HHsearch results for GI: 254780399 and protein with PDBid: 3hrs_A

>3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A
Probab=91.83  E-value=0.085  Score=30.98  Aligned_cols=99  Identities=12%  Similarity=0.137  Sum_probs=51.3

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCEEEEEECCCCCCCCCHHHHHH--HHHHHHH-HCCCCCCHHHHHHHHH
Q ss_conf             234678347777999899998669599960798799995261115567899999--9999998-5788664689999999
Q gi|254780399|r  461 EIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLR--DIIDEII-DSSTTYTLQDRIENIL  537 (594)
Q Consensus       461 ~~i~Ls~~e~~~l~~~~~~l~~~Gf~~e~~g~~~~~i~~iP~~l~~~~~~~~l~--dll~~l~-~~~~~~~~~~~~~~~l  537 (594)
                      ..+.+++..   +.+....|..-|+.... ....+.++.-    +...+..+++  .+++.+. +.-.. .     +   
T Consensus        28 ~~l~vs~~s---v~~~l~rL~~~g~i~~~-~~~~i~LT~~----G~~~A~~i~r~hrl~e~fl~~~lg~-~-----~---   90 (214)
T 3hrs_A           28 QLMQVSPPA---VTEMMKKLLAEELLIKD-KKAGYLLTDL----GLKLVSDLYRKHRLIEVFLVHHLGY-T-----T---   90 (214)
T ss_dssp             HHHTCCHHH---HHHHHHHHHHTTSEEEE-TTTEEEECHH----HHHHHHHHHHHHHHHHHHHHHTTCC-C-----H---
T ss_pred             HHHCCCHHH---HHHHHHHHHHCCCEEEC-CCCCEEECHH----HHHHHHHHHHHHHHHHHHHHHHHCC-C-----H---
T ss_conf             986899579---99999999978998973-8977765787----9999999999999999999998499-9-----8---


Q ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCEEE
Q ss_conf             9763486664588889899999999998188887887887279
Q gi|254780399|r  538 ATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTF  580 (594)
Q Consensus       538 ~s~ACr~AIk~gd~L~~~e~~~Li~~L~~c~~P~~CpHGRPt~  580 (594)
                       ..||+.|-+.-+.++.+-..+|...|   .+|-+||||+|+.
T Consensus        91 -~~~~~~A~~iEH~is~~~~~~l~~~l---~~p~~~P~g~~ip  129 (214)
T 3hrs_A           91 -EEIHEEAEVLEHTVSDHFVERLDQLL---DYPKACPHGGTIP  129 (214)
T ss_dssp             -HHHHHHHHHHHTTSCHHHHHHHHHHT---TCCSBCTTSCBCC
T ss_pred             -HHHHHHHHHHHHHCCHHHHHHHHHHH---CCCCCCCCCCCCC
T ss_conf             -99999998886437999999999994---8998795989779