HHsearch alignment for GI: 254780399 and conserved domain: TIGR00585

>TIGR00585 mutl DNA mismatch repair protein MutL; InterPro: IPR014763 This entry represents DNA mismatch repair proteins, such as MutL. The dimeric MutL protein has a key function in communicating mismatch recognition by MutS to downstream repair processes. Mismatch repair contributes to the overall fidelity of DNA replication by targeting mispaired bases that arise through replication errors during homologous recombination and as a result of DNA damage. It involves the correction of mismatched base pairs that have been missed by the proofreading element of the DNA polymerase complex ..
Probab=100.00  E-value=0  Score=758.57  Aligned_cols=306  Identities=41%  Similarity=0.709  Sum_probs=289.4

Q ss_pred             CCCCCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCEEEEEEEECCCCCCHHHHHHHHCCCCCCCC
Q ss_conf             96745888999985268722697899999998777269967999998098439999988899889899987502466563
Q gi|254780399|r    1 MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTSEEIPMAVQRHCTSKI   80 (594)
Q Consensus         1 m~I~~L~~~~~~~Iaagevi~~~~svVkELveNSlDAgAt~I~v~i~~~g~~~i~V~DnG~Gi~~~dl~~~~~rh~TSKi   80 (594)
T Consensus         1 ~~I~~L~~~~v~~IaaGEVI~~p~~vVKELvENSLDAGAt~I~v~~~~gG~~~I~V~DNG~Gi~~~d~~~~~~~haTSKI   80 (367)
T TIGR00585         1 STIKQLPPELVNKIAAGEVIERPASVVKELVENSLDAGATKIEVEIEEGGLKLIEVSDNGSGIDKEDLELACERHATSKI   80 (367)
T ss_pred             CCCEECCHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCEEEEEEEECCCCCCHHHHHHHHCCCCCCCC
T ss_conf             95023898998777401144327999999887312148858999996265358999977856777779986123577632


Q ss_pred             H--HHHHHCCCCCCCHHHHHHHHHHEEEEEEEEC----------CCCCCCEEEEECCCC--CCCCCCCCCCCCCEEEEEH
Q ss_conf             1--2441121488404899987620248999804----------898630155110100--0002110125675788521
Q gi|254780399|r   81 S--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRP----------PQNNTGAQIAISGEK--ISSVRPVAMNPGTIVEVRD  146 (594)
Q Consensus        81 ~--~dl~~i~t~GFRGEAL~sIa~vs~l~i~s~~----------~~~~~~~~~~~~~g~--~~~~~~~~~~~GT~V~V~~  146 (594)
T Consensus        81 ~~~~DL~~i~TlGFRGEAL~Si~~vs~~~i~t~~~~~~~W~yQ~~~~~~~~~~~~~~G~~~~~~~~p~~~~~GT~V~V~~  160 (367)
T TIGR00585        81 QSFEDLERIRTLGFRGEALASISSVSRLTITTKTSGPTAWFYQGAADGLALQVLYAEGKNIIEEIKPAPRPVGTTVEVRD  160 (367)
T ss_pred             CCHHHHHHHHCCCCHHHHHHHHHHHHCCEEEEEECCCCCCEECCCCCCEEEEEEECCCCEEEECCCCCCCCCCCEEEEEC
T ss_conf             24789998640483468999998643334787425898612212356404676620687342002566889897899730


Q ss_pred             HHHHHHHHHH-C-CCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEC------CCCEEEEECCCCCHHHHH-HHHHHHHHHH
Q ss_conf             0121125431-0-34536899999999999873189974999987------983079971788104899-9997321666
Q gi|254780399|r  147 LFFTIPARLN-F-LKSEQVETNLITDVIRRMAIAYPKVSFTFSTI------KSNRYKMNFQSTNGNFPE-RISQVIGEDF  217 (594)
Q Consensus       147 LF~N~PvRrk-f-lks~~~e~~~I~~~v~~~aL~~P~V~f~l~~~------~~~~~~l~~~~~~~~l~~-ri~~i~G~~~  217 (594)
T Consensus       161 LF~N~P~R~k~~s~k~~~~e~~~~~~~l~~~~l~~~~v~f~~~~~~~~~~~g~~~~~~~~-~~~~~~~~~~~~~v~g~~~  239 (367)
T TIGR00585       161 LFYNLPVRRKEFSLKSPKKELRKILDLLERYALIHPDVSFSLTSDESFQTNGKKVLSLST-KPNQSLKERRIRSVFGTAV  239 (367)
T ss_pred             CCCCCCHHHHHHHCCCHHHHHHHHHHHHHHHEEECCCCEEEEEECCEECCCCCEEEEECC-CCCCHHHHHHHHHHHHHHH
T ss_conf             315852026877557806889999999864401337935899971166477410033524-8873078999998874443


Q ss_pred             HHHHHHCC-CCCEEEEEE-------------------EEECCCCCCCCCCHH----------HHHHHCCCHHHCHH----
Q ss_conf             54310022-442036566-------------------662161103323206----------67751521000758----
Q gi|254780399|r  218 INNAVELN-EKSNEITLQ-------------------GYTGIPTFNRGNANQ----------FYVFINGRTVQDKF----  263 (594)
Q Consensus       218 ~~~l~~i~-~~~~~~~i~-------------------G~is~P~~~r~~~~~----------q~ifVNgR~V~~~~----  263 (594)
T Consensus       240 ~~~~~~~~~~~~~~~~~~~~~~~~~~~d~L~~~~r~~G~~~~p~~~~~~~~~~~~~~~~~r~~~~fiN~R~v~~~~~~~~  319 (367)
T TIGR00585       240 ASKLFPLDEKEDSDLQLERMNRQSNPGDILDIAYRLLGFISEPNVSRSRRSGDKRRNEKDRFQFLFINGRPVELKLDRQK  319 (367)
T ss_pred             HHCCCCHHCCCCCCEEEEEECCCCCCHHHHHHHHHHEEEECCCCCCCCCCCCCCCCCCCCEEEEEEECCEEECCCCCCCH
T ss_conf             31021000057774158762376886156654331111103776665445666678401208899756432037888755


Q ss_pred             -HHHHHHHHHHHHCCCCC---CEEEEEEEEEEHHHHCCCCCCHHHHHH
Q ss_conf             -88999987554427999---807999999606571247571111255
Q gi|254780399|r  264 -ILSTIRTAYAETIPLGR---YPVVVLLLEIDPRQVDVNVHPAKSYIR  307 (594)
Q Consensus       264 -l~~AI~~aY~~~l~~g~---~P~~vL~i~i~p~~vDVNVHP~K~eVr  307 (594)
T Consensus       320 ~l~~~~~~~y~~~~~~~~~~L~P~~~L~l~~~p~~~DvNvhP~K~eV~  367 (367)
T TIGR00585       320 SLLKAIREVYHEYLPKGQKKLYPVFVLNLEIDPELVDVNVHPDKKEVR  367 (367)
T ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEEEEEEECCCCEEEEEECCCCCCCC
T ss_conf             689999998764153457602238999740785115231268743129