HHsearch results for GI: 254780399 and protein with PDBid: 2ior_A

>2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli}
Probab=99.12  E-value=9e-10  Score=88.31  Aligned_cols=145  Identities=24%  Similarity=0.301  Sum_probs=94.8

Q ss_pred             CCCHHHHHHHHHHHHHHCC------------------CCEEEEEEECCCEEEEEEEECCCCCCHHHHHHHHCCCCCCCCH
Q ss_conf             2697899999998777269------------------9679999980984399999888998898999875024665631
Q gi|254780399|r   20 IERPSIAIKELIENSLDAE------------------SSRVETVIAGGGKSFFQITDNGFGMTSEEIPMAVQRHCTSKIS   81 (594)
Q Consensus        20 i~~~~svVkELveNSlDAg------------------At~I~v~i~~~g~~~i~V~DnG~Gi~~~dl~~~~~rh~TSKi~   81 (594)
                      -.+|.-.+||||+||.||-                  .-.|.|.++..+. .+.|+|||.||+++++..-+..-|.|--+
T Consensus        45 Ys~~~ifLRELIqNA~DA~~k~r~~~~~~~~~~~~~~~~~I~i~~d~~~~-~l~I~DnGiGMt~~el~~~l~tia~S~~~  123 (235)
T 2ior_A           45 YSNKEIFLRELISNASDAADKLRFRALSNPDLYEGDGELRVRVSFDKDKR-TLTISDNGVGMTRDEVIDHLGTIAKSGTK  123 (235)
T ss_dssp             GGGTTHHHHHHHHHHHHHHHHHHHHHTSCGGGGTTCCCCCEEEEEETTTT-EEEEEECSSCCCHHHHHHHHTTCCCTTHH
T ss_pred             CCCCCEEEEEHHHHHHHHHHHHHHHHCCCCHHHCCCCCCEEEEEECCCCC-EEEEEECCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             89986453108765999999999987159501058877436888648998-89999777332478866665022023238


Q ss_pred             H-----------HHHHCCCCCCCHHHHHHHHHHE-EEEEEEECCCCC--CCEEEEECCCCCCCCCCC-CCCCCCEEEEEH
Q ss_conf             2-----------4411214884048999876202-489998048986--301551101000002110-125675788521
Q gi|254780399|r   82 D-----------DFSNIHTFGFRGEALPSIGAVS-HLTLMSRPPQNN--TGAQIAISGEKISSVRPV-AMNPGTIVEVRD  146 (594)
Q Consensus        82 ~-----------dl~~i~t~GFRGEAL~sIa~vs-~l~i~s~~~~~~--~~~~~~~~~g~~~~~~~~-~~~~GT~V~V~~  146 (594)
                      +           |..-   .|..|=...|.=.|| +++|.||..++.  .+|.....|+......+. ..+.||+|++. 
T Consensus       124 ~f~~~~~~~~~~~~~~---IGqFGIGf~S~FmVad~V~V~Trs~~~~~~~~~~w~~~g~~~~~i~~~~~~~~GT~I~L~-  199 (235)
T 2ior_A          124 SFLESLGSDQAKDSQL---IGQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYTVADITKEDRGTEITLH-  199 (235)
T ss_dssp             HHHHHCCSCHHHHHHH---HTTCCCCGGGGGGTEEEEEEEEECTTSCGGGEEEEEECSSSEEEEEEECCCSCEEEEEEE-
T ss_pred             HHHHHHHHCCCCCCCC---CCCCCCCEEEEEECCCEEEEEECCCCCCCCCCEEEEECCCCEEEECCCCCCCCCCEEEEE-
T ss_conf             8987533113344110---023450025553306769998446686766113577458860550678889998889999-


Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             0121125431034536899999999999873
Q gi|254780399|r  147 LFFTIPARLNFLKSEQVETNLITDVIRRMAI  177 (594)
Q Consensus       147 LF~N~PvRrkflks~~~e~~~I~~~v~~~aL  177 (594)
                      |   =|--..|+     +...+.++|.+|+-
T Consensus       200 L---ked~~efl-----~~~~lk~iIkkys~  222 (235)
T 2ior_A          200 L---REGEDEFL-----DDWRVRSIISKYSD  222 (235)
T ss_dssp             E---CTTCGGGG-----CHHHHHHHHHHHTT
T ss_pred             E---CCCHHHHH-----CHHHHHHHHHHHHH
T ss_conf             8---97317664-----98799999998874