RPSBLAST alignment of GI: 254780398 and protein with PDBid: 3fut

>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus HB8} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Length = 271
 Score =  155 bits (392), Expect = 1e-38
 Identities = 89/273 (32%), Positives = 133/273 (48%), Gaps = 19/273 (6%)

Query: 9   SLKTILSHYKIIPKKYMGQNFLLDLNILKKIAESSGSLDGITVIEIGAGPGNLTQMLLTL 68
           S++ +L  + +   K  GQNFL+    L++I E++    G  V E+G G G LT+ LL  
Sbjct: 9   SVRALLERHGLFADKRFGQNFLVSEAHLRRIVEAARPFTG-PVFEVGPGLGALTRALLE- 66

Query: 69  GARKVIVIEKDQQFFPILKDISSQHPNRLEIIQDDALKVDFEKFFNISSPIRIIANLPYN 128
              +V  IEKD +  P+L++  S  P RL          +     ++     ++ANLPY+
Sbjct: 67  AGAEVTAIEKDLRLRPVLEETLSGLPVRLVFQDALLYPWEEVPQGSL-----LVANLPYH 121

Query: 129 IGTRLLFNWISADTWPPFWESLTLLFQKEVGERITAQKNSPHYGRLSVLTGWRTKATMMF 188
           I T L+   +        +  L  L QKEV ER+TA+  +P YG L++       A  +F
Sbjct: 122 IATPLVTRLL----KTGRFARLVFLVQKEVAERMTARPKTPAYGVLTLRVAHHAVAERLF 177

Query: 189 DISPHVFFPSPKVTSTVIHFIPHLNPIPCCLESLKKITQEAFGKRRKTLRQSLKRLGG-- 246
           D+ P  FFP PKV S+++   P        L    ++ + AFGKRRKTL  +L   G   
Sbjct: 178 DLPPGAFFPPPKVWSSLVRLTPTGALDDPGLF---RLVEAAFGKRRKTLLNALAAAGYPK 234

Query: 247 ---ENLLHQAGIETNLRAENLSIEDFCRITNIL 276
              E  L   G+   +RAE L +E F R+   L
Sbjct: 235 ARVEEALRALGLPPRVRAEELDLEAFRRLREGL 267