HHsearch results for GI: 254780399 and protein with PDBid: 2gqp_A

>2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 2esa_A*
Probab=98.98  E-value=4.9e-09  Score=83.01  Aligned_cols=142  Identities=24%  Similarity=0.343  Sum_probs=87.2

Q ss_pred             CCCCHHHHHHHHHHHHHHCC------------------CCEEEEEEECCCEEEEEEEECCCCCCHHHHHHHHCCCCCC--
Q ss_conf             22697899999998777269------------------9679999980984399999888998898999875024665--
Q gi|254780399|r   19 IIERPSIAIKELIENSLDAE------------------SSRVETVIAGGGKSFFQITDNGFGMTSEEIPMAVQRHCTS--   78 (594)
Q Consensus        19 vi~~~~svVkELveNSlDAg------------------At~I~v~i~~~g~~~i~V~DnG~Gi~~~dl~~~~~rh~TS--   78 (594)
                      .=.+|.-.+||||.||.||-                  .-.|.|..+.. ...+.|+|||.||+++|+..-+..-|-|  
T Consensus        29 LYs~~evfLRELiqNa~DA~~k~r~~~~~~~~~~~~~~~~~I~i~~d~~-~~~l~i~DnGiGMt~~el~~~lgtIa~Sgt  107 (236)
T 2gqp_A           29 LYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKE-KNLLHVTDTGVGMTREELVKNLGTIAKSGT  107 (236)
T ss_dssp             TTTCTTHHHHHHHHHHHHHHHHHHHHHHHCTTTTTTCCCCCEEEEEETT-TTEEEEEECSCCCCHHHHHHHHHCC-----
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEECCC-CCEEEEEECCCCCCHHHHHHHHHHHHHCCC
T ss_conf             5699622099998789999999999966494100467771699976588-888999845522159999887676662142


Q ss_pred             -----CCHH-------HHHHCCCCCCCHHHHHHHHHHE-EEEEEEECCCCCCCEEEEECCCCCCCC---CCCCCCCCCEE
Q ss_conf             -----6312-------4411214884048999876202-489998048986301551101000002---11012567578
Q gi|254780399|r   79 -----KISD-------DFSNIHTFGFRGEALPSIGAVS-HLTLMSRPPQNNTGAQIAISGEKISSV---RPVAMNPGTIV  142 (594)
Q Consensus        79 -----Ki~~-------dl~~i~t~GFRGEAL~sIa~vs-~l~i~s~~~~~~~~~~~~~~~g~~~~~---~~~~~~~GT~V  142 (594)
                           |+.+       +-.-|.-||   --+.|-=.|+ +++++||..+++ +|....+|+.....   .....++||+|
T Consensus       108 ~~f~~~~~~~~~~~~~~~~lIGqFG---VGFyS~FmVAd~V~V~sr~~~~~-~~~W~s~g~~~~~i~~~~~~~~~~GT~I  183 (236)
T 2gqp_A          108 SEFLNKMTEAQEDGQSTSELIGQFG---VGFYSAFLVADKVIVTSKHNNDT-QHIWESDSNEFSVIADPRGNTLGRGTTI  183 (236)
T ss_dssp             ----------------CHHHHHHTT---CGGGGGGGTEEEEEEEEECTTSC-CEEEEESSSCEEEEECTTCSCSSSEEEE
T ss_pred             HHHHHHHHHHHCCCCCCHHHHHHCC---CCCEEEEEEECEEEEEEECCCCC-CCEEEECCCCCEEEECCCCCCCCCCEEE
T ss_conf             8888765532003453111353257---23057673305599998216787-7459945887179731357778998499


Q ss_pred             EEEHHHHHHHHHHHCCCCHHH---HHHHHHHHHHHHHH
Q ss_conf             852101211254310345368---99999999999873
Q gi|254780399|r  143 EVRDLFFTIPARLNFLKSEQV---ETNLITDVIRRMAI  177 (594)
Q Consensus       143 ~V~~LF~N~PvRrkflks~~~---e~~~I~~~v~~~aL  177 (594)
                      +..            ||....   +...+.++|.+|+=
T Consensus       184 ~L~------------lk~~~~e~l~~~~l~~li~kys~  209 (236)
T 2gqp_A          184 TLV------------LKEEASDYLELDTIKNLVKKYSQ  209 (236)
T ss_dssp             EEE------------ECGGGGGGGCHHHHHHHHHHHHT
T ss_pred             EEE------------ECCCCHHHCCHHHHHHHHHHHHH
T ss_conf             999------------88877455799999999999861