HHsearch alignment for GI: 254780399 and conserved domain: PRK00095

>PRK00095 mutL DNA mismatch repair protein; Reviewed.
Probab=100.00  E-value=0  Score=1329.92  Aligned_cols=589  Identities=42%  Similarity=0.739  Sum_probs=510.7

Q ss_pred             CCCCCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCEEEEEEEECCCCCCHHHHHHHHCCCCCCCC
Q ss_conf             96745888999985268722697899999998777269967999998098439999988899889899987502466563
Q gi|254780399|r    1 MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTSEEIPMAVQRHCTSKI   80 (594)
Q Consensus         1 m~I~~L~~~~~~~Iaagevi~~~~svVkELveNSlDAgAt~I~v~i~~~g~~~i~V~DnG~Gi~~~dl~~~~~rh~TSKi   80 (594)
T Consensus         1 m~I~~L~~~~~~~IaAGEVverpasvVKELvENsiDAgAt~I~V~i~~~G~~~I~V~DnG~Gi~~~d~~l~~~rhaTSKi   80 (612)
T PRK00095          1 MPIQLLPPQLANQIAAGEVVERPASVVKELVENALDAGATRIDIEIEEGGLKLIRVRDNGCGIPKEDLPLALSRHATSKI   80 (612)
T ss_pred             CCCEECCHHHHHHHCCCCEECCHHHHHHHHHHHHHCCCCCEEEEEEECCCCCEEEEEECCCCCCHHHHHHHHHCCCCCCC
T ss_conf             98648978999883896842588999999984133179987999997498317999979999898999999757277678


Q ss_pred             H--HHHHHCCCCCCCHHHHHHHHHHEEEEEEEECCCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHHCC
Q ss_conf             1--24411214884048999876202489998048986301551101000002110125675788521012112543103
Q gi|254780399|r   81 S--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFL  158 (594)
Q Consensus        81 ~--~dl~~i~t~GFRGEAL~sIa~vs~l~i~s~~~~~~~~~~~~~~~g~~~~~~~~~~~~GT~V~V~~LF~N~PvRrkfl  158 (594)
T Consensus        81 ~~~~DL~~i~T~GFRGEAL~SIa~vs~~~i~s~~~~~~~g~~i~~~~g~~~~~~~~~~~~GT~V~V~~LF~N~PaRrKfL  160 (612)
T PRK00095         81 ASLDDLEAIRTLGFRGEALPSIASVSRLTLTSRTADAAEGWQIVVEGGEIVEVKPAAHPVGTTIEVRDLFFNTPARRKFL  160 (612)
T ss_pred             CCHHHHHHCCCCCCCHHHHHHHHHHEEEEEEECCCCCCCEEEEEEECCEECCEEECCCCCCCEEEECHHHCCCHHHHHHH
T ss_conf             98456611767876188899877326789996789976728999949967532333689984999604525576889875


Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEC
Q ss_conf             45368999999999998731899749999879830799717881048999997321666543100224420365666621
Q gi|254780399|r  159 KSEQVETNLITDVIRRMAIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG  238 (594)
Q Consensus       159 ks~~~e~~~I~~~v~~~aL~~P~V~f~l~~~~~~~~~l~~~~~~~~l~~ri~~i~G~~~~~~l~~i~~~~~~~~i~G~is  238 (594)
T Consensus       161 Ks~~~E~~~I~~~v~~~AL~~P~I~f~l~~~~k~---~~~~~~~~~l~~ri~~i~G~~~~~~li~v~~~~~~~~i~G~is  237 (612)
T PRK00095        161 KSEKTELGHIDDVVRRLALAHPDVAFTLTHNGKL---VLQTRANGDLLQRLAAILGRDFAENALPIDAEHGDLRLSGYVG  237 (612)
T ss_pred             CCCCHHHHHHHHHHHHHHHHCCCEEEEEEECCEE---EECCCCCCCHHHHHHHHHCHHHHHHCEEEEEECCCEEEEEEEE
T ss_conf             7981799999999999975179758999989999---7235888789999999849898962779860169769999995


Q ss_pred             CCCCCCCCCHHHHHHHCCCHHHCHHHHHHHHHHHHHHCCCCCCEEEEEEEEEEHHHHCCCCCCHHHHHHHCCHHHHHHHH
Q ss_conf             61103323206677515210007588899998755442799980799999960657124757111125535979999999
Q gi|254780399|r  239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSYIRFRNPTIIRNFI  318 (594)
Q Consensus       239 ~P~~~r~~~~~q~ifVNgR~V~~~~l~~AI~~aY~~~l~~g~~P~~vL~i~i~p~~vDVNVHP~K~eVrf~de~~i~~~i  318 (594)
T Consensus       238 ~P~~~r~~r~~q~~FVNgR~V~~~~l~~aI~~aY~~~l~~~r~P~~vL~i~i~p~~VDVNVHP~K~EVrF~de~~i~~~i  317 (612)
T PRK00095        238 LPTLSRANRDYQYLFVNGRYVRDKLLNHAIRQAYHDVLPRGRYPAFVLFLELDPEQVDVNVHPAKHEVRFRDERLVHDLI  317 (612)
T ss_pred             CCHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEEEEECHHHCCCCCCCCCEEEEECCHHHHHHHH
T ss_conf             83120367762799987840478999999999998755489853799999974545255558872069843767999999


Q ss_pred             HHHHHHHHHHCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCC------CCC----CCCCCCCCCCCCCCCC-----
Q ss_conf             9978988753178876101121001124333554557744566554------310----0012322235200000-----
Q gi|254780399|r  319 IQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTN------TQE----KLFLQENRLSTNDLLP-----  383 (594)
Q Consensus       319 ~~~i~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~----~~~~~~~~~~~~~~~~-----  383 (594)
T Consensus       318 ~~ai~~aL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  397 (612)
T PRK00095        318 VQAIQEALAQSGLIPDALEAGAKLAALRPEEPEQAQSPLEPAEPSSPSPPSKASSPPASSASRSAASPPSAAPLPQKEAQ  397 (612)
T ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             99999998404778766544333344566655555445555554444454444454544444555554444444332320


Q ss_pred             -----CCCCCCCCCCCCCCCHHHHHHCCCCEEEEECCCCCEEECCCCEEECCHHHHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             -----122210000012341011110057211310455100002586354005899899999998522103884211112
Q gi|254780399|r  384 -----SDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLL  458 (594)
Q Consensus       384 -----~~~~~~~~~~~~~~~~~~~~~~~~~~igQ~~~~yIl~~~~~gL~iIDQHAAhERI~yE~l~~~~~~~~~~~Q~Ll  458 (594)
T Consensus       398 ~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~vigQ~~~~yIl~e~~~gL~iIDQHAAhERI~yE~l~~~~~-~~~~sQ~LL  476 (612)
T PRK00095        398 AAYRELLQTPASASASPAPEPSEEASPLGKALGQLHGTYILAENEDGLVLVDQHAAHERLLYEQLKDKLA-GGVASQPLL  476 (612)
T ss_pred             HHHHCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCEEEEEECCCCEEEEEHHHHHHHHHHHHHHHHHH-CCCCCCCCC
T ss_conf             1232014786655556554333335766337889818899998599569988899999999999998761-577552257


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             22234678347777999899998669599960798799995261115567899999999999857886646899999999
Q gi|254780399|r  459 TPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILA  538 (594)
Q Consensus       459 ~P~~i~Ls~~e~~~l~~~~~~l~~~Gf~~e~~g~~~~~i~~iP~~l~~~~~~~~l~dll~~l~~~~~~~~~~~~~~~~l~  538 (594)
T Consensus       477 ~P~~ieLs~~e~~~l~~~~~~l~~lGf~ie~fg~~si~v~~vP~~l~~~~~~~~i~~ll~~l~~~~~~~~~-~~~~~~la  555 (612)
T PRK00095        477 IPLVLELSEDEADRLEEHKELLARLGLELEPFGPNSFAVREVPALLGKEDLEELIRELLDDLAELGESDIL-KLREELAA  555 (612)
T ss_pred             CCEEECCCHHHHHHHHHHHHHHHHCCCEEEECCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCCH-HHHHHHHH
T ss_conf             88043169999999999999999679599945998899995383347768999999999999854887737-79999999


Q ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECHHHHHHHCCC
Q ss_conf             76348666458888989999999999818888788788727998388899764187
Q gi|254780399|r  539 TMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR  594 (594)
Q Consensus       539 s~ACr~AIk~gd~L~~~e~~~Li~~L~~c~~P~~CpHGRPt~~~l~~~el~k~F~R  594 (594)
T Consensus       556 s~ACrsAIk~G~~Ls~~Em~~Ll~~L~~~~~P~~CPHGRPt~i~ls~~el~k~F~R  611 (612)
T PRK00095        556 TMACHGAIRAGRRLTLEEMNALLRQLEATENPGTCPHGRPTYIELSLSDLEKLFKR  611 (612)
T ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECHHHHHHHHCC
T ss_conf             98789871088989999999999999728996959899928899379999974089