151), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 19/107 (17%), Positives = 37/107 (34%), Gaps = 1/107 (0%)

Query: 210 LRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVE 268
            R                 VS+    +   SDL P++ +         +T P      + 
Sbjct: 315 FRAKYPTCDALNNEKGNGQVSVADLGFTALSDLKPEYASALQPLKVGQSTEPMKNTMNIN 374

Query: 269 YIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            + +CDK   G ++  +  +  + T  K+      Y++ +R  A I 
Sbjct: 375 VVYVCDKTAAGDDVPSREQVEQRLTQQKVAMLGRRYLRDIRDGATIE 421


>gi|162420091|ref|YP_001605345.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia pestis Angola]
 gi|162352906|gb|ABX86854.1| chaperone SurA [Yersinia pestis Angola]
          Length = 434

 Score =  119 bits (298), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 37/296 (12%), Positives = 102/296 (34%), Gaps = 16/296 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--------EL 72
           +++   I    ++ +     ++   ++  V+   DI   +  +K+              L
Sbjct: 7   LILGLVICANTAFAAPQEVDKVAAVVDNGVVLQSDIDGLLQSVKMNAQQSGQQVPDDSTL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ ++ Q  +K GIT     ++      A    ++     S L   G+  +
Sbjct: 67  RHQILERLIMDNIQLQMAKKMGITITDQALDKAIADIAAQNRMTLAQMRSRLAADGLSYD 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            +++ +  + +  +V  N+   +   L  E+ +  ++M N    +  +      IP  + 
Sbjct: 127 TYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQMGNQVSGDTELNLSHILIPLPEN 186

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNK---LEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
             Q  V +    A +    +    +        ++    +  G+  +    +L   F   
Sbjct: 187 PTQQQVDQAEDLANKLVADIKGGADFGKLAIANSADSQALKGGQMGWGKLQELPSLFAER 246

Query: 250 LKKSQ-NNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKH 300
           L+ +       P  +  G   + + D R     +        ++  + +P   ++ 
Sbjct: 247 LQSAHKGEIVGPIRSGVGFHILKVNDMRGADQTISVTEVNARHILLKPSPMMTDEQ 302



 Score = 80.5 bits (196), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/168 (13%), Positives = 54/168 (32%), Gaps = 4/168 (2%)

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
                G   +++   +   + I+V E   R +L          Q   +     AE    +
Sbjct: 259 IRSGVGFHILKVNDMRGADQTISVTEVNARHILLKPSPMMTDEQARAKLEAAAAEIKSGK 318

Query: 212 LPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEY 269
                   ++ +      +  G+  +       P F++  +K  +   + P  +  G   
Sbjct: 319 -TNFATIAKEISQDPGSAMQGGELGWASPDIYDPAFRDALMKLKKGEISAPVHSSFGWHL 377

Query: 270 IAICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           I + D R +   + A K          K  +    ++++ R+ A +  
Sbjct: 378 IQLVDTRQVDKTDAAQKERAYRMLFNRKFAEEAQTWMQEQRAAAYVKI 425


>gi|51246936|ref|YP_066820.1| hypothetical protein DP3084 [Desulfotalea psychrophila LSv54]
 gi|50877973|emb|CAG37813.1| hypothetical protein DP3084 [Desulfotalea psychrophila LSv54]
          Length = 333

 Score =  119 bits (298), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 53/333 (15%), Positives = 118/333 (35%), Gaps = 21/333 (6%)

Query: 2   TSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIA 61
              +   L  F+ L T+Y  L     + ++S     +  ++   +N EVIT  +++   A
Sbjct: 1   MHNLPKLLKKFMSLRTSY--LSCIFTLILLSPLQAQVIDKVVAVVNNEVITLSELNAETA 58

Query: 62  LLK-----------LQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
            +K            ++   E  + A+  +I + L  Q+ +++ +      V        
Sbjct: 59  EIKHKITETAPADQQEEAMAEAREGALNSIIDKKLIAQKAKEARVFVSDEEVEGTIAGIQ 118

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
           +   LS E F   L K G+  N ++  +  Q +   V+  D   K    E +I    +K 
Sbjct: 119 KRASLSREQFIEELKKSGLSFNTYQNNIRSQLLQRKVINYDIRSKIVIPESQIREYYEKE 178

Query: 171 KNITVREYLIRTVLFSIPDNKLQ--NQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHD 228
             I  ++     +      +K +  ++    +  K      ++        EK+++    
Sbjct: 179 YTINAQDGEYYLLQIGFDWDKEEAGSKEKTLQFAKRIHAIAVKGQDFGALAEKYSTLPSA 238

Query: 229 VSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRD-----LGGEI 282
              G   +    D+       +        +N   +  G ++  +               
Sbjct: 239 KDRGDIGFFAIDDMSENMARAISPLKPGEVSNIIESPAGYQFFKVLSGDQNNSISKAPYA 298

Query: 283 ALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            +K  + A+    +++K  + +VK+L+ NA I 
Sbjct: 299 TVKEVIQAKLFEIQMQKDFSSWVKELKENAYIQ 331


>gi|256828792|ref|YP_003157520.1| SurA domain-containing protein [Desulfomicrobium baculatum DSM
           4028]
 gi|256577968|gb|ACU89104.1| SurA domain protein [Desulfomicrobium baculatum DSM 4028]
          Length = 305

 Score =  119 bits (297), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 54/305 (17%), Positives = 111/305 (36%), Gaps = 18/305 (5%)

Query: 19  YFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEK---- 74
             +      V     ++  +  RI   +NGE+IT  D+ ++I L   Q  +    +    
Sbjct: 8   AVLTFSLFFVLAGLGQAAQLVDRIVAVVNGEIITFQDLQQQIRLSVGQTPDPATAEKIAP 67

Query: 75  IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF 134
             +  +I + + +QE ++  I    + V+    Q      LS EDF   L  QG+    F
Sbjct: 68  QVLDGMIDDVILRQEAQRLKIEVSDSEVDNEIRQFKARRRLSEEDFERTLRLQGLTPEQF 127

Query: 135 KQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQN 194
           K+          ++      K    + EI A  ++ ++    E ++   +  + D     
Sbjct: 128 KERSREDITKHKMLGYMVRRKVVVTQEEIDAYMEQNRSELTTERIVDVQMLVLVDE---- 183

Query: 195 QGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI--GKAQYLLESDLHPQFQNLLKK 252
               ++     +            +E+++      +       +   ++  P    L   
Sbjct: 184 ----ERANSLWKSLSEGEVSLEEAVERYSIGPKAENGVMRDVSWRELAE--PWRDGLRNL 237

Query: 253 SQNNTTNPYVTQKGVEYIAICDKRDL--GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRS 310
           S    + P++ Q     + + D+RD     + A++  +       K+E+   EY+  LRS
Sbjct: 238 SAGELSKPFLVQDKWVILKLLDRRDGVRQEDAAVEEEVREAIMRPKLEERFKEYMNGLRS 297

Query: 311 NAIIH 315
            AII 
Sbjct: 298 KAIIQ 302


>gi|145636275|ref|ZP_01791944.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittHH]
 gi|145270440|gb|EDK10374.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittHH]
          Length = 290

 Score =  119 bits (297), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 52/294 (17%), Positives = 105/294 (35%), Gaps = 19/294 (6%)

Query: 36  WAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGI 95
                R+  T++G  + +  +       +         + A+ ++I + L ++ +++SG+
Sbjct: 2   AQAEERVVATVDGIPVLESQV-------RANMGKKGDRQSAIDKIIDDILVQKAVQESGV 54

Query: 96  TFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLK 155
             D   +++     A   GL+   F   LD QGI  N F+Q +A Q +   V        
Sbjct: 55  KIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNTFRQQIANQMVMGAVRNKAIQES 114

Query: 156 YGNLEMEI----------PANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDA 205
                 E+             K   + +  +EY +R +L  +       Q   Q     +
Sbjct: 115 IDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHILLKLNPLLNDAQAKKQLAKIRS 174

Query: 206 EESRLRLPKDCNKLEKFASKIHDVSIGKAQY-LLESDLHPQFQNLLKKSQNNTTNPYVTQ 264
           +    +       L+     +   + G   Y   E+      Q ++K  Q   + P+ T+
Sbjct: 175 DIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPETYAPQFAQTVVKSKQGVISAPFKTE 234

Query: 265 KGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKHEAEYVKKLRSNAIIHYY 317
            G   + +   RD              +   T+++    ++VK LR  A I Y+
Sbjct: 235 FGWHILEVTGVRDGDLTAEAYTQKAYERLVNTQLQDATNDWVKALRKRANIQYF 288


>gi|226942107|ref|YP_002797181.1| SurA [Laribacter hongkongensis HLHK9]
 gi|226717034|gb|ACO76172.1| SurA [Laribacter hongkongensis HLHK9]
          Length = 434

 Score =  119 bits (297), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 47/286 (16%), Positives = 102/286 (35%), Gaps = 14/286 (4%)

Query: 40  SRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVETLKKQEIE 91
            RI   +N + IT   +  R+   + Q    +        L++  ++ +I E ++ Q   
Sbjct: 34  DRIVAVVNKQAITQQALDTRVREAEAQLTRQKVPLPPAGVLQQQMLERMINEEVQLQYAG 93

Query: 92  KSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
            +GI  DS  ++    + A    L+ E F + L   GI +  F+  L+ Q I   + + +
Sbjct: 94  NNGIALDSAELDRIMDRLAEQNRLTPEQFRARLKADGINEAAFRADLSRQVILDRLRERE 153

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTV-LFSIPDNKLQNQGFVQKRIKDAEESRL 210
              K    + E+ A  +   +    E+ +  + +        Q     Q+R  DA     
Sbjct: 154 VDSKVNVSDSEVDAVLRSAVSANRTEFRLSHILITLPEQASPQEVAKRQQRASDAAAKLA 213

Query: 211 RLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEY 269
                      ++     +S G   +   + L P F   L +     +T    +  G+  
Sbjct: 214 AGAPFAQVAASYSDAQDALSGGDLGWRSATRLPPVFVAALEQLKPGQSTQVLRSANGLHI 273

Query: 270 IAICDKRDLGGEIALK----AYLSAQNTPTKIEKHEAEYVKKLRSN 311
           + +  +R  G    ++     ++  +      +K     + ++R  
Sbjct: 274 LKLEARRSRGDAQMVEQRQVRHILVRANEITSDKDAQTRILQIRDR 319



 Score =  102 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/280 (10%), Positives = 82/280 (29%), Gaps = 19/280 (6%)

Query: 45  TINGEVITDGDISKRIALLKLQKING--------ELEKIAVQELIVETLKKQEIEKSGIT 96
            +N   ++D ++   +                   L + A  + + +  ++     + + 
Sbjct: 157 KVN---VSDSEVDAVLRSAVSANRTEFRLSHILITLPEQASPQEVAKRQQRASDAAAKLA 213

Query: 97  FDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKY 156
             +               LS  D       +                   V+++   L  
Sbjct: 214 AGAPFAQVAASYSDAQDALSGGDLGWRSATRLPPVFVAALEQLKPGQSTQVLRSANGLHI 273

Query: 157 GNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDC 216
                 +    ++ +         +     +  N++ +    Q RI    +         
Sbjct: 274 ------LKLEARRSRGDAQMVEQRQVRHILVRANEITSDKDAQTRILQIRDRIANGMPFA 327

Query: 217 NKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDK 275
              + ++        G   ++   D+ P+F+           + P  +  G   I +   
Sbjct: 328 EAAKLYSEDGSAPKGGDLGWVNPGDMVPEFERAYLALPVGQLSQPVRSPFGWHLILVDGT 387

Query: 276 RDLG-GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
           R    G+   +A +  +    K E+  AE++++LR++A +
Sbjct: 388 RQQDIGDARQRAEIRQELRARKSEQVYAEWLQQLRASAYV 427


>gi|241662025|ref|YP_002980385.1| SurA domain-containing protein [Ralstonia pickettii 12D]
 gi|240864052|gb|ACS61713.1| SurA domain protein [Ralstonia pickettii 12D]
          Length = 500

 Score =  119 bits (297), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 42/304 (13%), Positives = 91/304 (29%), Gaps = 21/304 (6%)

Query: 29  PIVSYKSWAMSSRIRTTINGEVITDGDISKRI----ALLKLQKINGELEK----IAVQEL 80
                    +   +   +N +VIT  ++  R        + Q              +++L
Sbjct: 81  TAPGAPRSQLVDEVVAVVNTDVITRRELLNRADLVERTFRAQNRPLPPRADLLGEVLEQL 140

Query: 81  IVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAI 140
           I+E ++ Q  ++SGI      V+      A+   LS     S L   G+  + ++  L  
Sbjct: 141 ILERVQAQTAKESGIRVSDADVDRAVESVAQRNNLSVPQLKSKLKDAGMTYDKYRDDLRQ 200

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKM-----KNITVREYLIRTVLFSIPDNKLQNQ 195
           + +   + + +   K    + EI     +           +  + + ++          +
Sbjct: 201 EILLARLREREVDSKVQVYDGEIDNYLAQQGGGTAPAGEQQYNVAQILVPVAEGATDAEK 260

Query: 196 GFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQ 254
              +K+ +   +               +        G+        L   F N ++    
Sbjct: 261 AAARKKAEGLLKQAQGGADFAKLARDNSGAQDAAQGGELGLRPIGRLPAVFANAVVDMKA 320

Query: 255 NNT-TNPYVTQKGVEYIAICDKRDLGGEIALK------AYLSAQNTPTKIEKHEAEYVKK 307
               +    +  G   I + DKR  G  IA K       ++  +  PT         +  
Sbjct: 321 GQVASQVVESPAGYHVIKLLDKRAPGTAIAAKVQQTQVRHILIKTGPTMSADDARRQLVG 380

Query: 308 LRSN 311
           LR  
Sbjct: 381 LRDR 384



 Score =  112 bits (280), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 20/178 (11%), Positives = 62/178 (34%), Gaps = 2/178 (1%)

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQK 200
                 V         G   +++   +     I  +    +     I      +    ++
Sbjct: 317 DMKAGQVASQVVESPAGYHVIKLLDKRAPGTAIAAKVQQTQVRHILIKTGPTMSADDARR 376

Query: 201 RIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTN 259
           ++    +  +      +   +++      + G+  ++    L P+F+  + +    + + 
Sbjct: 377 QLVGLRDRIVHGYDFGDAARRYSQDGSAGAGGELGWVSPGQLVPEFEQAMNQLKPGDVSQ 436

Query: 260 PYVTQKGVEYIAICDKRDLGGE-IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           P  +Q GV  I +  +R+        + Y  +     K++    +++++LR +A + Y
Sbjct: 437 PVQSQFGVHLIQVEGRREAEVSGDRQRDYARSVIREQKVQAAYEDWLRELRDSAHVEY 494


>gi|59710895|ref|YP_203671.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Vibrio fischeri
           ES114]
 gi|75507097|sp|Q5E863|SURA_VIBF1 RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|59478996|gb|AAW84783.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Vibrio fischeri
           ES114]
          Length = 437

 Score =  119 bits (297), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 37/295 (12%), Positives = 100/295 (33%), Gaps = 15/295 (5%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVETL 85
            +     R+   ++  V+   DI   +  +K+              L +  +++LIV+T+
Sbjct: 22  AAPVELDRVVAIVDEGVVLQSDIDTSLKTVKINAQEKGQPLPDEAVLREQVLEKLIVDTI 81

Query: 86  KKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWP 145
           + Q+ EK GI  D   +       A+   ++          QG+   +F++ +  +    
Sbjct: 82  QSQQAEKMGIRIDDTRLEAALNDIAKENNMTLAQLQQKTAAQGLPYANFREQIRKEIAAS 141

Query: 146 DVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDA 205
           +        +   L  E+ +  Q +   T      +     +       Q   +   K A
Sbjct: 142 EARNAQVRRRINILPQEVESLAQLLAEETQATVQYKISHIQLRVEDGATQADKEALEKQA 201

Query: 206 EESRLRLPKDCNKLE---KFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS-QNNTTNPY 261
           E+   RL +  +       ++     +  G   ++ + ++   F + +    +N+   P+
Sbjct: 202 EDLTERLKQGADFATMAYTYSKGPKALQGGDWGWMRKEEMPTIFADQITGQGKNSIIGPF 261

Query: 262 VTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAI 313
            +  G   + I D +    +        ++  + +    ++     +  +  +  
Sbjct: 262 RSGVGFHILKIDDVKGLETVAVTEVNARHILIKTSVIMSDEGAQRLLNTIIDDIK 316



 Score = 75.9 bits (184), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 31/275 (11%), Positives = 84/275 (30%), Gaps = 11/275 (4%)

Query: 51  ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA 110
           I   ++     LL  +       KI+  +L VE    Q  +K  +   +  +     Q A
Sbjct: 154 ILPQEVESLAQLLAEETQATVQYKISHIQLRVEDGATQA-DKEALEKQAEDLTERLKQGA 212

Query: 111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM 170
               ++          QG      ++          +         G     +  +  K+
Sbjct: 213 DFATMAYTYSKGPKALQGGDWGWMRKEEMPTIFADQITGQGKNSIIGPFRSGVGFHILKI 272

Query: 171 KNITV------REYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFAS 224
            ++         E   R +L                     ++ +       +  ++++ 
Sbjct: 273 DDVKGLETVAVTEVNARHILIKTSVIMSDEGAQR-LLNTIIDDIKSGKETFADMAQRYSQ 331

Query: 225 KI-HDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GE 281
                 + G+  +       P+F++ ++       + P+ T  G     + ++R +   +
Sbjct: 332 DPGSAANDGELGFQTPDLYVPEFKHQVETLPVGQISAPFKTVHGWHIAEVLERRQVDRTD 391

Query: 282 IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            A+K          K  +    +++++R++A +  
Sbjct: 392 AAMKNKAYRILLNRKFNEEAGAWLQEIRASAYVEI 426


>gi|237746912|ref|ZP_04577392.1| chaperone SurA [Oxalobacter formigenes HOxBLS]
 gi|229378263|gb|EEO28354.1| chaperone SurA [Oxalobacter formigenes HOxBLS]
          Length = 468

 Score =  119 bits (297), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 34/292 (11%), Positives = 96/292 (32%), Gaps = 25/292 (8%)

Query: 47  NGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVETLKKQEIEKSGITFD 98
           N +VIT G++++RI +++ Q             L+K  ++ +IVE+ + Q  ++ G+  D
Sbjct: 59  NNDVITMGELNERIQMIESQLQKQNVNLPPRAELQKQVLEHMIVESAQMQLAKEMGLRID 118

Query: 99  SNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGN 158
              ++    + A +  ++   F  ++++ G      ++ +  +     +   + + K   
Sbjct: 119 DTQLDRTIARIAESKHMTVPQFQQYIERDGTSFESHREKIRSEITMQRLRDREVVNKIQI 178

Query: 159 LEMEIPAN--KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDC 216
            + E+           +  +  L   ++    +   +     ++R +   +         
Sbjct: 179 NDAEVDHLLGADSQMQMPEQVRLGHILIRIPENASPEQIAEKRERAEKVLQILQSGGDFQ 238

Query: 217 NKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICDK 275
                ++     +S G   +     L   F +  +     N T    +  G   + + DK
Sbjct: 239 QNAASYSDADEGLSGGDIGWRSTDRLPKIFADALVGVKPGNITGIIKSPNGFHILKVLDK 298

Query: 276 RDLG--------------GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAI 313
           R +                +     ++  +             +  L+    
Sbjct: 299 RSMSTGPEPVAGAADGNAVQQIHARHILIKVNQLVSADEAKRKLLDLKQRIQ 350



 Score = 97.1 bits (239), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 21/139 (15%), Positives = 46/139 (33%), Gaps = 2/139 (1%)

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLE 239
               +    +  +      +K +   +  +          + +++       G   ++  
Sbjct: 321 HARHILIKVNQLVSADEAKRKLLDLKQRIQNDSASFEELAKTYSNDTSASRGGDLGWIYP 380

Query: 240 SDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKI 297
            D  P+F+  L        + P  TQ G   I + DK+     +  K           KI
Sbjct: 381 GDTVPEFEKALVSLQPGEISEPVETQFGFHLIQVLDKKTDDVSLERKRIAAKQALRERKI 440

Query: 298 EKHEAEYVKKLRSNAIIHY 316
            +   E++++LR  A + Y
Sbjct: 441 AEATEEWLRQLRDRAYVEY 459


>gi|264680840|ref|YP_003280750.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Comamonas
           testosteroni CNB-2]
 gi|262211356|gb|ACY35454.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Comamonas
           testosteroni CNB-2]
          Length = 475

 Score =  119 bits (297), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 48/298 (16%), Positives = 99/298 (33%), Gaps = 18/298 (6%)

Query: 32  SYKSWAMSSRIRTTINGEVITDGDISKRIALLKL--------QKINGELEKIAVQELIVE 83
           + +    +  I   +N E IT+ ++  R+  +               EL +  ++ LIVE
Sbjct: 62  AAQGVRSADYIVAVVNSEPITNNEVRARMERVAQNVTEQGGQLPSQSELARQVLERLIVE 121

Query: 84  TLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSI 143
            ++ QE + +GI  D+ TV+      AR          S L  +GI +  F+  +  Q +
Sbjct: 122 RVQLQEAKDTGINIDNMTVDQAVANVARQNNTDKAGLVSRLKAEGISEAQFRSEIRNQML 181

Query: 144 WPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI-----RTVLFSIPDNKLQNQGFV 198
              V + D   +    E +I    +  K                ++    +         
Sbjct: 182 MQRVRERDVDGRVKVGEADIDRYLKDQKRPGDAAAGAAANLGHILITVPENASPAVVAER 241

Query: 199 QKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNT 257
           + + K A E+  + P     + +F+   +    G       SD    F Q +   +    
Sbjct: 242 EAKAKQAAEAARKNPDFIAAVREFSDVPNGQGGGAMGMRPMSDYPELFSQQVGNSAVGAI 301

Query: 258 TNPYVTQKGVEYIAICDKRDLGG----EIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
             P+ +  G   + + +K   G           ++         E   A+ ++  +  
Sbjct: 302 VGPFRSGAGFHVLKVLEKSQAGAPVYITQNHARHILLTVGDGMTEAQAAKRLEDYKRR 359



 Score = 99.7 bits (246), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 25/167 (14%), Positives = 58/167 (34%), Gaps = 3/167 (1%)

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
           F    G   +++    Q    + + +   R +L ++ D   + Q   +           +
Sbjct: 305 FRSGAGFHVLKVLEKSQAGAPVYITQNHARHILLTVGDGMTEAQAAKRLEDYKRRVEAGQ 364

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYI 270
                   ++F+      + G   +       P+F+ +         +NP V++ GV  I
Sbjct: 365 ATFQ-QLAQEFSKDGSARNGGDLGWSSPGQFVPEFERVLDNLQPGQISNPVVSRFGVHLI 423

Query: 271 AICDKRDLGGEIALKAY-LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            + ++R        +   +       K E+    ++K+LR  A + Y
Sbjct: 424 QLIERRQEKLTEREQREMVRNVVRERKAEQDYETWLKELRGKAFVEY 470


>gi|300705125|ref|YP_003746728.1| peptidyl-prolyl cis-trans isomerase (ppiase), involved in
           maturation of outer membrane proteins [Ralstonia
           solanacearum CFBP2957]
 gi|299072789|emb|CBJ44144.1| peptidyl-prolyl cis-trans isomerase (PPIase), involved in
           maturation of outer membrane proteins [Ralstonia
           solanacearum CFBP2957]
          Length = 474

 Score =  119 bits (297), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 45/303 (14%), Positives = 92/303 (30%), Gaps = 20/303 (6%)

Query: 29  PIVSYKSWAMSSRIRTTINGEVITDGDISKRI----ALLKLQKINGELEK----IAVQEL 80
                    +   +   +N ++IT  ++  R       L+ Q              +++L
Sbjct: 56  TASGAARSQLVDEVVAVVNTDIITRRELLDRADLVERTLQAQNRPMPARADLLGEVLEQL 115

Query: 81  IVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAI 140
           I+E ++ Q  ++SGI      V+      A+   LS     S L + G+  + +++ L  
Sbjct: 116 ILERVQAQTAKESGIRVSDADVDRAVESVAQRNNLSVPQLKSKLVQSGLAYDKYREDLRQ 175

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPAN-KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQ 199
           + +   +   +   K    + EI     Q+    T            +P  +  +     
Sbjct: 176 EILLARLRDREVDSKVQVFDGEIDNFLAQQGGGATGEAQEYNVAQILVPVAEDASAEQKA 235

Query: 200 KRIKDAEESRLRLPKDCNKLE---KFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQN 255
                AE    +     +  +     +S       G+        L  QF N +      
Sbjct: 236 AARGKAENLLKQAQGGADFAKLVRDNSSGPEAAQGGELGLRSIGRLPTQFANAVVDLKPG 295

Query: 256 NTTN-PYVTQKGVEYIAICDKRDLGGEIALK------AYLSAQNTPTKIEKHEAEYVKKL 308
                   +  G   + + DKR  G   + K       ++  +  PT         +  L
Sbjct: 296 QLAGQVIESPAGFHVLKLVDKRAPGTAASAKVAQTQVRHILIKTGPTMSADDARRQLAGL 355

Query: 309 RSN 311
           R  
Sbjct: 356 RDR 358



 Score =  112 bits (279), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 19/178 (10%), Positives = 61/178 (34%), Gaps = 2/178 (1%)

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQK 200
                 +         G   +++   +      + +    +     I      +    ++
Sbjct: 291 DLKPGQLAGQVIESPAGFHVLKLVDKRAPGTAASAKVAQTQVRHILIKTGPTMSADDARR 350

Query: 201 RIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTN 259
           ++    +  +      +   +++      + G+  ++    L P+F+  +        + 
Sbjct: 351 QLAGLRDRIVHGYDFSDAARRYSQDTSASAGGELGWVSPGQLVPEFEQAMNLLKPGEVSQ 410

Query: 260 PYVTQKGVEYIAICDKRDLGGEIAL-KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           P  +Q GV  I +  +RD    +   + Y  +     K++    +++++LR +A + Y
Sbjct: 411 PVQSQFGVHLIQVEGRRDAEVPVDRQRDYARSVIREQKVQAAYEDWLRQLRDSAHVEY 468


>gi|163797530|ref|ZP_02191481.1| Parvulin-like peptidyl-prolyl isomerase [alpha proteobacterium
           BAL199]
 gi|159177279|gb|EDP61838.1| Parvulin-like peptidyl-prolyl isomerase [alpha proteobacterium
           BAL199]
          Length = 406

 Score =  119 bits (296), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 38/263 (14%), Positives = 92/263 (34%), Gaps = 9/263 (3%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEK-------IAVQELIVETLK 86
            +     RI   +N E+++  D+  R+ ++ +       ++         ++ L+ E ++
Sbjct: 7   AAAQEQQRIAAVVNDEILSMRDLRSRLRMVIVSSRLPATDETAQRLAPQVLRSLVDEQIQ 66

Query: 87  KQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPD 146
            QE ++  +      +     +  +   L    F  F+   G+      + L  Q  W  
Sbjct: 67  LQEAKRLNVAVTDQDLARARSEVEQRNNLKPGQFEEFVRSLGVDPETVIRQLKSQVAWTK 126

Query: 147 VVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAE 206
           +V+  F       + E+    Q+M+    +    R     +  +   N+  V++  +   
Sbjct: 127 LVRRRFGNDVTISQEEVTDVLQRMEADAGKT-QKRVSEIVLTVDDPANEEQVRQLAERIV 185

Query: 207 ESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQK 265
           E             +F++  +    G   ++L   + P+  + + K      + P  T  
Sbjct: 186 EQLKAGANFGAVARQFSASANAAVGGDVGWVLAERMAPEIAEAVAKLETGQISAPVRTLF 245

Query: 266 GVEYIAICDKRDLGGEIALKAYL 288
           G   + + D R +     L A +
Sbjct: 246 GYHIVQVADSRVIAAVDPLTATV 268



 Score = 70.9 bits (171), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/270 (8%), Positives = 75/270 (27%), Gaps = 1/270 (0%)

Query: 47  NGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFF 106
           N   I+  +++  +  ++      +     +   + +   ++++ +              
Sbjct: 134 NDVTISQEEVTDVLQRMEADAGKTQKRVSEIVLTVDDPANEEQVRQLAERIVEQLKAGAN 193

Query: 107 VQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN 166
                    ++ + +   D   +        +A      +  +    ++       +   
Sbjct: 194 FGAVARQFSASANAAVGGDVGWVLAERMAPEIAEAVAKLETGQISAPVRTLFGYHIVQVA 253

Query: 167 KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI 226
             ++            +              V+   +   E+     ++C    + A +I
Sbjct: 254 DSRVIAAVDPLTATVDLKQVFLPVPPNAGKDVRPSQQALAEALSGSAQNCTDFVELAKEI 313

Query: 227 HDVSIGKAQYLLESDL-HPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK 285
                     +   +L  P  + +       TT       GV  + +C ++     +   
Sbjct: 314 KSPVSPDLGEMKVGELAPPLRERVAGLKVGETTGAVDLPNGVMVVMVCSRQAPPSNLPSP 373

Query: 286 AYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
             + +Q    + E     Y++ LR NA + 
Sbjct: 374 EQIRSQLEAQRFEILAQRYLRDLRRNAFVE 403


>gi|299531915|ref|ZP_07045315.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Comamonas
           testosteroni S44]
 gi|298720090|gb|EFI61047.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Comamonas
           testosteroni S44]
          Length = 475

 Score =  119 bits (296), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 48/298 (16%), Positives = 99/298 (33%), Gaps = 18/298 (6%)

Query: 32  SYKSWAMSSRIRTTINGEVITDGDISKRIALLKL--------QKINGELEKIAVQELIVE 83
           + +    +  I   +N E IT+ ++  R+  +               EL +  ++ LIVE
Sbjct: 62  AAQGVRSADYIVAVVNSEPITNNEVRARMERVAQNVTEQGGQLPSQSELARQVLERLIVE 121

Query: 84  TLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSI 143
            ++ QE + +GI  D+ TV+      AR          S L  +GI +  F+  +  Q +
Sbjct: 122 RVQLQEAKDTGINIDNMTVDQAVANVARQNNTDKAGLVSRLKAEGISEAQFRSEIRNQML 181

Query: 144 WPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI-----RTVLFSIPDNKLQNQGFV 198
              V + D   +    E +I    +  K                ++    +         
Sbjct: 182 MQRVRERDVDGRVKVGEADIDRYLKDQKRPGDAAAGAAANLGHILITVPENASPAVVAER 241

Query: 199 QKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNT 257
           + + K A E+  + P     + +F+   +    G       SD    F Q +   +    
Sbjct: 242 EAKAKQAAEAARKNPDFIAAVREFSDVPNGQGGGAMGMRPMSDYPELFSQQVGNSAVGAI 301

Query: 258 TNPYVTQKGVEYIAICDKRDLGG----EIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
             P+ +  G   + + +K   G           ++         E   A+ ++  +  
Sbjct: 302 VGPFRSGAGFHVLKVLEKSQAGAPVYITQNHARHILLTVGDGMTEAQAAKRLEDYKRR 359



 Score = 99.7 bits (246), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 25/167 (14%), Positives = 58/167 (34%), Gaps = 3/167 (1%)

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
           F    G   +++    Q    + + +   R +L ++ D   + Q   +           +
Sbjct: 305 FRSGAGFHVLKVLEKSQAGAPVYITQNHARHILLTVGDGMTEAQAAKRLEDYKRRVEAGQ 364

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYI 270
                   ++F+      + G   +       P+F+ +         +NP V++ GV  I
Sbjct: 365 ATFQ-QLAQEFSKDGSARNGGDLGWSSPGQFVPEFERVLENLQPGQISNPVVSRFGVHLI 423

Query: 271 AICDKRDLGGEIALKAY-LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            + ++R        +   +       K E+    ++K+LR  A + Y
Sbjct: 424 QLIERRQEKLTEREQREMVRNVVRERKAEQDYETWLKELRGKAFVEY 470


>gi|114797858|ref|YP_760847.1| peptidyl-prolyl cis-trans isomerase domain-containing protein
           [Hyphomonas neptunium ATCC 15444]
 gi|114738032|gb|ABI76157.1| PPIC-type PPIASE domain protein [Hyphomonas neptunium ATCC 15444]
          Length = 415

 Score =  119 bits (296), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 35/290 (12%), Positives = 95/290 (32%), Gaps = 16/290 (5%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS------SRIRTTINGEVITDGDISKRIALLKL 65
            ++++          +       + A          I   +N + I+  D+ +R  LL L
Sbjct: 1   MVRVVFLAAAFAAISVFGAPVSPASAQEADRQTLEGIAAIVNDKPISYSDVRQRARLLLL 60

Query: 66  --------QKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSA 117
                   Q+   ++   A+++LI E L+   + +  +  D   ++      A   G++ 
Sbjct: 61  TIGASQPTQEQVQQITGQALEQLIDEKLQLDRVSEFEVEVDPVEIDAAVQNMASEAGVTG 120

Query: 118 EDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVRE 177
           E     L   G+     ++ +  +  W  ++   +  +    E ++     +++  + + 
Sbjct: 121 EVLREQLTSSGVNPASLEEQMRAEIAWNRLMSGLYGNRIRISENQVDDQMSRLRTASQKT 180

Query: 178 YLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYL 237
                 +F    ++      +            +        ++ +S     + G   ++
Sbjct: 181 QYRIGEIFLYAPDEATKTEALTAAESI-ISQLQQGADFRVAAQRISSAPTAAAGGDMGWV 239

Query: 238 LESDLHPQFQNLLKKSQN-NTTNPYVTQKGVEYIAICDKRDLGGEIALKA 286
              D+ P     ++ S       P  T+ G+  I +  KR+    +    
Sbjct: 240 TIEDIDPTIAEAVRNSSGNGLLEPIQTENGIYIILLGGKREPAEPVTRVD 289


>gi|218461597|ref|ZP_03501688.1| probable peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           etli Kim 5]
          Length = 313

 Score =  119 bits (296), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 77/287 (26%), Positives = 139/287 (48%), Gaps = 10/287 (3%)

Query: 38  MSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITF 97
            +S ++  +NG  IT GD++KR A L+LQ    +  K A ++LI ETLK+QE+ +  ++ 
Sbjct: 28  AASEVQAVVNGTAITSGDVAKRQAFLRLQHTKADA-KTAKEQLIDETLKRQEVARVRMSV 86

Query: 98  DSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYG 157
               V+  F + +    LS E  S  LD+ G+G +HFK ++A+Q  WP VV   +     
Sbjct: 87  SQQDVDASFARFSAGNKLSVEQMSQILDRAGVGVDHFKGFIAVQMSWPRVVNARYGSTSR 146

Query: 158 NLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCN 217
               ++ +   +                     + +      KR  +AE SR + P   +
Sbjct: 147 LSNYDLVSRMMQNNKQKPVTTEYMLQQIIFVIPQAKRAAITGKRKGEAEASRSKFPGC-D 205

Query: 218 KLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRD 277
           + + FA+ + DV++     +L  ++ P ++ L+++++ NTT   VT KGVEY+AIC +R 
Sbjct: 206 QSKVFAATMRDVAVRDLGRMLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEYLAICSQRQ 265

Query: 278 LGGEIALKAYLSAQNTPTKI--------EKHEAEYVKKLRSNAIIHY 316
           +  + A +     ++              ++  +Y+ +LR  A I Y
Sbjct: 266 VSDDQAAEMVFRQEDLDKSKAGKNGPPENENSKKYLDELRKKAQIAY 312


>gi|197334077|ref|YP_002155047.1| chaperone SurA [Vibrio fischeri MJ11]
 gi|197315567|gb|ACH65014.1| chaperone SurA [Vibrio fischeri MJ11]
          Length = 437

 Score =  119 bits (296), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 34/295 (11%), Positives = 100/295 (33%), Gaps = 15/295 (5%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKIAVQELIVETL 85
            +     R+   ++  V+   DI   +  +K+              L +  +++LIV+T+
Sbjct: 22  AAPVELDRVVAIVDEGVVLQSDIDTSLKTVKINAQEKGQPLPDEAVLREQVLEKLIVDTI 81

Query: 86  KKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWP 145
           + Q+ EK GI  D   +       A+   ++          QG+   +F++ +  +    
Sbjct: 82  QSQQAEKMGIRIDDTRLEAALNDIAKENNMTLAQLQQKTAAQGLPYANFREQIRKEIAAS 141

Query: 146 DVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQ---NQGFVQKRI 202
           +        +   L  E+ +  Q +   T      +     +         ++  ++K+ 
Sbjct: 142 EARNAQVRRRINILPQEVESLAQLLAEETQATVQYKISHIQLRVEDGATQTDKEALEKQA 201

Query: 203 KDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS-QNNTTNPY 261
           +D  E   +          ++     +  G   ++ + ++   F + +    +N+   P+
Sbjct: 202 EDLTERLKQGADFATMAYTYSKGPKALQGGDWGWMRKEEMPTIFADQITGQGKNSIIGPF 261

Query: 262 VTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAI 313
            +  G   + I D +    +        ++  + +    ++     +  +  +  
Sbjct: 262 RSGVGFHILKIDDVKGLETVAVTEVNARHILIKTSVIMSDEGAQRLLNTIIDDIK 316



 Score = 75.9 bits (184), Expect =