HHsearch alignment for GI: 254780399 and conserved domain: cd00075

>cd00075 HATPase_c Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins.
Probab=98.68  E-value=3.5e-07  Score=71.31  Aligned_cols=84  Identities=17%  Similarity=0.280  Sum_probs=61.4

Q ss_pred             HHHHHHHHHHHHHHCCC---CEEEEEEECC-CEEEEEEEECCCCCCHHHHHHHHCCCCCCCCHHHHHHCCCCCCCHHHHH
Q ss_conf             78999999987772699---6799999809-8439999988899889899987502466563124411214884048999
Q gi|254780399|r   23 PSIAIKELIENSLDAES---SRVETVIAGG-GKSFFQITDNGFGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALP   98 (594)
Q Consensus        23 ~~svVkELveNSlDAgA---t~I~v~i~~~-g~~~i~V~DnG~Gi~~~dl~~~~~rh~TSKi~~dl~~i~t~GFRGEAL~   98 (594)
T Consensus         1 l~~vl~nLl~NAik~~~~~~~~I~i~~~~~~~~~~i~V~D~G~Gi~~~~~~~if~~f~~~~~------~~~~~g~GlGL~   74 (103)
T cd00075           1 LQQVLLNLLSNAIKHTPEGGGRITISVERDGDHLEIRVEDNGPGIPEEDLERIFERFSDGSR------SRKGGGTGLGLS   74 (103)
T ss_pred             CHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCEEEEEEEECCCCCCHHHHHHCCCCCCCCCC------CCCCCCCCCHHH
T ss_conf             96999999999998678999489999998399999999977994088999760697501788------877898650599


Q ss_pred             HHHHHE-----EEEEEEEC
Q ss_conf             876202-----48999804
Q gi|254780399|r   99 SIGAVS-----HLTLMSRP  112 (594)
Q Consensus        99 sIa~vs-----~l~i~s~~  112 (594)
T Consensus        75 i~~~i~~~~~G~i~i~s~~   93 (103)
T cd00075          75 IVKKLVELHGGRIEVESEP   93 (103)
T ss_pred             HHHHHHHHCCCEEEEEECC
T ss_conf             9999999889989999659