HHsearch alignment for GI: 254780399 and conserved domain: TIGR02956

>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: IPR014302 This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (IPR003594 from INTERPRO), HAMP (IPR003660 from INTERPRO), phosphoacceptor (IPR003661 from INTERPRO), and phosphotransfer (IPR008207 from INTERPRO) domains and a response regulator receiver domain (IPR001789 from INTERPRO)..
Probab=95.67  E-value=0.027  Score=36.15  Aligned_cols=102  Identities=19%  Similarity=0.242  Sum_probs=74.8

Q ss_pred             CCHHHHHHHHHHHHH---HCCCCEEEEEEECCCE-----EEEEEEECCCCCCHHHHHHHHCCCCCCCCHHHHHHCCCCCC
Q ss_conf             697899999998777---2699679999980984-----39999988899889899987502466563124411214884
Q gi|254780399|r   21 ERPSIAIKELIENSL---DAESSRVETVIAGGGK-----SFFQITDNGFGMTSEEIPMAVQRHCTSKISDDFSNIHTFGF   92 (594)
Q Consensus        21 ~~~~svVkELveNSl---DAgAt~I~v~i~~~g~-----~~i~V~DnG~Gi~~~dl~~~~~rh~TSKi~~dl~~i~t~GF   92 (594)
T Consensus       621 ~riRQvL~NLvgNaIKFT~~Gsv~l~~~l~~~~~~gdsel~F~V~DtG~GIae~~~~~lF~aF~Qa~-----eg~~~~gG  695 (1052)
T TIGR02956       621 RRIRQVLINLVGNAIKFTDRGSVVLRVSLNDDSSSGDSELLFEVEDTGVGIAEEEQATLFDAFTQAD-----EGRRKSGG  695 (1052)
T ss_pred             CHHHHHHHHHHHCCCEECCCCEEEEEEEECCCCCCCCCEEEEEEEECCCCCCHHHHHHHCCCCCCCC-----CCCCCCCC
T ss_conf             1344767654413200434526999988558889866347888862477998799985433101210-----13731377


Q ss_pred             CHHHHHHHH-----HH-EE---EEEEEECC-CCCCCEEEEECCCCC
Q ss_conf             048999876-----20-24---89998048-986301551101000
Q gi|254780399|r   93 RGEALPSIG-----AV-SH---LTLMSRPP-QNNTGAQIAISGEKI  128 (594)
Q Consensus        93 RGEAL~sIa-----~v-s~---l~i~s~~~-~~~~~~~~~~~~g~~  128 (594)
T Consensus       696 TGLGLA-Is~~Lv~AM~G~GrGl~v~S~~~~GScF~F~lpl~~~~~  740 (1052)
T TIGR02956       696 TGLGLA-ISRRLVEAMDGEGRGLGVESELGQGSCFWFTLPLARGKP  740 (1052)
T ss_pred             CCCHHH-HHHHHHHHHCCCCCCCEEEEECCCCCEEEEECCCCCCCH
T ss_conf             650689-999999970888765016664587502212423133750