BLAST/PSIBLAST alignment of GI: 254780399 and GI: 315122189 at iteration 1
>gi|315122189|ref|YP_004062678.1| DNA mismatch repair protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 600
>gi|313495591|gb|ADR52190.1| DNA mismatch repair protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 600
 Score =  955 bits (2468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/597 (78%), Positives = 526/597 (88%), Gaps = 4/597 (0%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           MKIRKLSEKI+NQIAAGEIIERP+IAIKELIENSLDAES+ +ETVI+GGGKSFFQITDNG
Sbjct: 5   MKIRKLSEKIVNQIAAGEIIERPAIAIKELIENSLDAESTCIETVISGGGKSFFQITDNG 64

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           FGMTSEEI MAVQRHCTSKI D+FSNI TFGFRGEALPSIGAV+HLTLMSR PQNNTGAQ
Sbjct: 65  FGMTSEEIQMAVQRHCTSKIFDNFSNICTFGFRGEALPSIGAVAHLTLMSRSPQNNTGAQ 124

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQ+ETNLI +VIRRMAIAYP
Sbjct: 125 ITISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQIETNLIANVIRRMAIAYP 184

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V FTFST K+NRY M+F+ST+GNFP+RISQVIGEDFINNAVE+NE S  ITL+GY GIP
Sbjct: 185 AVRFTFSTTKNNRYTMDFKSTDGNFPDRISQVIGEDFINNAVEINETSPNITLRGYAGIP 244

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGNANQ YVF+NGR +QDK ILSTIR AY+ETIPL RYPV+VLLLEI+P QVDVNVH
Sbjct: 245 TFNRGNANQLYVFVNGRIIQDKLILSTIRIAYSETIPLRRYPVIVLLLEINPTQVDVNVH 304

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           PAKS +RFR+P+++RNFIIQSIQK+INKK   TSS+LS KMISSFHQ+NA K     Y  
Sbjct: 305 PAKSDVRFRDPSMVRNFIIQSIQKSINKKRNFTSSILSNKMISSFHQENAEKFRPITYEH 364

Query: 361 SL--TNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYI 418
               +++QEKL LQEN LST +LL +++  + +DN  + ++  ++Y LG+ACAQIHQNYI
Sbjct: 365 KAIPSHSQEKLVLQENNLSTKELLTTNNKYFMDDNS-INDTTTSNYPLGMACAQIHQNYI 423

Query: 419 ISQTTDGLVIVDQHAAHERLIFEKMRQDFN-STKITSQTLLTPEIIDLLEGECALIMEHD 477
           ISQT D L+IVDQHAAHERLIFEKMRQDFN + KITSQTLL PEIIDLLEGECALI+EHD
Sbjct: 424 ISQTYDELIIVDQHAAHERLIFEKMRQDFNINDKITSQTLLIPEIIDLLEGECALILEHD 483

Query: 478 EDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENIL 537
           EDL RLG+  ERFG NAIAIREIPAILSK N+ QLLRDI+DEII+++T   L D+I+ IL
Sbjct: 484 EDLRRLGVTVERFGLNAIAIREIPAILSKNNVSQLLRDIVDEIIENNTKNNLTDKIDKIL 543

Query: 538 ATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ATMACYGSIRSGRKM   EMNRLLREME+N NSSQCNHGRPTFIKLKLSDIEKLFGR
Sbjct: 544 ATMACYGSIRSGRKMHLTEMNRLLREMEQNNNSSQCNHGRPTFIKLKLSDIEKLFGR 600