HHsearch results for GI: 254780399 and protein with PDBid: 2o1u_A

>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A
Probab=98.77  E-value=7.4e-08  Score=74.56  Aligned_cols=272  Identities=19%  Similarity=0.280  Sum_probs=137.7

Q ss_pred             CCHHHHHHHHHHHHHHCC------------------CCEEEEEEECCCEEEEEEEECCCCCCHHHHHHHHCCCC---CC-
Q ss_conf             697899999998777269------------------96799999809843999998889988989998750246---65-
Q gi|254780399|r   21 ERPSIAIKELIENSLDAE------------------SSRVETVIAGGGKSFFQITDNGFGMTSEEIPMAVQRHC---TS-   78 (594)
Q Consensus        21 ~~~~svVkELveNSlDAg------------------At~I~v~i~~~g~~~i~V~DnG~Gi~~~dl~~~~~rh~---TS-   78 (594)
                      .+|---|||||.||.||=                  .-.|.|.++..+. .+.|+|||.||+++|+...+-.=|   |. 
T Consensus        44 S~~eVFlRELisNA~DAi~k~r~~~l~~~~~~~~~~~~~I~i~~d~~~~-tl~i~DnGIGMt~~El~~~LgtIa~Sgt~~  122 (666)
T 2o1u_A           44 KNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKN-LLHVTDTGVGMTREELVKNLGTIAKSGTSE  122 (666)
T ss_dssp             SSCTTHHHHHHHHHHHHHHHHHHHTTSCTTSSSSCCCCCEEEEEETTTT-EEEEEECSCCCCHHHHHHHTTC--------
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHCCCCCCCEEEEEECCCCC-EEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             9832759989874999999999986358200278888469998659899-899995388889999998723230132899


Q ss_pred             ---CCHH---H----HHHCCC--CCCCHHHHHHHHHHE-EEEEEEECCCCCCCEEEEECCCCCCCC---CCCCCCCCCEE
Q ss_conf             ---6312---4----411214--884048999876202-489998048986301551101000002---11012567578
Q gi|254780399|r   79 ---KISD---D----FSNIHT--FGFRGEALPSIGAVS-HLTLMSRPPQNNTGAQIAISGEKISSV---RPVAMNPGTIV  142 (594)
Q Consensus        79 ---Ki~~---d----l~~i~t--~GFRGEAL~sIa~vs-~l~i~s~~~~~~~~~~~~~~~g~~~~~---~~~~~~~GT~V  142 (594)
                         |+.+   |    -.-|.-  .||     .|-=-|| +++|.||..+++ ++...-+|+.....   .....+.||+|
T Consensus       123 fl~~~~~~~~~~~~~~~~IGqFGvGf-----yS~FmVad~V~V~trs~~~~-~~~W~s~g~~~~~~~~~~~~~~~~GT~I  196 (666)
T 2o1u_A          123 FLNKMTEAQEDGQSTSELIGQFGVGF-----YSAFLVADKVIVTSKHNNDT-QHIWESDSNEFSVIADPRGNTLGRGTTI  196 (666)
T ss_dssp             -----------------------CTT-----GGGGGTEEEEEEEEECTTSC-CEEEEESSSCCEEEECTTCCSSSSEEEE
T ss_pred             HHHHHHHHHHCCCCHHHHHCCCCCCC-----EEEEEEEEEEEEEEECCCCC-CCEEEECCCCCEEECCCCCCCCCCCEEE
T ss_conf             99998742101231033340577451-----13427867999998548877-5058935898357456655666897389


Q ss_pred             EEEHHHHHHHHHHHCCCCHHHHH---HHHHHHHHHHHHCCCCCEEEEEECCCC--------EEEEE-----CC-CC----
Q ss_conf             85210121125431034536899---999999999873189974999987983--------07997-----17-88----
Q gi|254780399|r  143 EVRDLFFTIPARLNFLKSEQVET---NLITDVIRRMAIAYPKVSFTFSTIKSN--------RYKMN-----FQ-ST----  201 (594)
Q Consensus       143 ~V~~LF~N~PvRrkflks~~~e~---~~I~~~v~~~aL~~P~V~f~l~~~~~~--------~~~l~-----~~-~~----  201 (594)
                      +..            ||....|+   ..|.+++.+|+=.= .+-+.+......        ...+.     +. +.    
T Consensus       197 ~L~------------lk~~~~e~l~~~~i~~li~kYs~fi-~~PI~l~~~~~~~~~~~~~~~~~iN~~~~lW~r~~~~it  263 (666)
T 2o1u_A          197 TLV------------LKEEASDYLELDTIKNLVKKYSQFI-NFPIYVWSSKTGGGGKTVWDWELMNDIKPIWQRPSKEVE  263 (666)
T ss_dssp             EEE------------ECTTTTTSSSTTHHHHHHHHHSTTC-CSCEEEEECC-------CCEEEECSCCSCTTTSCTTTCC
T ss_pred             EEE------------ECCCHHHHCCHHHHHHHHHHHCCCC-CCCEEEECCCCCCCCCCCCHHHHHCCCCCCCCCCHHHCC
T ss_conf             997------------0550143411999999999741367-777698304444555455405550666644468812237


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCC-EEEEEEEEECCCCC---------CCCCCHHHHHHHCCCHHHCHHHHHHHHHH
Q ss_conf             104899999732166654310022442-03656666216110---------33232066775152100075888999987
Q gi|254780399|r  202 NGNFPERISQVIGEDFINNAVELNEKS-NEITLQGYTGIPTF---------NRGNANQFYVFINGRTVQDKFILSTIRTA  271 (594)
Q Consensus       202 ~~~l~~ri~~i~G~~~~~~l~~i~~~~-~~~~i~G~is~P~~---------~r~~~~~q~ifVNgR~V~~~~l~~AI~~a  271 (594)
                      ...+.+-...+++. ...-+..+.... +.+.+.|.+=.|..         ....+...-+|+|+=.|.+.         
T Consensus       264 ~eey~~fy~~~~~~-~~~Pl~~ih~~~eg~~~~~~llyiP~~~p~~~~~~~~~~~~~~i~LY~krVfI~d~---------  333 (666)
T 2o1u_A          264 DDEYKAFYKSFSKE-SDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDD---------  333 (666)
T ss_dssp             HHHHHHHHHHTTCT-TSCCSEEEEEEECSSSCEEEEEEECSSCCC------------CEEEEETTEEEESC---------
T ss_pred             HHHHHHHHHHHCCC-CCCCHHHEEECCCCCCEEEEEEEECCCCCHHHHHHHHHHHCCCEEEEEEEEEEECC---------
T ss_conf             88999898750123-35873441230367621578997114584444544324304764899730386054---------


Q ss_pred             HHHHCCCCCCEEEEEEEEEEHHHHCCCCCCHHHHHHHCCH--HHHHHHHHHHHHHHHHH
Q ss_conf             5544279998079999996065712475711112553597--99999999978988753
Q gi|254780399|r  272 YAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSYIRFRNP--TIIRNFIIQSIQKAINK  328 (594)
Q Consensus       272 Y~~~l~~g~~P~~vL~i~i~p~~vDVNVHP~K~eVrf~de--~~i~~~i~~~i~~~L~~  328 (594)
                      ..++||.  |- +|+.--+|...+-.||.   +|.--.|.  ..|...|...|.+.|..
T Consensus       334 ~~~LLP~--wl-~FvrGVVDS~DLpLNvS---RE~LQ~d~~l~kI~~~i~kkv~~~L~~  386 (666)
T 2o1u_A          334 FHDMMPK--YL-NFVKGVVDSDDLPLNVS---RETLQQHKLLKVIRKKLVRKTLDMIKK  386 (666)
T ss_dssp             CCTTSCG--GG-TTCEEEEEESSSCSSSC---HHHHHTCHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHCHH--HH-HHHCCEECCCCCCCCCH---HHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             5443828--77-53211200112675410---555542399999999999999999987