HHsearch results for GI: 254780399 and protein with PDBid: 2q2e_B

>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei}
Probab=99.83  E-value=3.6e-20  Score=163.10  Aligned_cols=164  Identities=20%  Similarity=0.230  Sum_probs=124.5

Q ss_pred             CCHHHHHHHHHHHHHHCCCC-----EEEEEEE--CCCEEEEEEEECCCCCCHHHHHHH-HCCCCCCCCH--HHHHHCCCC
Q ss_conf             69789999999877726996-----7999998--098439999988899889899987-5024665631--244112148
Q gi|254780399|r   21 ERPSIAIKELIENSLDAESS-----RVETVIA--GGGKSFFQITDNGFGMTSEEIPMA-VQRHCTSKIS--DDFSNIHTF   90 (594)
Q Consensus        21 ~~~~svVkELveNSlDAgAt-----~I~v~i~--~~g~~~i~V~DnG~Gi~~~dl~~~-~~rh~TSKi~--~dl~~i~t~   90 (594)
                      -+++++|+|||+||+||+|+     .|.|.|.  +++...|+|+|||+||+.+|++.+ +.-|++||..  +++.-.+.+
T Consensus        36 ~~L~~~v~Elv~Na~Da~~~~g~~~~I~v~i~~~~~~~~~i~V~DnG~Gm~~d~~~~~l~~l~~sgK~~~~~~s~G~~Gv  115 (621)
T 2q2e_B           36 RSLITTVKEAVDNALDACEEAGILPDILVQVERTGPDYVTVIIEDNGPGIVREQIPKVFAKLLYGSRFHALKQSRGQQGI  115 (621)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTTSCSCEEEECCEEETTTEEEEEEECCSCCCCGGGHHHHHSCCCCC--CCCCC-CCSSSSH
T ss_pred             CHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCEEEEEEEEECCCCCHHHHHHHHHEECCCCCCCCCCCCCCCCCC
T ss_conf             17899899999718868976399982599999689964699999848999989999986084667787665117997665


Q ss_pred             CCCHHHHHHHHHHE-EEEEEEECCCCCCCEEEEECCCCCCC--------CCCCCCCCCCEEEEEHHHHHHHHHHHCCCCH
Q ss_conf             84048999876202-48999804898630155110100000--------2110125675788521012112543103453
Q gi|254780399|r   91 GFRGEALPSIGAVS-HLTLMSRPPQNNTGAQIAISGEKISS--------VRPVAMNPGTIVEVRDLFFTIPARLNFLKSE  161 (594)
Q Consensus        91 GFRGEAL~sIa~vs-~l~i~s~~~~~~~~~~~~~~~g~~~~--------~~~~~~~~GT~V~V~~LF~N~PvRrkflks~  161 (594)
                      ||+|+++.|.-.++ +++|.|+..++..+|...+.++....        ........||.+.+..-|......+.     
T Consensus       116 G~~gv~~~S~~~va~~v~V~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----  190 (621)
T 2q2e_B          116 GISAAVLYAQMTAGRHTKILSKTSPTAPAHYYELMINTSTNEPDILVDEVRDWFRPHGTQIELEMRAAYVKGRRQ-----  190 (621)
T ss_dssp             HHHHHHHHHHHHTCCCCEEEEECSSSSCEEEEECCCCSSSCSCCCCCEEECCCSCSSCCCEEEECSCCCCCCSSS-----
T ss_pred             CHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEECCCCCCCCCCEEECCCCCCCCCEEEEEEECCCCCHHHHHHH-----
T ss_conf             676888876864286389999617987259998415665567731103655664440479740223430122689-----


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEEECCCCEE
Q ss_conf             689999999999987318997499998798307
Q gi|254780399|r  162 QVETNLITDVIRRMAIAYPKVSFTFSTIKSNRY  194 (594)
Q Consensus       162 ~~e~~~I~~~v~~~aL~~P~V~f~l~~~~~~~~  194 (594)
                           .|.+.++++|+.+|++.+.+...+....
T Consensus       191 -----~i~~~lr~~a~~~~~~~i~~~~~~~~~~  218 (621)
T 2q2e_B          191 -----SIYEYLKATAIVNPHARITLIDPDGNEE  218 (621)
T ss_dssp             -----SSHHHHHHHHHHCCSCEEEECCTTSCCE
T ss_pred             -----HHHHHHHHHHHHCCCCEEEEECCCCCEE
T ss_conf             -----9999999998508785699864899706