HHsearch alignment for GI: 254780399 and conserved domain: pfam01119

>pfam01119 DNA_mis_repair DNA mismatch repair protein, C-terminal domain. This family represents the C-terminal domain of the mutL/hexB/PMS1 family. This domain has a ribosomal S5 domain 2-like fold.
Probab=99.97  E-value=5.8e-31  Score=242.23  Aligned_cols=118  Identities=42%  Similarity=0.819  Sum_probs=115.1

Q ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEEEEEECCCCCCCCCCHHHHHHHCCCHHHCHHHHHHHHHHHHHHCCCCCCEEEEEEE
Q ss_conf             99732166654310022442036566662161103323206677515210007588899998755442799980799999
Q gi|254780399|r  209 ISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLL  288 (594)
Q Consensus       209 i~~i~G~~~~~~l~~i~~~~~~~~i~G~is~P~~~r~~~~~q~ifVNgR~V~~~~l~~AI~~aY~~~l~~g~~P~~vL~i  288 (594)
T Consensus         1 i~~i~G~~~~~~li~v~~~~~~~~i~G~is~p~~~r~~~~~q~~fVN~R~V~~~~l~~ai~~aY~~~l~~~~~P~~~l~i   80 (118)
T pfam01119         1 IAAIYGREFAENLLPIDAEDEGLRLSGFISKPELSRSNRDYQYLFVNGRPVRDKLLSHAIREAYRDLLPKGRYPVAVLFL   80 (118)
T ss_pred             CCEEECHHHHHHCEEEEEECCCEEEEEEEECCHHCCCCCCCEEEEECCCEECCHHHHHHHHHHHHHHCCCCCCCEEEEEE
T ss_conf             90400888996050887466999999999892323688865899994989871899999999999765079974799998


Q ss_pred             EEEHHHHCCCCCCHHHHHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             96065712475711112553597999999999789887
Q gi|254780399|r  289 EIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAI  326 (594)
Q Consensus       289 ~i~p~~vDVNVHP~K~eVrf~de~~i~~~i~~~i~~~L  326 (594)
T Consensus        81 ~ipp~~vDVNVHP~K~eV~f~~e~~i~~~i~~~i~~~L  118 (118)
T pfam01119        81 EIDPELVDVNVHPAKREVRFRDEREVHDFIEEAVREAL  118 (118)
T ss_pred             ECCHHHEECCCCCCCCEEEECCHHHHHHHHHHHHHHHC
T ss_conf             55889934323886038998188999999999999759