HHsearch results for GI: 254780399 and protein with PDBid: 2wer_A

>2wer_A ATP-dependent molecular chaperone HSP82; ATPase, cytoplasm, ATP-binding, phosphoprotein, stress response, nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2akp_A
Probab=99.03  E-value=3.1e-09  Score=84.47  Aligned_cols=141  Identities=23%  Similarity=0.313  Sum_probs=93.0

Q ss_pred             CCCHHHHHHHHHHHHHHC------------------CCCEEEEEEECCCEEEEEEEECCCCCCHHHHHHHHCCCCCCCCH
Q ss_conf             269789999999877726------------------99679999980984399999888998898999875024665631
Q gi|254780399|r   20 IERPSIAIKELIENSLDA------------------ESSRVETVIAGGGKSFFQITDNGFGMTSEEIPMAVQRHCTSKIS   81 (594)
Q Consensus        20 i~~~~svVkELveNSlDA------------------gAt~I~v~i~~~g~~~i~V~DnG~Gi~~~dl~~~~~rh~TSKi~   81 (594)
                      =.+|.-.+||||.||.||                  +.-.|.|.++..+. .+.|+|||.||+++++...+..-+.|.=+
T Consensus        24 Ys~~~iflRELisNa~DA~~k~~~~~~~~~~~~~~~~~~~I~i~~d~~~~-~l~i~DnGiGMt~~el~~~L~ti~~S~t~  102 (220)
T 2wer_A           24 YSNKEIFLREIVSNASDALDKIRYKSLSDPKQLETEPDLFIRITPKPEQK-VLEIRDSGIGMTKAELINNLGTIAKSGTK  102 (220)
T ss_dssp             CSSTTHHHHHHHHHHHHHHHHHHHHHTTCGGGGGGCCCCCEEEEEEGGGT-EEEEEECSCCCCHHHHHHHTTTSCCTTHH
T ss_pred             CCCCCEEHHHHHHHHHHHHHHHHHHHCCCCCHHCCCCCCEEEEEECCCCC-EEEEECCCCEECHHHHHHHHHHHHCCCCH
T ss_conf             89975018788867999999999986459501125788458998538887-79996187311389987654434033437


Q ss_pred             ---------HHHHHCCCCCCCHHHHHHHHHHE-EEEEEEECCCCCCCEEEEECC--CCCCCCCC--CCCCCCCEEEEEHH
Q ss_conf             ---------24411214884048999876202-489998048986301551101--00000211--01256757885210
Q gi|254780399|r   82 ---------DDFSNIHTFGFRGEALPSIGAVS-HLTLMSRPPQNNTGAQIAISG--EKISSVRP--VAMNPGTIVEVRDL  147 (594)
Q Consensus        82 ---------~dl~~i~t~GFRGEAL~sIa~vs-~l~i~s~~~~~~~~~~~~~~~--g~~~~~~~--~~~~~GT~V~V~~L  147 (594)
                               +|..-|.-||   =-+.|-=.|+ ++++.||..+++ +|.....+  +-.....+  -..++||+|+..  
T Consensus       103 ~~~~~~~~~~~~~~IGqFG---IGfyS~FmVad~V~V~Tr~~~~~-~~~W~~~~dg~~~i~~~~~~~~~~~GT~I~L~--  176 (220)
T 2wer_A          103 AFMEALSAGADVSMIGQFG---VGFYSLFLVADRVQVISKSNDDE-QYIWESNAGGSFTVTLDEVNERIGRGTILRLF--  176 (220)
T ss_dssp             HHHHHHTTTCCGGGGGGGT---CGGGGGGGTEEEEEEEEECTTSC-CEEEEECSSSEEEEEECSSSCCCSSEEEEEEE--
T ss_pred             HHHHHCCCCCCCCCCCCCC---EEEEEEEEECCEEEEEECCCCCC-CEEEEECCCCCEEEEEECCCCCCCCCEEEEEE--
T ss_conf             7775301365413035310---04778886317699998359986-30578517997699981147767987799999--


Q ss_pred             HHHHHHHHHCCCCHH---HHHHHHHHHHHHHHH
Q ss_conf             121125431034536---899999999999873
Q gi|254780399|r  148 FFTIPARLNFLKSEQ---VETNLITDVIRRMAI  177 (594)
Q Consensus       148 F~N~PvRrkflks~~---~e~~~I~~~v~~~aL  177 (594)
                                ||...   .+-..|.++|.+|+=
T Consensus       177 ----------lk~d~~e~l~~~~l~~likkys~  199 (220)
T 2wer_A          177 ----------LKDDQLEYLEEKRIKEVIKRHSE  199 (220)
T ss_dssp             ----------ECTTCGGGGCHHHHHHHHHHHCT
T ss_pred             ----------ECCCHHHHCCHHHHHHHHHHHHH
T ss_conf             ----------68448876598899999999874