HHsearch results for GI: 254780399 and protein with PDBid: 3a0r_A

>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transferase, two-component regulatory system; 3.80A {Thermotoga maritima}
Probab=98.10  E-value=3.1e-06  Score=62.87  Aligned_cols=57  Identities=19%  Similarity=0.286  Sum_probs=23.7

Q ss_pred             HHHCHHHHHHHHHHHHHHCCCCCCEEEEEEEEEEHHHHCCCCCCHHHHHHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             0007588899998755442799980799999960657124757111125535979999999997898875
Q gi|254780399|r  258 TVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAIN  327 (594)
Q Consensus       258 ~V~~~~l~~AI~~aY~~~l~~g~~P~~vL~i~i~p~~vDVNVHP~K~eVrf~de~~i~~~i~~~i~~~L~  327 (594)
                      ++.-..+...+...++..+....   .-+.+++++....|...|          ..+...+..-+.+|+.
T Consensus       202 ~~~l~~~i~~~~~~~~~~~~~~~---i~l~~~~~~~~~~v~~d~----------~~l~qvl~NLl~NAi~  258 (349)
T 3a0r_A          202 EFNLNELIREVYVLFEEKIRKMN---IDFCFETDNEDLRVEADR----------TRIKQVLINLVQNAIE  258 (349)
T ss_dssp             EEEHHHHHHHHHHHHHHHHTTTT---CCCEEEESCSCCEEEECH----------HHHHHHHHHHHTHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHHHCC---CEEEEECCCCCEEEEECH----------HHHHHHHHHHHHHHHH
T ss_conf             65799999999999999998669---189997278870899857----------8999999999999999