HHsearch alignment for GI: 254780399 and conserved domain: KOG0019

>KOG0019 consensus.
Probab=97.66  E-value=0.00049  Score=48.64  Aligned_cols=160  Identities=21%  Similarity=0.344  Sum_probs=105.0

Q ss_pred             CCCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCC----------------CEEEEEEECCCEEEEEEEECCCCCCHH
Q ss_conf             7458889999852687226978999999987772699----------------679999980984399999888998898
Q gi|254780399|r    3 IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAES----------------SRVETVIAGGGKSFFQITDNGFGMTSE   66 (594)
Q Consensus         3 I~~L~~~~~~~Iaagevi~~~~svVkELveNSlDAgA----------------t~I~v~i~~~g~~~i~V~DnG~Gi~~~   66 (594)
T Consensus        43 ~~qLm~lii~s~YS~kE-----vFlRELISNaSDAldKiRy~~lt~~~~~~~~l~I~i~~-nk~~~tlti~DtGIGMTk~  116 (656)
T KOG0019          43 TNQLMDIVAKSLYSHKE-----VFLRELISNASDALEKLRYLELKGDEKALPELEIRIIT-NKDKRTITIQDTGIGMTKE  116 (656)
T ss_pred             HHHHHHHHHHHHHCCHH-----HHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCEEEEECC-CCCCCEEEEEECCCCCCHH
T ss_conf             77679999987615437-----88876531464047778877624743356632689615-8876558998447776889


Q ss_pred             HHHHHHCCCC---CCCCHHHHH----HCCCCCCCHHHHHHHHHHE-EEEEEEECCCCCCCEEEEECCCCCCCC-CCCCCC
Q ss_conf             9998750246---656312441----1214884048999876202-489998048986301551101000002-110125
Q gi|254780399|r   67 EIPMAVQRHC---TSKISDDFS----NIHTFGFRGEALPSIGAVS-HLTLMSRPPQNNTGAQIAISGEKISSV-RPVAMN  137 (594)
Q Consensus        67 dl~~~~~rh~---TSKi~~dl~----~i~t~GFRGEAL~sIa~vs-~l~i~s~~~~~~~~~~~~~~~g~~~~~-~~~~~~  137 (594)
T Consensus       117 dLvnnLGTIAkSGtK~Fmealkea~ad~~~IGQFGvGFYSaylVAdkV~V~tk~~~~e-~y~Wes~~~gs~~v~~~~~~~  195 (656)
T KOG0019         117 DLVNNLGTIAKSGSKAFLEALKEAEAESNLIGQFGVGFYSAFMVADRVVVTTRHPADE-GLQWTSNGRGSYEIAEASGLR  195 (656)
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHHCCCCHHHHHHHHHEEEEEECCCCCC-CEEEECCCCCCEEEEECCCCC
T ss_conf             9986551564346589999887634411122110100456665123268861268874-104313788726876236755


Q ss_pred             CCCEEEEEHHHHHHHHHHHCCCCHHHHH---HHHHHHHHHHHH--CCCC
Q ss_conf             6757885210121125431034536899---999999999873--1899
Q gi|254780399|r  138 PGTIVEVRDLFFTIPARLNFLKSEQVET---NLITDVIRRMAI--AYPK  181 (594)
Q Consensus       138 ~GT~V~V~~LF~N~PvRrkflks~~~e~---~~I~~~v~~~aL--~~P~  181 (594)
T Consensus       196 rGTki~l------------~lKe~~~ey~ee~rikeiVKK~S~Fv~yPI  232 (656)
T KOG0019         196 TGTKIVI------------HLKEGDCEFLEEKRIKEVVKKYSNFVSYPI  232 (656)
T ss_pred             CCCEEEE------------EEHHHHHHHCCHHHHHHHHHHCCCCCCCCC
T ss_conf             5304776------------502103432427678888752033224410