BLAST/PSIBLAST alignment of GI: 254780399 and GI: 218682547 at iteration 1
>gi|218682547|ref|ZP_03530148.1| DNA mismatch repair protein [Rhizobium etli CIAT 894] Length = 600
 Score =  630 bits (1626), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 309/606 (50%), Positives = 417/606 (68%), Gaps = 19/606 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+LSE +INQIAAGE+IERP+ A KELIEN+LDA ++R+E   A GGK+  +++DNG
Sbjct: 1   MAIRQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIATASGGKALLRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM + ++ +AV+RHCTSK+SD   +I T GFRGEALPSIG+V+ L++ SR   +  G +
Sbjct: 61  SGMDAADLELAVRRHCTSKLSDTLEDIRTLGFRGEALPSIGSVARLSIASRRRDSAGGHE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA++  KI+ +RP A NPGTIVEVRDLFF  PARL FLKSE+ E   IT++++RMAIA+P
Sbjct: 121 IAVNAGKITHLRPAAANPGTIVEVRDLFFATPARLKFLKSEKAEAGAITEIVKRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V F  S   S+R  + F +T  +   R++QV+G++F +NA+ L+    EI+L G+ G+P
Sbjct: 181 AVRFVLS--GSDRATLEFPATGDDHLARMAQVLGKEFRDNAIALDAVREEISLTGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+   Y F+NGR VQDK ILS IR AYAETIP GRYPV VL + +DP  VDVNVH
Sbjct: 239 TFNRGNSAHQYAFVNGRPVQDKLILSAIRGAYAETIPSGRYPVAVLSITLDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH---QDNAPKTHLPK 357
           PAKS +RFR+P ++R  I+ +I++A+ + G   ++  +  M+ +F    Q  AP+   P+
Sbjct: 299 PAKSDVRFRDPGLVRGLIVGAIREALARDGSRAATTGASDMLRAFRPGFQSYAPR---PQ 355

Query: 358 YATSLTNT-----QEKLFLQENRLSTNDLL----PSDDPTYSEDNDPVEESEATHYQLGI 408
            A S   +     Q  + L E   ++ D L       +P +S          A  Y LG 
Sbjct: 356 TAWSAETSPSRPYQPAMGLSERPQASFDGLSMPTARAEPQFSPQP--AAPEPAARYPLGA 413

Query: 409 ACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEG 468
           A AQIH NYI++QT DGLVIVDQHAAHERL+FE MR+  +S ++ SQ LL PEIID+ E 
Sbjct: 414 ARAQIHANYIVAQTEDGLVIVDQHAAHERLVFEAMRKALHSKRLASQVLLIPEIIDIPEE 473

Query: 469 ECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYT 528
           +C  +M+H  +L  LG+  ERFGP AIA+RE PA+L + +   L+R + DEI +  T   
Sbjct: 474 DCDRLMQHAAELSELGLSIERFGPGAIAVRETPAMLGEVDAHGLIRQLADEIAEWDTASG 533

Query: 529 LQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDI 588
           L  ++E + ATMAC+GS+RSGR+++  EMN LLREME  P S QCNHGRPT+I+LKLSDI
Sbjct: 534 LSAKLEYVAATMACHGSVRSGRRLRPEEMNALLREMEVTPGSGQCNHGRPTYIELKLSDI 593

Query: 589 EKLFGR 594
           E+LFGR
Sbjct: 594 ERLFGR 599