HHsearch results for GI: 254780399 and protein with PDBid: 1id0_A

>1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A
Probab=97.78  E-value=4e-05  Score=54.89  Aligned_cols=57  Identities=12%  Similarity=0.123  Sum_probs=47.3

Q ss_pred             CHHHHHHHHHHHHHHCCCCEEEEEEEC-CCEEEEEEEECCCCCCHHHHHHHHCCCCCC
Q ss_conf             978999999987772699679999980-984399999888998898999875024665
Q gi|254780399|r   22 RPSIAIKELIENSLDAESSRVETVIAG-GGKSFFQITDNGFGMTSEEIPMAVQRHCTS   78 (594)
Q Consensus        22 ~~~svVkELveNSlDAgAt~I~v~i~~-~g~~~i~V~DnG~Gi~~~dl~~~~~rh~TS   78 (594)
                      ....|+--||+||+......|.|.+.. +..-.|.|.|||.||++++++.+++|+++.
T Consensus        44 ~l~~vl~NLl~NAiky~~~~i~I~~~~~~~~~~i~V~D~G~Gi~~~~~~~iF~~F~r~  101 (152)
T 1id0_A           44 DFVEVMGNVLDNACKYCLEFVEISARQTDEHLYIVVEDDGPGIPLSKREVIFDRGQRV  101 (152)
T ss_dssp             HHHHHHHHHHHHHHHHCSSEEEEEEEECSSCEEEEEEESSSCCCGGGTTGGGSCCCCT
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEEEECCEEEEEEEECCCCCCHHHHHHHCCCCCCC
T ss_conf             9999999999999997799889999997999999999889998989999872897048