BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780399|ref|YP_003064812.1| DNA mismatch repair protein
[Candidatus Liberibacter asiaticus str. psy62]
         (594 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780399|ref|YP_003064812.1| DNA mismatch repair protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040076|gb|ACT56872.1| DNA mismatch repair protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 594

 Score = 1218 bits (3152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/594 (100%), Positives = 594/594 (100%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG
Sbjct: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ
Sbjct: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP
Sbjct: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
           KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP
Sbjct: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH
Sbjct: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT
Sbjct: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360

Query: 361 SLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIIS 420
           SLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIIS
Sbjct: 361 SLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIIS 420

Query: 421 QTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDL 480
           QTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDL
Sbjct: 421 QTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDL 480

Query: 481 HRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATM 540
           HRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATM
Sbjct: 481 HRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATM 540

Query: 541 ACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR
Sbjct: 541 ACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594


>gi|315122189|ref|YP_004062678.1| DNA mismatch repair protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495591|gb|ADR52190.1| DNA mismatch repair protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 600

 Score =  955 bits (2468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/597 (78%), Positives = 526/597 (88%), Gaps = 4/597 (0%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           MKIRKLSEKI+NQIAAGEIIERP+IAIKELIENSLDAES+ +ETVI+GGGKSFFQITDNG
Sbjct: 5   MKIRKLSEKIVNQIAAGEIIERPAIAIKELIENSLDAESTCIETVISGGGKSFFQITDNG 64

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           FGMTSEEI MAVQRHCTSKI D+FSNI TFGFRGEALPSIGAV+HLTLMSR PQNNTGAQ
Sbjct: 65  FGMTSEEIQMAVQRHCTSKIFDNFSNICTFGFRGEALPSIGAVAHLTLMSRSPQNNTGAQ 124

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQ+ETNLI +VIRRMAIAYP
Sbjct: 125 ITISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQIETNLIANVIRRMAIAYP 184

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V FTFST K+NRY M+F+ST+GNFP+RISQVIGEDFINNAVE+NE S  ITL+GY GIP
Sbjct: 185 AVRFTFSTTKNNRYTMDFKSTDGNFPDRISQVIGEDFINNAVEINETSPNITLRGYAGIP 244

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGNANQ YVF+NGR +QDK ILSTIR AY+ETIPL RYPV+VLLLEI+P QVDVNVH
Sbjct: 245 TFNRGNANQLYVFVNGRIIQDKLILSTIRIAYSETIPLRRYPVIVLLLEINPTQVDVNVH 304

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           PAKS +RFR+P+++RNFIIQSIQK+INKK   TSS+LS KMISSFHQ+NA K     Y  
Sbjct: 305 PAKSDVRFRDPSMVRNFIIQSIQKSINKKRNFTSSILSNKMISSFHQENAEKFRPITYEH 364

Query: 361 SL--TNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYI 418
               +++QEKL LQEN LST +LL +++  + +DN  + ++  ++Y LG+ACAQIHQNYI
Sbjct: 365 KAIPSHSQEKLVLQENNLSTKELLTTNNKYFMDDNS-INDTTTSNYPLGMACAQIHQNYI 423

Query: 419 ISQTTDGLVIVDQHAAHERLIFEKMRQDFN-STKITSQTLLTPEIIDLLEGECALIMEHD 477
           ISQT D L+IVDQHAAHERLIFEKMRQDFN + KITSQTLL PEIIDLLEGECALI+EHD
Sbjct: 424 ISQTYDELIIVDQHAAHERLIFEKMRQDFNINDKITSQTLLIPEIIDLLEGECALILEHD 483

Query: 478 EDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENIL 537
           EDL RLG+  ERFG NAIAIREIPAILSK N+ QLLRDI+DEII+++T   L D+I+ IL
Sbjct: 484 EDLRRLGVTVERFGLNAIAIREIPAILSKNNVSQLLRDIVDEIIENNTKNNLTDKIDKIL 543

Query: 538 ATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ATMACYGSIRSGRKM   EMNRLLREME+N NSSQCNHGRPTFIKLKLSDIEKLFGR
Sbjct: 544 ATMACYGSIRSGRKMHLTEMNRLLREMEQNNNSSQCNHGRPTFIKLKLSDIEKLFGR 600


>gi|241203286|ref|YP_002974382.1| DNA mismatch repair protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240857176|gb|ACS54843.1| DNA mismatch repair protein MutL [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 600

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/603 (50%), Positives = 419/603 (69%), Gaps = 13/603 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+LSE +INQIAAGE+IERP+ A KELIEN+LDA ++R+E   +GGGK+  +++DNG
Sbjct: 1   MAIRQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIATSGGGKALLRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM + ++ +AV+RHCTSKIS+   +I T GFRGEALPSIG+V+ L++ SR   +  G +
Sbjct: 61  SGMDAADLELAVRRHCTSKISETLEDIRTLGFRGEALPSIGSVARLSIASRRRDSTGGHE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA++G KI+ +RP A NPGTIVEVRDLFF  PARL FLK+E+ E   IT++++RMAIA+P
Sbjct: 121 IAVAGGKIAHMRPAAANPGTIVEVRDLFFATPARLKFLKTEKAEAGAITEIVKRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V F  S   S+R  + F +T  +   R++QV+G++F +NA+ L+    EI L G+ G+P
Sbjct: 181 AVRFVLS--GSDRTTLEFPATGDDHLARMAQVLGKEFRDNAIALDAVREEIALTGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+   Y F+NGR VQDK ILS IR AYAETIP GRYPV VL + +DP  VDVNVH
Sbjct: 239 TFNRGNSAHQYAFVNGRPVQDKLILSAIRGAYAETIPSGRYPVAVLAITLDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           PAKS +RFR+P+++R  I+ +I++A+ + G   ++  +  M+ SF     P    P+ A 
Sbjct: 299 PAKSDVRFRDPSLVRGLIVGAIREALARDGSRAATTGASDMLRSFRPGFQPNNQRPQTAW 358

Query: 361 SLTNTQEKL------FLQENRLSTNDL-LPSD--DPTYSEDNDPVEESEATHYQLGIACA 411
           S   +  +       F +  + S + L +P+   +P +S    P      T Y LG A A
Sbjct: 359 SAETSPSQPYQPATGFGERPQASFDGLSMPTARAEPQFSPQ--PAVAEPNTRYPLGAARA 416

Query: 412 QIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECA 471
           QIH NYI++QT DGLVIVDQHAAHERL+FE MR+  +S ++ SQ LL PEI+D+ E +C 
Sbjct: 417 QIHANYIVAQTEDGLVIVDQHAAHERLVFEAMRKALHSKRLASQVLLIPEIVDIPEEDCD 476

Query: 472 LIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQD 531
            +M+H  +L  LG+  ERFGP AIA+RE PA+L + +   L+R + DEI +  T   L  
Sbjct: 477 RLMQHAAELSELGLAIERFGPGAIAVRETPAMLGEVDAHGLIRQLADEIAEWDTASGLSA 536

Query: 532 RIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKL 591
           ++E + ATMAC+GS+RSGR+++  EMN LLREME  P S QCNHGRPT+I+LKLSDIE+L
Sbjct: 537 KLEYVAATMACHGSVRSGRRLRPEEMNALLREMEVTPGSGQCNHGRPTYIELKLSDIERL 596

Query: 592 FGR 594
           FGR
Sbjct: 597 FGR 599


>gi|116250684|ref|YP_766522.1| DNA mismatch repair protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|123384931|sp|Q1MKU7|MUTL_RHIL3 RecName: Full=DNA mismatch repair protein mutL
 gi|115255332|emb|CAK06407.1| putative DNA mismatch repair protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 600

 Score =  637 bits (1643), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 306/603 (50%), Positives = 418/603 (69%), Gaps = 13/603 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+LSE +INQIAAGE+IERP+ A KELIEN+LDA ++R+E   +GGGK+  +++DNG
Sbjct: 1   MAIRQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIATSGGGKALLRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM + ++ +AV+RHCTSKIS+   +I T GFRGEALPSIG+V+ L++ SR   +  G +
Sbjct: 61  SGMDAADLELAVRRHCTSKISETLEDIRTLGFRGEALPSIGSVARLSIASRRRDSAGGHE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA++G KI+ +RP A NPGTIVEVRDLFF  PARL FLK+E+ E   IT++++RMAIA+P
Sbjct: 121 IAVAGGKIAHLRPAAANPGTIVEVRDLFFATPARLKFLKTEKAEAGAITEIVKRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V F  S   S+R  + F +T  +   R++QV+G++F +NA+ L+    EI L G+ G+P
Sbjct: 181 AVRFVLS--GSDRTTLEFPATGDDHLGRMAQVLGKEFRDNAIALDAVREEIALTGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+   Y F+NGR VQDK ILS IR AYAETIP GRYPV VL + +DP  VDVNVH
Sbjct: 239 TFNRGNSAHQYAFVNGRPVQDKLILSAIRGAYAETIPSGRYPVAVLSITLDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           PAKS +RFR+P ++R  I+ +I++A+ + G   ++  +  M+ SF     P +  P+ A 
Sbjct: 299 PAKSDVRFRDPGLVRGLIVGAIREALARDGSRAATTGASDMLRSFRPGFPPNSQRPQTAW 358

Query: 361 SLTNTQEKL------FLQENRLSTNDL-LPSD--DPTYSEDNDPVEESEATHYQLGIACA 411
           S   +  +       F +  + S + L +P+   +P +S    P        Y LG A A
Sbjct: 359 SAETSSSRPYQPATGFGERPQASFDGLSMPTARAEPQFSPQ--PAAAEPNARYPLGAARA 416

Query: 412 QIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECA 471
           QIH NYI++QT DGLVIVDQHAAHERL+FE MR+  +S ++ SQ LL PEI+D+ E +C 
Sbjct: 417 QIHANYIVAQTEDGLVIVDQHAAHERLVFEAMRKALHSKRLASQVLLIPEIVDIPEEDCD 476

Query: 472 LIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQD 531
            +M+H  +L  LG+  ERFGP AIA+RE PA+L + +   L+R + DEI +  T   L  
Sbjct: 477 RLMQHAAELSELGLAIERFGPGAIAVRETPAMLGEVDAHGLIRQLADEIAEWDTASGLSA 536

Query: 532 RIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKL 591
           ++E + ATMAC+GS+RSGR+++  EMN LLREME  P S QCNHGRPT+I+LKLSDIE+L
Sbjct: 537 KLEYVAATMACHGSVRSGRRLRPEEMNALLREMEVTPGSGQCNHGRPTYIELKLSDIERL 596

Query: 592 FGR 594
           FGR
Sbjct: 597 FGR 599


>gi|190890558|ref|YP_001977100.1| DNA mismatch repair protein [Rhizobium etli CIAT 652]
 gi|238692496|sp|B3PRD9|MUTL_RHIE6 RecName: Full=DNA mismatch repair protein mutL
 gi|190695837|gb|ACE89922.1| DNA mismatch repair protein [Rhizobium etli CIAT 652]
          Length = 606

 Score =  637 bits (1643), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 312/610 (51%), Positives = 416/610 (68%), Gaps = 21/610 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+LSE +INQIAAGE+IERP+ A KELIEN+LDA ++R+E   AGGGK+  +++DNG
Sbjct: 1   MAIRQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIATAGGGKALLRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM + ++ +AV+RHCTSKIS+   +I T GFRGEALPSIG+V+ L + SR   +  G +
Sbjct: 61  SGMEATDLELAVRRHCTSKISETLEDIRTLGFRGEALPSIGSVARLNIASRRRDSAGGHE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA++G KI  +RP A NPGTIVEVRDLFF  PARL FLKSE+ E   IT++++RMAIA+P
Sbjct: 121 IAVAGGKIVHIRPAAANPGTIVEVRDLFFATPARLKFLKSEKAEAGAITEIVKRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V F  S   S+R  + F +T  +   R++QV+G++F +NA+ L+    +I+L G+ G+P
Sbjct: 181 AVRFVLS--GSDRTTLEFPATGDDHLARMAQVLGKEFRDNAILLDAVREDISLTGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+   Y F+NGR VQDK ILS IR AYAETIP GRYPV VL + +DP  VDVNVH
Sbjct: 239 TFNRGNSAHQYAFVNGRPVQDKLILSAIRGAYAETIPSGRYPVAVLSITLDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           PAKS +RFR+P ++R  I+ +I++A+ + G   ++  +  M+ +F     P    P+   
Sbjct: 299 PAKSDVRFRDPGLVRGLIVGAIREALARDGSRAATTGASDMLRAFRPGFQPHAQRPQAPW 358

Query: 361 SLTNT-----------QEKLFLQENRLST----NDLLPSDDPTYSEDNDPVEESEAT-HY 404
           S   +            E+     +RLS      +L PS  P   E   P   +E T  Y
Sbjct: 359 SAETSPFRPYPPAAGFSERPQASFDRLSMPTARAELQPSPQPGAPE---PAASAETTGRY 415

Query: 405 QLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIID 464
            LG A AQIH NYI++QT DGLVIVDQHAAHERL+FE MR+  +S ++ SQ LL PEIID
Sbjct: 416 PLGAARAQIHANYIVAQTEDGLVIVDQHAAHERLVFEAMRKALHSKRLASQVLLIPEIID 475

Query: 465 LLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSS 524
           L E +C  +M+H  +L  LG+  ERFGP AIA+RE PA+L + +   L+R + DEI +  
Sbjct: 476 LPEEDCDRLMQHAAELSELGLAIERFGPGAIAVRETPAMLGEVDAHGLIRQLADEIAEWD 535

Query: 525 TTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLK 584
           T   L  ++E + ATMAC+GS+RSGR+++  EMN LLREME  P S QCNHGRPT+I+LK
Sbjct: 536 TASGLSAKLEYVAATMACHGSVRSGRRLRPEEMNALLREMEVTPGSGQCNHGRPTYIELK 595

Query: 585 LSDIEKLFGR 594
           LSDIE+LFGR
Sbjct: 596 LSDIERLFGR 605


>gi|209548102|ref|YP_002280019.1| DNA mismatch repair protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|238058936|sp|B5ZS00|MUTL_RHILW RecName: Full=DNA mismatch repair protein mutL
 gi|209533858|gb|ACI53793.1| DNA mismatch repair protein MutL [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 600

 Score =  635 bits (1637), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 305/603 (50%), Positives = 416/603 (68%), Gaps = 13/603 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+LSE +INQIAAGE+IERP+ A KELIEN+LDA ++R+E   AGGGK+  +++DNG
Sbjct: 1   MAIRQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIATAGGGKALLRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM + ++ +AV+RHCTSK+S+   +I T GFRGEALPSIG+V+ L++ SR   +  G +
Sbjct: 61  SGMDAADLELAVRRHCTSKLSETLEDIRTLGFRGEALPSIGSVARLSIASRRRDSAGGHE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA++  K++ +RP A NPGTIVEVRDLFF  PARL FLK+E+ E   IT++++RMAIA+P
Sbjct: 121 IAVNAGKVAHLRPAAANPGTIVEVRDLFFATPARLKFLKTEKAEAGAITEIVKRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V F  S   S+R  + F +T  +   R++QV+G+DF +NA+ L+    EI+L G+ G+P
Sbjct: 181 AVRFVLS--GSDRTTLEFPATGDDHLARMAQVLGKDFRDNAIALDAVREEISLTGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+   Y F+NGR VQDK ILS IR AYAETIP GR+PV VL + +DP  VDVNVH
Sbjct: 239 TFNRGNSAHQYAFVNGRPVQDKLILSAIRGAYAETIPSGRHPVAVLSITLDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           PAKS +RFR+P ++R  I+ +I++A+ + G   ++  +  M+ SF     P+   P+ A 
Sbjct: 299 PAKSDVRFRDPGLVRGLIVGAIREALARDGSRAATTGASDMLRSFRPGFQPQAQRPQTAW 358

Query: 361 SLTNT-----QEKLFLQENRLSTNDLL--PSD--DPTYSEDNDPVEESEATHYQLGIACA 411
           S   +     Q      E   ++ D L  P+   +P +S    P        Y LG A A
Sbjct: 359 SAETSPFRPYQPTTGFSERPQASFDGLSMPTARAEPPFSPQ--PAAADTTARYPLGAARA 416

Query: 412 QIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECA 471
           QIH NYI++QT DGLVIVDQHAAHERL+FE MR+  +S ++ SQ LL PEI+D+ E +C 
Sbjct: 417 QIHANYIVAQTEDGLVIVDQHAAHERLVFEAMRKALHSKRLASQVLLIPEIVDIPEEDCD 476

Query: 472 LIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQD 531
            +M+H  +L  LG+  ERFGP AIA+RE PA+L + +   L+R + DEI +  T   L  
Sbjct: 477 RLMQHAAELAELGLAIERFGPGAIAVRETPAMLGEVDAHGLIRQLADEIAEWDTASGLSA 536

Query: 532 RIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKL 591
           ++E + ATMAC+GS+RSGR+++  EMN LLREME  P S QCNHGRPT+I+LKLSDIE+L
Sbjct: 537 KLEYVAATMACHGSVRSGRRLRPEEMNALLREMEVTPGSGQCNHGRPTYIELKLSDIERL 596

Query: 592 FGR 594
           FGR
Sbjct: 597 FGR 599


>gi|222147678|ref|YP_002548635.1| DNA mismatch repair protein [Agrobacterium vitis S4]
 gi|254766154|sp|B9JSD6|MUTL_AGRVS RecName: Full=DNA mismatch repair protein mutL
 gi|221734666|gb|ACM35629.1| DNA mismatch repair protein MutL [Agrobacterium vitis S4]
          Length = 617

 Score =  632 bits (1631), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 307/618 (49%), Positives = 427/618 (69%), Gaps = 26/618 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I++LSE +INQIAAGE+IERP+ A KELIEN++DA +SR+E   AGGGK+  +ITDNG
Sbjct: 1   MSIKQLSETLINQIAAGEVIERPASAAKELIENAIDAGASRIEIATAGGGKALLRITDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM  +++ +AV+RHCTSK+++   +I + GFRGEALPSIG+V+ LT+ SR   + +  Q
Sbjct: 61  CGMDGQDLALAVRRHCTSKLNESLMDIKSLGFRGEALPSIGSVARLTIASRRADSASAFQ 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA+ G K+  VRP   NPGT+VEVRDLFF  PARL FLK+E+ E   IT++++RMAIA+P
Sbjct: 121 IAVEGGKVGEVRPAPGNPGTVVEVRDLFFATPARLKFLKTERAEAAAITEMVKRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
           K+ F  S   S+R  +   +T  +   RI+QV+G DF +NA+ L+ +  ++ L G+ G+P
Sbjct: 181 KIRFVLS--GSDRSTLELPATGDDHLARIAQVLGPDFRDNAIALDAEREDVHLGGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+   Y F+NGR VQDK ILS IR AYAET+P GRYPV VL L +DP  VDVNVH
Sbjct: 239 TFNRGNSAHQYAFVNGRPVQDKLILSAIRGAYAETVPHGRYPVAVLALTVDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH-----------QDN 349
           PAKS +RFR+P ++R  I+ +I++++ ++G  +S+  +  M+ +F            Q  
Sbjct: 299 PAKSDVRFRDPGLVRGLIVGAIRQSLTREGDRSSTAGAGAMLRAFRPGANGGFSEGAQAA 358

Query: 350 APKTHLPKY--------ATSL-TNTQEKLFLQENRLSTNDLLPSDDPTY---SEDNDPVE 397
           A  ++ P Y        A S+ T+    L   +NR     L  +    +   S+ ++PV 
Sbjct: 359 ANNSYAPAYGARPPQPSAWSVDTSPHRPLDDGQNRFDGLALPAARADAHVSPSQISEPVA 418

Query: 398 ES-EATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQT 456
            + E+  ++LG A AQ+H NYI++QT DGLVIVDQHAAHERL+FE MR+  +  ++ SQ 
Sbjct: 419 MAMESGRFRLGAARAQVHANYIVAQTQDGLVIVDQHAAHERLVFEDMRKALSGRRLPSQG 478

Query: 457 LLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDI 516
           LL PEII L E +C  +M+H E+L RLG+  ERFGP AIA+RE PA+L + ++P L+R +
Sbjct: 479 LLIPEIIGLPEEDCDRLMDHAENLDRLGLAIERFGPGAIAVRETPAMLGEVDVPGLVRQL 538

Query: 517 IDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHG 576
            DEI +  T  +L  R+E++ ATMAC+GS+RSGR ++  EMN LLR+ME+ P S QCNHG
Sbjct: 539 ADEIAEWETAGSLFARLEHVAATMACHGSVRSGRLLRVEEMNALLRKMEETPGSGQCNHG 598

Query: 577 RPTFIKLKLSDIEKLFGR 594
           RPT+I+LKLSDIE+LFGR
Sbjct: 599 RPTYIELKLSDIERLFGR 616


>gi|86356494|ref|YP_468386.1| DNA mismatch repair protein [Rhizobium etli CFN 42]
 gi|123765850|sp|Q2KBX7|MUTL_RHIEC RecName: Full=DNA mismatch repair protein mutL
 gi|86280596|gb|ABC89659.1| DNA mismatch repair protein [Rhizobium etli CFN 42]
          Length = 610

 Score =  631 bits (1627), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 303/611 (49%), Positives = 413/611 (67%), Gaps = 19/611 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+LSE +INQIAAGE+IERP+ A KELIEN+LDA ++R+E   AGGGK+  +++DNG
Sbjct: 1   MAIRQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIATAGGGKALLRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM + ++ +A++RHCTSKIS+   +I T GFRGEALPSIG+V+ L++ SR   +  G +
Sbjct: 61  SGMDAADLELAIRRHCTSKISETLEDIRTLGFRGEALPSIGSVARLSIASRKRDSAGGHE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA++G K+  +RP   NPGTIVEVRDLFF  PARL FLK+E+ E   IT++++RMAIA+P
Sbjct: 121 IAVAGGKVLHLRPAGANPGTIVEVRDLFFATPARLKFLKTEKAEAGAITEIVKRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V F  S   S+R  + F +T  +   R++QV+G+DF +NA+ L+    EI+L G+ G+P
Sbjct: 181 AVRFVLS--GSDRATLEFPATGDDHLARMAQVLGKDFSDNAIALDAVREEISLTGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+   Y F+NGR VQDK ILS IR AYAETIP GRYPV VL + +DP  VDVNVH
Sbjct: 239 TFNRGNSAHQYAFVNGRPVQDKLILSAIRGAYAETIPSGRYPVAVLSIALDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           PAKS +RFR+P ++R  I+ +I++A+ + G   ++  +  M+ +F     P    P+   
Sbjct: 299 PAKSDVRFRDPGLVRGLIVGAIREALARDGSRAATTGASDMLRAFRPGFQPYGQRPQAPW 358

Query: 361 SLTNTQEKLF-----LQENRLSTNDLLPSD----DPTYSEDN--------DPVEESEATH 403
           S   +  + +       E   ++ D L +     +P +S D          PV       
Sbjct: 359 SAETSPSRPYQPAPAFSERPQASFDGLSTPTARAEPQFSPDPVSPGLASPRPVAPETVGR 418

Query: 404 YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEII 463
           Y LG A AQIH NYI++QT DGLVIVDQHAAHERL+FE MR+  +S ++ SQ LL PEI+
Sbjct: 419 YPLGAARAQIHANYIVAQTEDGLVIVDQHAAHERLVFEAMRKALHSKRLASQVLLIPEIV 478

Query: 464 DLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDS 523
           D+ E +C  +M H  +   LG+  ERFGP AIA+RE PA+L + +   L+R + DEI + 
Sbjct: 479 DIPEEDCDRLMLHAAEFAELGLAIERFGPGAIAVRETPAMLGEVDAHGLIRQLADEIAEW 538

Query: 524 STTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKL 583
            T   L  ++E + ATMAC+GS+RSGR+++  EMN LLREME  P S QCNHGRPT+I+L
Sbjct: 539 DTASGLSAKLEYVAATMACHGSVRSGRRLRPEEMNALLREMEVTPGSGQCNHGRPTYIEL 598

Query: 584 KLSDIEKLFGR 594
           KLSDIE+LFGR
Sbjct: 599 KLSDIERLFGR 609


>gi|218682547|ref|ZP_03530148.1| DNA mismatch repair protein [Rhizobium etli CIAT 894]
          Length = 600

 Score =  630 bits (1626), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 309/606 (50%), Positives = 417/606 (68%), Gaps = 19/606 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+LSE +INQIAAGE+IERP+ A KELIEN+LDA ++R+E   A GGK+  +++DNG
Sbjct: 1   MAIRQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIATASGGKALLRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM + ++ +AV+RHCTSK+SD   +I T GFRGEALPSIG+V+ L++ SR   +  G +
Sbjct: 61  SGMDAADLELAVRRHCTSKLSDTLEDIRTLGFRGEALPSIGSVARLSIASRRRDSAGGHE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA++  KI+ +RP A NPGTIVEVRDLFF  PARL FLKSE+ E   IT++++RMAIA+P
Sbjct: 121 IAVNAGKITHLRPAAANPGTIVEVRDLFFATPARLKFLKSEKAEAGAITEIVKRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V F  S   S+R  + F +T  +   R++QV+G++F +NA+ L+    EI+L G+ G+P
Sbjct: 181 AVRFVLS--GSDRATLEFPATGDDHLARMAQVLGKEFRDNAIALDAVREEISLTGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+   Y F+NGR VQDK ILS IR AYAETIP GRYPV VL + +DP  VDVNVH
Sbjct: 239 TFNRGNSAHQYAFVNGRPVQDKLILSAIRGAYAETIPSGRYPVAVLSITLDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH---QDNAPKTHLPK 357
           PAKS +RFR+P ++R  I+ +I++A+ + G   ++  +  M+ +F    Q  AP+   P+
Sbjct: 299 PAKSDVRFRDPGLVRGLIVGAIREALARDGSRAATTGASDMLRAFRPGFQSYAPR---PQ 355

Query: 358 YATSLTNT-----QEKLFLQENRLSTNDLL----PSDDPTYSEDNDPVEESEATHYQLGI 408
            A S   +     Q  + L E   ++ D L       +P +S          A  Y LG 
Sbjct: 356 TAWSAETSPSRPYQPAMGLSERPQASFDGLSMPTARAEPQFSPQP--AAPEPAARYPLGA 413

Query: 409 ACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEG 468
           A AQIH NYI++QT DGLVIVDQHAAHERL+FE MR+  +S ++ SQ LL PEIID+ E 
Sbjct: 414 ARAQIHANYIVAQTEDGLVIVDQHAAHERLVFEAMRKALHSKRLASQVLLIPEIIDIPEE 473

Query: 469 ECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYT 528
           +C  +M+H  +L  LG+  ERFGP AIA+RE PA+L + +   L+R + DEI +  T   
Sbjct: 474 DCDRLMQHAAELSELGLSIERFGPGAIAVRETPAMLGEVDAHGLIRQLADEIAEWDTASG 533

Query: 529 LQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDI 588
           L  ++E + ATMAC+GS+RSGR+++  EMN LLREME  P S QCNHGRPT+I+LKLSDI
Sbjct: 534 LSAKLEYVAATMACHGSVRSGRRLRPEEMNALLREMEVTPGSGQCNHGRPTYIELKLSDI 593

Query: 589 EKLFGR 594
           E+LFGR
Sbjct: 594 ERLFGR 599


>gi|222085025|ref|YP_002543554.1| DNA mismatch repair protein [Agrobacterium radiobacter K84]
 gi|254766153|sp|B9JA11|MUTL_AGRRK RecName: Full=DNA mismatch repair protein mutL
 gi|221722473|gb|ACM25629.1| DNA mismatch repair protein [Agrobacterium radiobacter K84]
          Length = 606

 Score =  629 bits (1622), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 301/609 (49%), Positives = 426/609 (69%), Gaps = 19/609 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I++LSE +INQIAAGE+IERP+ A KELIEN+LDA ++R+E   AGGGK+  +++DNG
Sbjct: 1   MTIKQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIATAGGGKALLRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM   ++ +A++RHCTSKISD   +I T GFRGEALPSIG+V+ L++ SR   +  GA+
Sbjct: 61  SGMEQADLELAIKRHCTSKISDTLDDIRTLGFRGEALPSIGSVARLSIASRRVGSAGGAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA++G K+  +RP A NPGTIVEVRDLFF  PARL FLK+E+ E   IT+V++RMAIA+P
Sbjct: 121 IAVAGGKVLHLRPAAANPGTIVEVRDLFFATPARLKFLKTEKAEAAAITEVVKRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
           +V F  S   S+R  + F +T  +   R++QV+G+DF +NA+EL+ +  ++ L G+ G+P
Sbjct: 181 QVRFVLS--GSDRSTLEFPATGDDRLARMAQVLGKDFKDNAIELDAEREDVRLTGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+   Y F+NGR VQDK ILS IR AYAETIP GRYP+ VL + +DP  +DVNVH
Sbjct: 239 TFNRGNSAHQYAFVNGRPVQDKLILSAIRGAYAETIPSGRYPIAVLSITLDPALLDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF-------HQDNAPKT 353
           PAKS +RFR+P ++R  I+ +I++A+ ++G   ++  +  M+ +F        + +AP  
Sbjct: 299 PAKSDVRFRDPGLVRGLIVGAIREALAREGDRAATTGADGMLRAFTSGFQPGWRPSAPSA 358

Query: 354 HL-PK------YATSLTNTQEKLFLQENRLSTNDL-LPSDDPTYSEDNDPVEESEATHYQ 405
              P+      Y  ++TN     F +  + + + L +P+     +   +P +  E   + 
Sbjct: 359 PWTPEASPSRPYQPAVTNGYS--FRERPQAAFDGLTMPTARAESTPFVEPTQSEEPARFP 416

Query: 406 LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDL 465
           LG A AQ+H+NYI++QT DGLVIVDQHAAHERL+FE+MR+  +S +++SQ LL PEI+DL
Sbjct: 417 LGAARAQLHENYIVAQTDDGLVIVDQHAAHERLVFEEMRKALHSKRLSSQVLLIPEIVDL 476

Query: 466 LEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSST 525
            E +C  +M   ++L  LG+  ERFGP AIA+RE PA+L + +   L+R + DEI +  T
Sbjct: 477 PEEDCDRLMVFADELGELGLAIERFGPGAIAVRETPAMLGEVDAQGLIRQLADEIAEWDT 536

Query: 526 TYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKL 585
              L  ++E + ATMAC+GS+RSGR+++  EMN LLR+ME  P S QCNHGRPT+I+LKL
Sbjct: 537 ASGLAAKLEYVAATMACHGSVRSGRRLRPEEMNALLRQMEATPGSGQCNHGRPTYIELKL 596

Query: 586 SDIEKLFGR 594
           SDIE+LFGR
Sbjct: 597 SDIERLFGR 605


>gi|227821008|ref|YP_002824978.1| DNA mismatch repair protein [Sinorhizobium fredii NGR234]
 gi|254766173|sp|C3MGW0|MUTL_RHISN RecName: Full=DNA mismatch repair protein mutL
 gi|227340007|gb|ACP24225.1| DNA mismatch repair protein MutL [Sinorhizobium fredii NGR234]
          Length = 600

 Score =  626 bits (1614), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 302/605 (49%), Positives = 415/605 (68%), Gaps = 17/605 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I++LSE +INQIAAGE+IERP+ A KELIEN+LDA ++R+E   AGGGK+  ++TDNG
Sbjct: 1   MAIKQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEVATAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM+  ++ +A++RHCTSKI D  ++I T GFRGEALPSIG+V+ L++ +R      GA 
Sbjct: 61  NGMSPADLELAIRRHCTSKIDDTLTDIRTLGFRGEALPSIGSVARLSITTRTAGAREGAA 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I++ G K  SVRP   N GT+VEVRDLFF  PARL F+K+E+ E   I++V+RRMAIA+P
Sbjct: 121 ISVIGGKTESVRPSPANVGTVVEVRDLFFATPARLKFMKTEKAEAAAISEVVRRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
           KV F  S   S+R  + F +T  +   R++QV+G+DF +NA+ ++ +  E  L G+ G+P
Sbjct: 181 KVRFVVS--GSDRSTLEFPATGDDRLARMAQVLGKDFRDNAIGIDAEREEARLSGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+ Q Y F+NGR VQDK ILS IR AYAETIP GRYPV VL + +DP  VDVNVH
Sbjct: 239 TFNRGNSLQQYAFVNGRPVQDKLILSAIRAAYAETIPQGRYPVAVLSIALDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF---------HQDNAP 351
           PAKS +RFR+P +IR  II +I++A+++ G   ++  ++ M+ SF         H+  AP
Sbjct: 299 PAKSDVRFRDPGLIRGLIIGAIREALSRGGDRAATTGAQGMMRSFRPEAYRAEPHRAQAP 358

Query: 352 KTHLPK-YATSLTNTQEKLFLQENRLSTNDLL-PSDDPTYSEDNDPVEESEATHYQLGIA 409
            T     Y     +   + F +  + +  +   P+  P  +  N  VE +    + LG A
Sbjct: 359 WTAATSPYRPMRFDEPARGFAEAPQAAFQEFAQPAARPAETAPNGTVEPA----FPLGAA 414

Query: 410 CAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGE 469
            AQ+H+NYI++QT +GLVIVDQHAAHERL+FE MR   +S  + +Q LL PEI+DL E +
Sbjct: 415 RAQLHENYIVAQTEEGLVIVDQHAAHERLVFEAMRTALHSRPVPAQALLIPEIVDLAEDD 474

Query: 470 CALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTL 529
           C  +M H E+  RLG+  ERFGP AIA+RE PA+L + +   L+R + DE+ +  T   L
Sbjct: 475 CDRLMAHAEEFLRLGLSIERFGPGAIAVRETPAMLGEMDASGLVRQLADELAEWDTANGL 534

Query: 530 QDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIE 589
             R++ + ATMAC+GS+RSGR+M+  EMN LLR+ME  P S QCNHGRPT+I+LKL+DIE
Sbjct: 535 AGRLDYLAATMACHGSVRSGRRMRPEEMNALLRQMEATPGSGQCNHGRPTYIELKLADIE 594

Query: 590 KLFGR 594
           +LFGR
Sbjct: 595 RLFGR 599


>gi|159184423|ref|NP_353724.2| DNA mismatch repair protein [Agrobacterium tumefaciens str. C58]
 gi|25090766|sp|Q8UHI3|MUTL_AGRT5 RecName: Full=DNA mismatch repair protein mutL
 gi|159139736|gb|AAK86509.2| DNA mismatch repair protein MutL [Agrobacterium tumefaciens str.
           C58]
          Length = 606

 Score =  623 bits (1606), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 304/607 (50%), Positives = 419/607 (69%), Gaps = 15/607 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I++LSE +INQIAAGE+IERPS A KEL+EN++DA ++R+E   AGGGK   +ITDNG
Sbjct: 1   MAIKQLSETLINQIAAGEVIERPSSATKELVENAIDAGATRIEIATAGGGKGLVRITDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM+  ++ +AV+RHCTSKIS    +I T GFRGEALPSIG+V+ LT+ SR      G+ 
Sbjct: 61  SGMSPADLELAVRRHCTSKISTTLDDIRTLGFRGEALPSIGSVAKLTITSRQQGAEQGSV 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I+++G K+S VRP A N GTIVEVRDLFF  PARL FLK+E+ E   IT+V++RMAIA+P
Sbjct: 121 ISVTGGKVSDVRPAASNAGTIVEVRDLFFATPARLKFLKTERAEAAAITEVVKRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            + F  S   ++R  +   ST  +   R++Q++G +F +NA+E++    ++TL G+ G+P
Sbjct: 181 HIRFVLS--GTDRSTLEIPSTGDDHLARMAQILGAEFKDNAIEIDAGREDVTLTGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN++  YVF+NGR VQDK +LS IR AYAET+P GRYPV VL + +DP  VDVNVH
Sbjct: 239 TFNRGNSSHQYVFVNGRPVQDKLLLSAIRGAYAETVPHGRYPVAVLSITLDPAFVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPK--- 357
           PAKS +RFR+P +IR  I+ +I++A+ + G   ++  + +M+++F    +P    P    
Sbjct: 299 PAKSDVRFRDPGLIRGLIVGAIRQALTRDGDRAATTGASQMMNAFRPGYSPSGLRPSPSA 358

Query: 358 ---YATS----LTNTQEKLFLQENRLSTNDL-LPSD--DPTYSEDNDPVEESEATHYQLG 407
               ATS    L  + +  F +  +   +D+ +P+   +P  + +       E   Y LG
Sbjct: 359 TWSAATSPSRPLAVSGDMQFAEAAQSRFSDITMPTARAEPREAYEASQSPSPEPVLYPLG 418

Query: 408 IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLE 467
            A AQ+H+NYII+QT +GLVIVDQHAAHERL+FE+MR   +S +  SQ LL PEIIDL E
Sbjct: 419 AARAQLHENYIIAQTENGLVIVDQHAAHERLVFEEMRNALHSRRPPSQVLLIPEIIDLPE 478

Query: 468 GECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTY 527
            +C  +M+H      LG+  ERFGP AIA+RE PA+L + N+  L+R + DEI +     
Sbjct: 479 EDCDRLMDHAAGFDALGLVIERFGPGAIAVRETPAMLGEVNVQGLVRQLADEIAEWDAAS 538

Query: 528 TLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSD 587
           TL +++E + ATMAC+GS+RSGR+M+  EMN LLR+ME  P S QCNHGRPT+I+LKLSD
Sbjct: 539 TLANKLEYVAATMACHGSVRSGRRMRPEEMNALLRQMENTPGSGQCNHGRPTYIELKLSD 598

Query: 588 IEKLFGR 594
           IE+LFGR
Sbjct: 599 IERLFGR 605


>gi|325292085|ref|YP_004277949.1| DNA mismatch repair protein [Agrobacterium sp. H13-3]
 gi|325059938|gb|ADY63629.1| DNA mismatch repair protein [Agrobacterium sp. H13-3]
          Length = 609

 Score =  621 bits (1601), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 301/607 (49%), Positives = 416/607 (68%), Gaps = 15/607 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I++LSE +INQIAAGE+IERPS A KEL+EN++DA ++R+E   AGGGK   +ITDNG
Sbjct: 4   MAIKQLSETLINQIAAGEVIERPSSATKELVENAIDAGATRIEIATAGGGKGLVRITDNG 63

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM+  ++ +AV+RHCTSKIS    +I T GFRGEALPSIG+V+ L++ SR      G+ 
Sbjct: 64  SGMSPADLELAVRRHCTSKISTTLDDIRTLGFRGEALPSIGSVAKLSITSRQHGAEQGSV 123

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I+++G K+S VRP A N GTIVEVRDLFF  PARL FLK+E+ E   IT+V++RMAIA+P
Sbjct: 124 ISVTGGKVSEVRPAAANAGTIVEVRDLFFATPARLKFLKTERAEAAAITEVVKRMAIAFP 183

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            + F  S   ++R  +   ST  +   R++Q++G +F +NA+E++    ++TL G+ G+P
Sbjct: 184 HIRFVLS--GTDRSTLEIPSTGDDHLARMAQILGAEFKDNAIEIDAGREDVTLSGFAGVP 241

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+   YVF+NGR VQDK +LS IR AYAET+P GRYPV VL L +DP  VDVNVH
Sbjct: 242 TFNRGNSAHQYVFVNGRPVQDKLLLSAIRGAYAETVPHGRYPVAVLSLTLDPAFVDVNVH 301

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           PAKS +RFR+P ++R  I+ +I++A+ + G   ++  + +M+++F    +P    P  A 
Sbjct: 302 PAKSDVRFRDPGLVRGLIVGAIRQALTRDGDRAATTGASQMMNAFRPGYSPSNLRPSAAA 361

Query: 361 S----------LTNTQEKLFLQENRLSTNDL-LPSD--DPTYSEDNDPVEESEATHYQLG 407
           +          L  +    F +  +   +D+ +P+   +P    +       E + Y LG
Sbjct: 362 TWSAAASPSRPLAVSGNMQFAEAVQSRFSDITMPTARAEPREVYEASASPSLEPSQYPLG 421

Query: 408 IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLE 467
            A AQ+HQNYI++QT DGLVIVDQHAAHERL+FE+MR   +S +  SQ LL PEIIDL E
Sbjct: 422 AARAQLHQNYIVAQTEDGLVIVDQHAAHERLVFEEMRNALHSRRPPSQVLLIPEIIDLPE 481

Query: 468 GECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTY 527
            +C  +M+H      LG+  ERFGP A+A+RE PA+L + N+  L+R + DEI +     
Sbjct: 482 EDCDRLMDHAAGFDALGLVIERFGPGAVAVRETPAMLGEVNVQGLVRQLADEIAEWDAAS 541

Query: 528 TLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSD 587
           TL +++E + ATMAC+GS+RSGR+M+  EMN LLR+ME  P S QCNHGRPT+I+LKLSD
Sbjct: 542 TLANKLEYVAATMACHGSVRSGRRMRPEEMNALLRQMENTPGSGQCNHGRPTYIELKLSD 601

Query: 588 IEKLFGR 594
           IE+LFGR
Sbjct: 602 IERLFGR 608


>gi|150395653|ref|YP_001326120.1| DNA mismatch repair protein [Sinorhizobium medicae WSM419]
 gi|166232108|sp|A6U6K5|MUTL_SINMW RecName: Full=DNA mismatch repair protein mutL
 gi|150027168|gb|ABR59285.1| DNA mismatch repair protein MutL [Sinorhizobium medicae WSM419]
          Length = 605

 Score =  613 bits (1580), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 294/609 (48%), Positives = 414/609 (67%), Gaps = 20/609 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I++LSE +INQIAAGE+IERP+ A KELIEN+LDA ++R+E   AGGGK+  ++TDNG
Sbjct: 1   MAIKQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIATAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM+  ++ +A++RHCTSK+    ++I T GFRGEALPSIG+V+ L++ +R  +   GA 
Sbjct: 61  LGMSPADLELAIRRHCTSKLDGSLADIRTLGFRGEALPSIGSVARLSITTRTAEAREGAT 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I I+G +   VRP A   GT+VEVR+LFF  PARL F+KSE+ ET  I++V+RRMAIA+P
Sbjct: 121 ITITGGRSDPVRPSAAVVGTVVEVRELFFATPARLKFMKSERAETAAISEVVRRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
           KV F  S   S+R  + F +T  +   R++QV+G DF +NA+E++ +     L G+ G+P
Sbjct: 181 KVRFVLS--GSDRSALEFPATGDDRLARMAQVLGRDFRDNAIEIDAEREGARLTGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+ Q Y F+NGR VQDK I+S IR AYAET+P GRYPV VL L IDP  VDVNVH
Sbjct: 239 TFNRGNSLQQYAFVNGRPVQDKLIMSAIRAAYAETVPQGRYPVAVLSLTIDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF----HQDNAPKTHLP 356
           PAKS +RFR+P +IR  II +I++A+ ++G   ++  ++ ++ +F    H+ +  +   P
Sbjct: 299 PAKSDVRFRDPGLIRGLIIGAIREALMREGDRAATTGAQGLMRAFRPEFHRGDQQRPQEP 358

Query: 357 KYATSLT------NTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVE-----ESEATHYQ 405
             A +            + F +  + + +D      P+      PV+     + +A  + 
Sbjct: 359 WTAATSPYRPFSPGGAARGFAETPQAAFSDFA---QPSARNAAVPVDSIQAADGQAASFP 415

Query: 406 LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDL 465
           LG A AQ+H+NYI++QT DGLVIVDQHAAHERL+FE MR   ++  + +Q LL PEI+DL
Sbjct: 416 LGAARAQLHENYIVAQTDDGLVIVDQHAAHERLVFETMRTALHARPVPAQALLIPEIVDL 475

Query: 466 LEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSST 525
            E +C  ++ H  +  RLG+  ERFGP AIA+RE PA+L + +   L+R + DE+ +  T
Sbjct: 476 PEEDCDRLVAHAGEFTRLGLAIERFGPAAIAVRETPAMLGEMDAAGLVRQLADELAEWDT 535

Query: 526 TYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKL 585
              L  R+E + ATMAC+GS+RSGR++++ EMN LLR ME  P S QCNHGRPT+I+LKL
Sbjct: 536 ADGLAGRLEYLAATMACHGSVRSGRRLRTEEMNALLRRMEATPGSGQCNHGRPTYIELKL 595

Query: 586 SDIEKLFGR 594
           +DIE+LFGR
Sbjct: 596 ADIERLFGR 604


>gi|15964569|ref|NP_384922.1| DNA mismatch repair protein [Sinorhizobium meliloti 1021]
 gi|307309315|ref|ZP_07588978.1| DNA mismatch repair protein MutL [Sinorhizobium meliloti BL225C]
 gi|307320051|ref|ZP_07599472.1| DNA mismatch repair protein MutL [Sinorhizobium meliloti AK83]
 gi|20455110|sp|Q92RP4|MUTL_RHIME RecName: Full=DNA mismatch repair protein mutL
 gi|15073747|emb|CAC45388.1| Probable DNA mismatch repair protein [Sinorhizobium meliloti 1021]
 gi|306894266|gb|EFN25031.1| DNA mismatch repair protein MutL [Sinorhizobium meliloti AK83]
 gi|306900184|gb|EFN30802.1| DNA mismatch repair protein MutL [Sinorhizobium meliloti BL225C]
          Length = 605

 Score =  607 bits (1565), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 286/606 (47%), Positives = 412/606 (67%), Gaps = 14/606 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I++LSE +INQIAAGE+IERP+ A KELIEN+LDA ++R+E   AGGGK+  ++TDNG
Sbjct: 1   MAIKQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIATAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM+  ++ +A++RHCTSK++D  ++I T GFRGEALPSIG+V+ L++ +R  +   GA 
Sbjct: 61  IGMSPADLELAIRRHCTSKLNDSLADIRTLGFRGEALPSIGSVARLSITTRTAEAREGAA 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ++G +    RP A   GT+VEVRDLFF  PARL F+KSE+ E   I++V+RRMAIA+P
Sbjct: 121 ITVTGGRSEPARPSAAIVGTVVEVRDLFFATPARLKFMKSEKAEAAAISEVVRRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
           +V F  S   S+R  + F +T  +   R++QV+G DF +NA+E++ +     L G+ G+P
Sbjct: 181 RVRFVLS--GSDRTTLEFPATGDDRLARMAQVLGRDFRDNAIEIDAEREGARLTGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+ Q Y F+NGR VQDK I+S +R AYAETIP GRYP+ VL + +DP  VDVNVH
Sbjct: 239 TFNRGNSLQQYAFVNGRPVQDKLIMSALRAAYAETIPQGRYPIAVLSITLDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF----HQDNAPKTHLP 356
           PAKS +RFR+P +IR  II +I++A+ ++G   ++  +  ++ +F    H+    +   P
Sbjct: 299 PAKSDVRFRDPGLIRGLIIGAIREALTREGDRAATTGAHGLMRAFRPEFHRAGQQRPQEP 358

Query: 357 KYATSLTNTQEKL------FLQENRLSTNDLLPSDDPTYSEDNDPVE--ESEATHYQLGI 408
             A +  +   +       F +  + + +D       + +   +     + +A  + LG 
Sbjct: 359 WSAAASPHRPLRFEEAARGFAEAPQAAFSDFAQPSARSAAAAVEATRATDGQAASFPLGA 418

Query: 409 ACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEG 468
           A AQ+H+NYI++QT DGLVIVDQHAAHERL+FE MR   ++  + +Q LL PEI+ L E 
Sbjct: 419 ARAQLHENYIVAQTDDGLVIVDQHAAHERLVFETMRTALHARPVPAQALLIPEIVGLPED 478

Query: 469 ECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYT 528
           +C  +M H E+  RLG+  ERFGP A+A+RE PA+L + +   L+R + DE+ +  T   
Sbjct: 479 DCDRLMAHAEEFTRLGLAIERFGPAAVAVRETPAMLGEMDAAGLVRQLADELAEWDTASG 538

Query: 529 LQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDI 588
           L  R+E + ATMAC+GS+RSGR++++ EMN LLR+ME  P S QCNHGRPT+I+LKL+DI
Sbjct: 539 LAGRLEYLAATMACHGSVRSGRRLRTEEMNALLRQMEATPGSGQCNHGRPTYIELKLADI 598

Query: 589 EKLFGR 594
           E+LFGR
Sbjct: 599 ERLFGR 604


>gi|163758427|ref|ZP_02165515.1| putative DNA mismatch repair protein [Hoeflea phototrophica DFL-43]
 gi|162284716|gb|EDQ34999.1| putative DNA mismatch repair protein [Hoeflea phototrophica DFL-43]
          Length = 620

 Score =  588 bits (1515), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 291/622 (46%), Positives = 401/622 (64%), Gaps = 31/622 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M+I +L E +INQIAAGE+IERP+  +KEL+EN++DA +SRVE   AGGGK+  ++ D+G
Sbjct: 1   MRIHQLPETLINQIAAGEVIERPASVVKELVENAIDAGASRVEIATAGGGKALIRVIDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM +E++ +AV+RHCTSKI     +I T GFRGEALPSIG+V+ LTL SRP       +
Sbjct: 61  RGMDAEDLQLAVRRHCTSKIDQRLDDIRTLGFRGEALPSIGSVARLTLRSRPADAAHANE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I+++G   S ++P A N GT VEVRDLFF  PARL FLKS++ ET  IT+V+RR+AIA+P
Sbjct: 121 ISLAGGVPSPLKPAAANKGTTVEVRDLFFATPARLKFLKSDRAETAAITEVVRRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V FT S    +R  ++  +T  +   RI QV+G +F  N + L+    EI L G+ G+P
Sbjct: 181 SVRFTLS--GPDRSTLDLAATGEDRLARIGQVLGAEFAANTIALDAMREEIELTGHIGLP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           T+N+ N+   Y F+NGR VQDK ILS IR AY++T+P GRYPV VL + +DP  VDVNVH
Sbjct: 239 TWNKANSLSQYAFVNGRPVQDKQILSAIRAAYSDTLPRGRYPVAVLWITLDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKG---------------ISTSSVLSKK----- 340
           PAK+ +RFR+P ++R  ++ +I++A+   G                STS   S +     
Sbjct: 299 PAKADVRFRDPGLVRGLLVGAIRQALLAGGDQASPSARADLVRAFSSTSPAGSDQSLPGS 358

Query: 341 --MISSFHQDNAPKTHLPKYATSLTNTQEKLFLQE------NRLSTNDLLPSDDPTYSED 392
             M  +FH+D         +       Q   +  +         S  +   +  P+   D
Sbjct: 359 SSMPPAFHRDGNSAGLAGGWTGQWAAAQSPSWPLDGAAPGFGEASQAEFEAAAAPSGRFD 418

Query: 393 NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
             P  E +A H  LG A AQ+H+NYI+SQT+DG+VIVDQHAAHERL+FE+++       +
Sbjct: 419 KAPETEPDARH-PLGAARAQVHENYILSQTSDGMVIVDQHAAHERLVFERLKTALREGSV 477

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
            SQ LL PEIIDL E +C  + E   +L   G+  ERFGP AIA+RE PA+L + ++  L
Sbjct: 478 ASQILLLPEIIDLPEDDCDRLAERAGELAGFGLVLERFGPGAIAVRETPAMLGETDVTGL 537

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           +RD+ DEI +  +T  LQ+R+E + +TMAC+GS+RSGR++   EM+ LLREME+ P S Q
Sbjct: 538 VRDLADEITEWDSTGGLQERLEAVASTMACHGSVRSGRRLTREEMDALLREMERTPGSGQ 597

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT+I+LKLSDIEKLF R
Sbjct: 598 CNHGRPTYIELKLSDIEKLFSR 619


>gi|256015004|ref|YP_003105013.1| DNA mismatch repair protein [Brucella microti CCM 4915]
 gi|255997664|gb|ACU49351.1| DNA mismatch repair protein [Brucella microti CCM 4915]
          Length = 623

 Score =  580 bits (1496), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 284/625 (45%), Positives = 407/625 (65%), Gaps = 34/625 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           MKIR LSE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG
Sbjct: 1   MKIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL SRP   ++G +
Sbjct: 61  SGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSRPQDADSGFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + ++G  +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P
Sbjct: 121 VCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFP-ERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ +      ++M    T      ERI QV+G +F  NA+ ++ + + + L G+ GI
Sbjct: 181 HIRFSLAGTDRTPFEMPATGTGAEATLERIGQVLGREFGENALAIDAERDGVRLAGFVGI 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTFNRGNA   + ++NGR V+DK I   +R A+++ I   R+PV VL L +DP  VDVNV
Sbjct: 241 PTFNRGNALHQFAYVNGRPVRDKQIFGALRGAHSDVIARDRHPVAVLFLTLDPALVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH------QDNAP-- 351
           HPAK+ +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F       Q +AP  
Sbjct: 301 HPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRP 360

Query: 352 ---------KTHLPKYATSLT-----------NTQEKLFLQENRLST--NDLLPSDDPTY 389
                    +T  P   +  +           + Q    L+EN  +   +  +P+ D   
Sbjct: 361 ANSYSPASWRTAPPAPRSEWSPQTAHPAHRPLDLQAAPALRENGQAVLGDVAVPAADARA 420

Query: 390 SEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
           S    PV   E     LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++
Sbjct: 421 SVAEAPV---ELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHA 477

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             I  Q LL PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+
Sbjct: 478 RPIAGQMLLIPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLGEMNV 537

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            QL+RD+ DEI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P 
Sbjct: 538 QQLIRDLADEIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPG 597

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S  CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 598 SGTCNHGRPTYIELKLTDIERLFGR 622


>gi|163844405|ref|YP_001622060.1| DNA mismatch repair protein [Brucella suis ATCC 23445]
 gi|189030393|sp|A9WXS2|MUTL_BRUSI RecName: Full=DNA mismatch repair protein mutL
 gi|163675128|gb|ABY39238.1| DNA mismatch repair protein MutL [Brucella suis ATCC 23445]
          Length = 623

 Score =  580 bits (1495), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 283/625 (45%), Positives = 407/625 (65%), Gaps = 34/625 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG
Sbjct: 1   MTIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL SRP   ++G +
Sbjct: 61  SGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSRPQDADSGFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + ++G  +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P
Sbjct: 121 VCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFP-ERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ +      ++M    T      ERI QV+G +F  NA+ ++ + + + L G+ GI
Sbjct: 181 HIRFSLAGTDRTPFEMPATGTGAEATLERIGQVLGREFGENALAIDAERDGVRLAGFVGI 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNRGNA   + ++NGR V+DK I   +R AY++ I   R+PV VL L +DP  VDVNV
Sbjct: 241 PSFNRGNALHQFAYVNGRPVRDKQIFGALRGAYSDVIARDRHPVAVLFLTLDPALVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH------QDNAP-- 351
           HPAK+ +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F       Q +AP  
Sbjct: 301 HPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRP 360

Query: 352 ---------KTHLPKYATSLT-----------NTQEKLFLQENRLST--NDLLPSDDPTY 389
                    +T  P   +  +           + Q    L+EN  +   +  +P+ D   
Sbjct: 361 ANSYSPASWRTAPPAPRSEWSPQTAHPAHRPLDLQAAPALRENGQAVLGDVAVPAADARA 420

Query: 390 SEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
           S    PV   E     LG+A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++
Sbjct: 421 SVAEAPV---ELMQKPLGVARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHA 477

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             I  Q LL PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+
Sbjct: 478 RPIAGQMLLIPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLGEMNV 537

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            QL+RD+ DEI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P 
Sbjct: 538 QQLIRDLADEIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPG 597

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S  CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 598 SGTCNHGRPTYIELKLTDIERLFGR 622


>gi|225686071|ref|YP_002734043.1| DNA mismatch repair protein [Brucella melitensis ATCC 23457]
 gi|256262806|ref|ZP_05465338.1| DNA mismatch repair protein [Brucella melitensis bv. 2 str. 63/9]
 gi|254766161|sp|C0RKF6|MUTL_BRUMB RecName: Full=DNA mismatch repair protein mutL
 gi|225642176|gb|ACO02089.1| DNA mismatch repair protein MutL [Brucella melitensis ATCC 23457]
 gi|263092627|gb|EEZ16848.1| DNA mismatch repair protein [Brucella melitensis bv. 2 str. 63/9]
 gi|326410397|gb|ADZ67461.1| DNA mismatch repair protein [Brucella melitensis M28]
          Length = 623

 Score =  580 bits (1494), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 282/625 (45%), Positives = 406/625 (64%), Gaps = 34/625 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG
Sbjct: 1   MTIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL SRP   ++G +
Sbjct: 61  SGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSRPQDADSGFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + ++G  +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P
Sbjct: 121 VCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFP-ERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ +      ++M    T      ERI QV+G +F  NA+ ++ + + + L G+ GI
Sbjct: 181 HIRFSLAGTDRTPFEMPATGTGAEATLERIGQVLGREFGENALAIDAERDGVRLAGFVGI 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNRGNA   + ++NGR V+DK I   +R AY++ I   R+PV VL L +DP  VDVNV
Sbjct: 241 PSFNRGNALHQFAYVNGRPVRDKQIFGALRGAYSDVIARDRHPVAVLFLTLDPALVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDN---------- 349
           HPAK+ +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F  +           
Sbjct: 301 HPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRP 360

Query: 350 --------------APKTHL-PKYATSL---TNTQEKLFLQENRLST--NDLLPSDDPTY 389
                         AP++   P+ A +     + Q    L+EN  +   +  +P+ D   
Sbjct: 361 ANSYSPASWRTAPPAPRSEWSPQTAQTAHRPLDLQAAPALRENGQAVLGDVAVPASDARA 420

Query: 390 SEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
           S    PV   E     LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++
Sbjct: 421 SVAEAPV---ELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHA 477

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             I  Q LL PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+
Sbjct: 478 RPIAGQMLLIPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLGEMNV 537

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            QL+RD+ DEI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P 
Sbjct: 538 QQLIRDLADEIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPG 597

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S  CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 598 SGTCNHGRPTYIELKLTDIERLFGR 622


>gi|254712072|ref|ZP_05173883.1| DNA mismatch repair protein [Brucella ceti M644/93/1]
 gi|254715142|ref|ZP_05176953.1| DNA mismatch repair protein [Brucella ceti M13/05/1]
 gi|261216852|ref|ZP_05931133.1| DNA mismatch repair protein mutL [Brucella ceti M13/05/1]
 gi|261319719|ref|ZP_05958916.1| DNA mismatch repair protein mutL [Brucella ceti M644/93/1]
 gi|260921941|gb|EEX88509.1| DNA mismatch repair protein mutL [Brucella ceti M13/05/1]
 gi|261292409|gb|EEX95905.1| DNA mismatch repair protein mutL [Brucella ceti M644/93/1]
          Length = 623

 Score =  579 bits (1493), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 284/625 (45%), Positives = 407/625 (65%), Gaps = 34/625 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG
Sbjct: 1   MTIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL SRP   ++G +
Sbjct: 61  SGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSRPQDADSGFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + ++G  +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P
Sbjct: 121 VCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFP-ERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ +      ++M    T      ERI QV+G +F  NA+ ++ + + + L G+ GI
Sbjct: 181 HIRFSLAGTDRTPFEMPATGTGAEATLERIGQVLGREFGENALAIDAERDGVRLAGFVGI 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNRGNA   + ++NGR V+DK I   +R AY++ I   R+PV VL L +DP  VDVNV
Sbjct: 241 PSFNRGNALHQFAYVNGRPVRDKQIFGALRGAYSDVIARDRHPVAVLFLTLDPALVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH------QDNAP-- 351
           HPAK+ +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F       Q +AP  
Sbjct: 301 HPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRP 360

Query: 352 ---------KTHLPKYATSLT-----------NTQEKLFLQENRLST-NDL-LPSDDPTY 389
                    +T  P   +  +           + Q    L+EN  +   D+ +P+ D   
Sbjct: 361 ANSYSPASWRTAPPAPRSEWSPQTAHPAHRPLDLQAAPALRENGQAVLGDVAVPAADARA 420

Query: 390 SEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
           S    PV   E     LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++
Sbjct: 421 SVAEAPV---ELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHA 477

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             I  Q LL PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+
Sbjct: 478 RPIAGQKLLIPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLGEMNV 537

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            QL+RD+ DEI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P 
Sbjct: 538 QQLIRDLADEIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPG 597

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S  CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 598 SGTCNHGRPTYIELKLTDIERLFGR 622


>gi|161620296|ref|YP_001594182.1| DNA mismatch repair protein [Brucella canis ATCC 23365]
 gi|189030392|sp|A9MDX3|MUTL_BRUC2 RecName: Full=DNA mismatch repair protein mutL
 gi|161337107|gb|ABX63411.1| DNA mismatch repair protein MutL [Brucella canis ATCC 23365]
          Length = 623

 Score =  579 bits (1492), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 283/625 (45%), Positives = 406/625 (64%), Gaps = 34/625 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG
Sbjct: 1   MTIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL SRP   ++G +
Sbjct: 61  SGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSRPQDADSGFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + ++G  +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P
Sbjct: 121 VCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFP-ERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ +      ++M    T      ERI QV+G +F  NA+ ++ + + + L G+ GI
Sbjct: 181 HIRFSLAGTDRTPFEMPATGTGAKATLERIGQVLGREFGENALAIDAERDGVRLAGFVGI 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNRGNA   + ++NGR V+DK I   +R AY++ I   R+PV VL L +DP  VDVNV
Sbjct: 241 PSFNRGNALHQFAYVNGRPVRDKQIFGALRGAYSDVIARDRHPVAVLFLTLDPALVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH------QDNAP-- 351
           HPAK+ +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F       Q +AP  
Sbjct: 301 HPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRP 360

Query: 352 ---------KTHLPKYATSLT-----------NTQEKLFLQENRLST--NDLLPSDDPTY 389
                    +T  P   +  +           + Q    L+EN  +   +  +P+ D   
Sbjct: 361 ANSYSPASWRTAPPAPRSEWSPQTAHPAHRPLDLQAAPALRENGQAVLGDVAVPAADARA 420

Query: 390 SEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
           S    PV   E     LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++
Sbjct: 421 SVAEAPV---ELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHA 477

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             I  Q LL PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+
Sbjct: 478 RPIAGQMLLIPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLGEMNV 537

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            QL+RD+ DEI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P 
Sbjct: 538 QQLIRDLADEIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPG 597

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S  CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 598 SGTCNHGRPTYIELKLTDIERLFGR 622


>gi|17989371|ref|NP_542004.1| DNA mismatch repair protein [Brucella melitensis bv. 1 str. 16M]
 gi|23499977|ref|NP_699417.1| DNA mismatch repair protein [Brucella suis 1330]
 gi|62317165|ref|YP_223018.1| DNA mismatch repair protein [Brucella abortus bv. 1 str. 9-941]
 gi|83269147|ref|YP_418438.1| DNA mismatch repair protein [Brucella melitensis biovar Abortus
           2308]
 gi|148558497|ref|YP_001257266.1| DNA mismatch repair protein [Brucella ovis ATCC 25840]
 gi|189022424|ref|YP_001932165.1| DNA mismatch repair protein [Brucella abortus S19]
 gi|237816724|ref|ZP_04595716.1| DNA mismatch repair protein MutL [Brucella abortus str. 2308 A]
 gi|254691352|ref|ZP_05154606.1| DNA mismatch repair protein [Brucella abortus bv. 6 str. 870]
 gi|254695348|ref|ZP_05157176.1| DNA mismatch repair protein [Brucella abortus bv. 3 str. Tulya]
 gi|254698443|ref|ZP_05160271.1| DNA mismatch repair protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254699509|ref|ZP_05161337.1| DNA mismatch repair protein [Brucella suis bv. 5 str. 513]
 gi|254702632|ref|ZP_05164460.1| DNA mismatch repair protein [Brucella suis bv. 3 str. 686]
 gi|254706237|ref|ZP_05168065.1| DNA mismatch repair protein [Brucella pinnipedialis M163/99/10]
 gi|254711470|ref|ZP_05173281.1| DNA mismatch repair protein [Brucella pinnipedialis B2/94]
 gi|254731891|ref|ZP_05190469.1| DNA mismatch repair protein [Brucella abortus bv. 4 str. 292]
 gi|256029899|ref|ZP_05443513.1| DNA mismatch repair protein [Brucella pinnipedialis M292/94/1]
 gi|256043138|ref|ZP_05446080.1| DNA mismatch repair protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|256059548|ref|ZP_05449747.1| DNA mismatch repair protein [Brucella neotomae 5K33]
 gi|256111875|ref|ZP_05452836.1| DNA mismatch repair protein [Brucella melitensis bv. 3 str. Ether]
 gi|256158069|ref|ZP_05455987.1| DNA mismatch repair protein [Brucella ceti M490/95/1]
 gi|256252976|ref|ZP_05458512.1| DNA mismatch repair protein [Brucella ceti B1/94]
 gi|256256537|ref|ZP_05462073.1| DNA mismatch repair protein [Brucella abortus bv. 9 str. C68]
 gi|260544399|ref|ZP_05820220.1| DNA mismatch repair protein mutL [Brucella abortus NCTC 8038]
 gi|260564360|ref|ZP_05834845.1| DNA mismatch repair protein mutL [Brucella melitensis bv. 1 str.
           16M]
 gi|260568459|ref|ZP_05838928.1| DNA mismatch repair protein mutL [Brucella suis bv. 4 str. 40]
 gi|260756962|ref|ZP_05869310.1| DNA mismatch repair protein mutL [Brucella abortus bv. 6 str. 870]
 gi|260759664|ref|ZP_05872012.1| DNA mismatch repair protein mutL [Brucella abortus bv. 4 str. 292]
 gi|260762906|ref|ZP_05875238.1| DNA mismatch repair protein mutL [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260882774|ref|ZP_05894388.1| DNA mismatch repair protein mutL [Brucella abortus bv. 9 str. C68]
 gi|261215721|ref|ZP_05930002.1| DNA mismatch repair protein mutL [Brucella abortus bv. 3 str.
           Tulya]
 gi|261220069|ref|ZP_05934350.1| DNA mismatch repair protein mutL [Brucella ceti B1/94]
 gi|261313678|ref|ZP_05952875.1| DNA mismatch repair protein mutL [Brucella pinnipedialis
           M163/99/10]
 gi|261319079|ref|ZP_05958276.1| DNA mismatch repair protein mutL [Brucella pinnipedialis B2/94]
 gi|261323516|ref|ZP_05962713.1| DNA mismatch repair protein mutL [Brucella neotomae 5K33]
 gi|261749964|ref|ZP_05993673.1| DNA mismatch repair protein mutL [Brucella suis bv. 5 str. 513]
 gi|261753217|ref|ZP_05996926.1| DNA mismatch repair protein mutL [Brucella suis bv. 3 str. 686]
 gi|265986917|ref|ZP_06099474.1| DNA mismatch repair protein mutL [Brucella pinnipedialis M292/94/1]
 gi|265989570|ref|ZP_06102127.1| DNA mismatch repair protein mutL [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993328|ref|ZP_06105885.1| DNA mismatch repair protein mutL [Brucella melitensis bv. 3 str.
           Ether]
 gi|265996583|ref|ZP_06109140.1| DNA mismatch repair protein mutL [Brucella ceti M490/95/1]
 gi|297249893|ref|ZP_06933594.1| DNA mismatch repair protein mutL [Brucella abortus bv. 5 str.
           B3196]
 gi|54037874|sp|P65490|MUTL_BRUSU RecName: Full=DNA mismatch repair protein mutL
 gi|54041515|sp|P65489|MUTL_BRUME RecName: Full=DNA mismatch repair protein mutL
 gi|81309329|sp|Q579M7|MUTL_BRUAB RecName: Full=DNA mismatch repair protein mutL
 gi|123727280|sp|Q2YIH2|MUTL_BRUA2 RecName: Full=DNA mismatch repair protein mutL
 gi|166232081|sp|A5VTW1|MUTL_BRUO2 RecName: Full=DNA mismatch repair protein mutL
 gi|238691508|sp|B2SD15|MUTL_BRUA1 RecName: Full=DNA mismatch repair protein mutL
 gi|17985243|gb|AAL54268.1| DNA mismatch repair protein mutl [Brucella melitensis bv. 1 str.
           16M]
 gi|23463559|gb|AAN33422.1| DNA mismatch repair protein MutL [Brucella suis 1330]
 gi|62197358|gb|AAX75657.1| MutL, DNA mismatch repair protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82939421|emb|CAJ12378.1| DNA mismatch repair protein:ATP-binding region, ATPase-like
           [Brucella melitensis biovar Abortus 2308]
 gi|148369782|gb|ABQ62654.1| DNA mismatch repair protein MutL [Brucella ovis ATCC 25840]
 gi|189020998|gb|ACD73719.1| DNA mismatch repair protein [Brucella abortus S19]
 gi|237787537|gb|EEP61753.1| DNA mismatch repair protein MutL [Brucella abortus str. 2308 A]
 gi|260097670|gb|EEW81544.1| DNA mismatch repair protein mutL [Brucella abortus NCTC 8038]
 gi|260152003|gb|EEW87096.1| DNA mismatch repair protein mutL [Brucella melitensis bv. 1 str.
           16M]
 gi|260155124|gb|EEW90205.1| DNA mismatch repair protein mutL [Brucella suis bv. 4 str. 40]
 gi|260669982|gb|EEX56922.1| DNA mismatch repair protein mutL [Brucella abortus bv. 4 str. 292]
 gi|260673327|gb|EEX60148.1| DNA mismatch repair protein mutL [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260677070|gb|EEX63891.1| DNA mismatch repair protein mutL [Brucella abortus bv. 6 str. 870]
 gi|260872302|gb|EEX79371.1| DNA mismatch repair protein mutL [Brucella abortus bv. 9 str. C68]
 gi|260917328|gb|EEX84189.1| DNA mismatch repair protein mutL [Brucella abortus bv. 3 str.
           Tulya]
 gi|260918653|gb|EEX85306.1| DNA mismatch repair protein mutL [Brucella ceti B1/94]
 gi|261298302|gb|EEY01799.1| DNA mismatch repair protein mutL [Brucella pinnipedialis B2/94]
 gi|261299496|gb|EEY02993.1| DNA mismatch repair protein mutL [Brucella neotomae 5K33]
 gi|261302704|gb|EEY06201.1| DNA mismatch repair protein mutL [Brucella pinnipedialis
           M163/99/10]
 gi|261739717|gb|EEY27643.1| DNA mismatch repair protein mutL [Brucella suis bv. 5 str. 513]
 gi|261742970|gb|EEY30896.1| DNA mismatch repair protein mutL [Brucella suis bv. 3 str. 686]
 gi|262550880|gb|EEZ07041.1| DNA mismatch repair protein mutL [Brucella ceti M490/95/1]
 gi|262764198|gb|EEZ10230.1| DNA mismatch repair protein mutL [Brucella melitensis bv. 3 str.
           Ether]
 gi|263000239|gb|EEZ12929.1| DNA mismatch repair protein mutL [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|264659114|gb|EEZ29375.1| DNA mismatch repair protein mutL [Brucella pinnipedialis M292/94/1]
 gi|297173762|gb|EFH33126.1| DNA mismatch repair protein mutL [Brucella abortus bv. 5 str.
           B3196]
          Length = 623

 Score =  579 bits (1492), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 283/625 (45%), Positives = 406/625 (64%), Gaps = 34/625 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG
Sbjct: 1   MTIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL SRP   ++G +
Sbjct: 61  SGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSRPQDADSGFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + ++G  +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P
Sbjct: 121 VCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFP-ERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ +      ++M    T      ERI QV+G +F  NA+ ++ + + + L G+ GI
Sbjct: 181 HIRFSLAGTDRTPFEMPATGTGAEATLERIGQVLGREFGENALAIDAERDGVRLAGFVGI 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNRGNA   + ++NGR V+DK I   +R AY++ I   R+PV VL L +DP  VDVNV
Sbjct: 241 PSFNRGNALHQFAYVNGRPVRDKQIFGALRGAYSDVIARDRHPVAVLFLTLDPALVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH------QDNAP-- 351
           HPAK+ +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F       Q +AP  
Sbjct: 301 HPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRP 360

Query: 352 ---------KTHLPKYATSLT-----------NTQEKLFLQENRLST--NDLLPSDDPTY 389
                    +T  P   +  +           + Q    L+EN  +   +  +P+ D   
Sbjct: 361 ANSYSPASWRTAPPAPRSEWSPQTAHPAHRPLDLQAAPALRENGQAVLGDVAVPAADARA 420

Query: 390 SEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
           S    PV   E     LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++
Sbjct: 421 SVAEAPV---ELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHA 477

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             I  Q LL PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+
Sbjct: 478 RPIAGQMLLIPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLGEMNV 537

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            QL+RD+ DEI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P 
Sbjct: 538 QQLIRDLADEIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPG 597

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S  CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 598 SGTCNHGRPTYIELKLTDIERLFGR 622


>gi|260166999|ref|ZP_05753810.1| DNA mismatch repair protein [Brucella sp. F5/99]
 gi|261756386|ref|ZP_06000095.1| DNA mismatch repair protein mutL [Brucella sp. F5/99]
 gi|261736370|gb|EEY24366.1| DNA mismatch repair protein mutL [Brucella sp. F5/99]
          Length = 623

 Score =  578 bits (1490), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 283/625 (45%), Positives = 406/625 (64%), Gaps = 34/625 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG
Sbjct: 1   MTIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL SRP   ++G +
Sbjct: 61  SGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSRPQDADSGFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + ++G  +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P
Sbjct: 121 VCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFP-ERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ +      ++M    T      ERI QV+G +F  NA+ ++ + + + L G+ GI
Sbjct: 181 HIRFSLAGTDRTPFEMPATGTGAEATLERIGQVLGREFGENALAIDAERDGVRLAGFVGI 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNRGNA   + ++NGR V+DK I   +R AY++ I   R+PV VL L +DP  VDVNV
Sbjct: 241 PSFNRGNALHQFAYVNGRPVRDKQIFGALRGAYSDVIARDRHPVAVLFLTLDPALVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH------QDNAP-- 351
           HPAK+ +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F       Q +AP  
Sbjct: 301 HPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRP 360

Query: 352 ---------KTHLPKYATSLT-----------NTQEKLFLQENRLST--NDLLPSDDPTY 389
                    +T  P   +  +           + Q    L+EN  +   +  +P+ D   
Sbjct: 361 ANSYSPASWRTAPPAPRSEWSPQTAHPAHRPLDLQAAPALRENGQAVLGDVAVPAADARA 420

Query: 390 SEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
           S    PV   E     LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++
Sbjct: 421 SVAEAPV---ELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHA 477

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             I  Q LL PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+
Sbjct: 478 RPIAGQMLLIPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLDEMNV 537

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            QL+RD+ DEI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P 
Sbjct: 538 QQLIRDLADEIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPG 597

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S  CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 598 SGTCNHGRPTYIELKLTDIERLFGR 622


>gi|153010372|ref|YP_001371586.1| DNA mismatch repair protein [Ochrobactrum anthropi ATCC 49188]
 gi|166232099|sp|A6X3F3|MUTL_OCHA4 RecName: Full=DNA mismatch repair protein mutL
 gi|151562260|gb|ABS15757.1| DNA mismatch repair protein MutL [Ochrobactrum anthropi ATCC 49188]
          Length = 626

 Score =  576 bits (1484), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 286/634 (45%), Positives = 412/634 (64%), Gaps = 49/634 (7%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V  GGGK+  ++TDNG
Sbjct: 1   MPIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTGGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+  +E+P+AV RHCTSK+SDD  +I   GFRGEALPSIG+V+ LTL SRP   ++G +
Sbjct: 61  SGIPVDELPLAVSRHCTSKLSDDVHDIRALGFRGEALPSIGSVAKLTLKSRPQDADSGFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           +++SG  +   RP A+N GTI EVRDLFF  PARL F+K+++ E + ITDV++R+AIA+P
Sbjct: 121 VSVSGGHLDGPRPSALNRGTIAEVRDLFFATPARLKFMKTDRAEASAITDVVKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFP---ERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            V F+ +   ++R  +   +T        ERI+QV+G++F  NA+ ++ + + + L G+ 
Sbjct: 181 HVRFSLA--GTDRTPLELAATGSGAEATLERINQVLGKEFGENALAIDAERDGVRLAGFV 238

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           GIP+ NRGNA   + ++NGR V+DK +   +R AYA+ +   R+PV VL L +DP  VDV
Sbjct: 239 GIPSHNRGNALHQFAYVNGRPVRDKQLFGALRGAYADVMARDRHPVAVLFLTLDPAFVDV 298

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD--------- 348
           NVHPAK+ +RFR+P ++R  I+ +I++A+ + GI  ++  +  M+ +F  +         
Sbjct: 299 NVHPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGADAMLQAFRAEGFQPPSPSF 358

Query: 349 ------------------NAPKT----------HLPKYATSLTNTQEKLFLQENRLSTND 380
                             ++P+T          H P    +  + QE     +  L+T +
Sbjct: 359 TSRPSSAGYASGSWHPAVSSPRTEWSPQTAHPAHRPLDLGAAPSFQES---DQATLATVN 415

Query: 381 LLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIF 440
           +L + D   + D  PVE  +     LG A AQIH NYI+SQT D LVIVDQHAAHERL++
Sbjct: 416 VLAA-DARATRDEAPVELQQ---KPLGAARAQIHANYIVSQTEDSLVIVDQHAAHERLVY 471

Query: 441 EKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREI 500
           E ++   +S  I+ Q LL PEI+DL E +   +  H E L R G+  E+FGP AIA+RE 
Sbjct: 472 EALKNALHSRPISGQMLLIPEIVDLPEEDAERLATHAETLARFGLGIEQFGPGAIAVRET 531

Query: 501 PAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRL 560
           PA+L + N+ QL+RD+ DEI +  T+  L+  + ++ ATMAC+GS+RSGR+++  EMN L
Sbjct: 532 PAMLGEMNVQQLIRDLSDEIAEHDTSEGLKAMLNHVAATMACHGSVRSGRRLKPEEMNAL 591

Query: 561 LREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LREME  P S  CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 592 LREMEATPGSGTCNHGRPTYIELKLTDIERLFGR 625


>gi|326553690|gb|ADZ88329.1| DNA mismatch repair protein [Brucella melitensis M5-90]
          Length = 618

 Score =  574 bits (1479), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 279/620 (45%), Positives = 404/620 (65%), Gaps = 34/620 (5%)

Query: 6   LSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTS 65
           +SE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG G+ +
Sbjct: 1   MSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNGSGIPA 60

Query: 66  EEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAISG 125
           +E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL SRP   ++G ++ ++G
Sbjct: 61  DELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSRPQDADSGFEVCVTG 120

Query: 126 EKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVSFT 185
             +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P + F+
Sbjct: 121 GHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFPHIRFS 180

Query: 186 FSTIKSNRYKMNFQSTNGNFP-ERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNR 244
            +      ++M    T      ERI QV+G +F  NA+ ++ + + + L G+ GIP+FNR
Sbjct: 181 LAGTDRTPFEMPATGTGAEATLERIGQVLGREFGENALAIDAERDGVRLAGFVGIPSFNR 240

Query: 245 GNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKS 304
           GNA   + ++NGR V+DK I   +R AY++ I   R+PV VL L +DP  VDVNVHPAK+
Sbjct: 241 GNALHQFAYVNGRPVRDKQIFGALRGAYSDVIARDRHPVAVLFLTLDPALVDVNVHPAKA 300

Query: 305 YIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDN--------------- 349
            +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F  +                
Sbjct: 301 DVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRPANSYS 360

Query: 350 ---------APKTHL-PKYATSL---TNTQEKLFLQENRLST-NDL-LPSDDPTYSEDND 394
                    AP++   P+ A +     + Q    L+EN  +   D+ +P+ D   S    
Sbjct: 361 PASWRTAPPAPRSEWSPQTAQTAHRPLDLQAAPALRENGQAVLGDVAVPASDARASVAEA 420

Query: 395 PVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITS 454
           PV   E     LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++  I  
Sbjct: 421 PV---ELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHARPIAG 477

Query: 455 QTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLR 514
           Q LL PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+ QL+R
Sbjct: 478 QMLLIPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLGEMNVQQLIR 537

Query: 515 DIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCN 574
           D+ DEI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P S  CN
Sbjct: 538 DLADEIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPGSGTCN 597

Query: 575 HGRPTFIKLKLSDIEKLFGR 594
           HGRPT+I+LKL+DIE+LFGR
Sbjct: 598 HGRPTYIELKLTDIERLFGR 617


>gi|254719953|ref|ZP_05181764.1| DNA mismatch repair protein [Brucella sp. 83/13]
 gi|265984961|ref|ZP_06097696.1| DNA mismatch repair protein mutL [Brucella sp. 83/13]
 gi|306838542|ref|ZP_07471380.1| DNA mismatch repair protein MutL [Brucella sp. NF 2653]
 gi|264663553|gb|EEZ33814.1| DNA mismatch repair protein mutL [Brucella sp. 83/13]
 gi|306406409|gb|EFM62650.1| DNA mismatch repair protein MutL [Brucella sp. NF 2653]
          Length = 623

 Score =  574 bits (1479), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 278/622 (44%), Positives = 402/622 (64%), Gaps = 28/622 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG
Sbjct: 1   MTIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL SRP   ++G +
Sbjct: 61  SGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSRPQDADSGFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + ++G  +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P
Sbjct: 121 VCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFP-ERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ +      ++M    T      ERI QV+G +F  NA+ ++ + + + L G+ GI
Sbjct: 181 HIRFSLAGTDRTPFEMPATGTGAEATLERIGQVLGREFGENALAIDAERDGVRLAGFVGI 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNRGNA   + ++NGR V+DK I   +R  Y++ I   R+PV VL L +DP  VDVNV
Sbjct: 241 PSFNRGNALHQFAYVNGRPVRDKQIFGALRGTYSDVIARDRHPVAVLFLTLDPALVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH------QDNAPK- 352
           HPAK+ +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F       Q +AP+ 
Sbjct: 301 HPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRP 360

Query: 353 --THLP-KYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPV------------- 396
             ++ P  + T+    + +   Q    +   L     P + E+   V             
Sbjct: 361 ANSYSPASWRTAPPAPRSEWSPQTAHPAHRPLDLQAAPAFRENGQAVLGDVAAPAADARA 420

Query: 397 ----EESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
                  E     LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++  I
Sbjct: 421 SVAEAPVELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHARPI 480

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
             Q LL PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+ QL
Sbjct: 481 AGQILLIPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLGEMNVQQL 540

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           +RD+ DEI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P S  
Sbjct: 541 IRDLADEIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPGSGT 600

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 601 CNHGRPTYIELKLTDIERLFGR 622


>gi|306845535|ref|ZP_07478104.1| DNA mismatch repair protein MutL [Brucella sp. BO1]
 gi|306273856|gb|EFM55683.1| DNA mismatch repair protein MutL [Brucella sp. BO1]
          Length = 623

 Score =  573 bits (1477), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 282/625 (45%), Positives = 405/625 (64%), Gaps = 34/625 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG
Sbjct: 1   MTIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL SR    ++G +
Sbjct: 61  SGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSRSQDADSGFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + ++G  +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P
Sbjct: 121 VCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFP-ERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ +      ++M    T      ERI QV+G +F  NA+ ++ + + + L G+ GI
Sbjct: 181 HIRFSLAGTDRTPFEMPATGTGAEATLERIGQVLGREFGENALAIDAERDGVRLAGFVGI 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNRGNA   + ++NGR V+DK I   +R AY++ I   R+PV VL L +DP  VDVNV
Sbjct: 241 PSFNRGNALHQFAYVNGRPVRDKQIFGALRGAYSDVIARDRHPVAVLFLTLDPALVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH------QDNAP-- 351
           HPAK+ +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F       Q +AP  
Sbjct: 301 HPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRP 360

Query: 352 ---------KTHLPKYATSLT-----------NTQEKLFLQENRLST-NDL-LPSDDPTY 389
                    +T  P   +  +           + Q     +EN  +   D+ +P+ D   
Sbjct: 361 ANSYSPASWRTAPPAPRSEWSPQTAHPAHRPLDLQAAPAFRENEQAVLGDVAVPAADARA 420

Query: 390 SEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
           S    PV   E     LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++
Sbjct: 421 SVAEVPV---ELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHA 477

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             I  Q LL PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+
Sbjct: 478 RPIAGQMLLIPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLGEMNV 537

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            QL+RD+ DEI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P 
Sbjct: 538 QQLIRDLADEIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPG 597

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S  CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 598 SGTCNHGRPTYIELKLTDIERLFGR 622


>gi|110632802|ref|YP_673010.1| DNA mismatch repair protein [Mesorhizobium sp. BNC1]
 gi|123162815|sp|Q11L80|MUTL_MESSB RecName: Full=DNA mismatch repair protein mutL
 gi|110283786|gb|ABG61845.1| DNA mismatch repair protein MutL [Chelativorans sp. BNC1]
          Length = 620

 Score =  573 bits (1476), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 281/620 (45%), Positives = 392/620 (63%), Gaps = 27/620 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR L++ IINQIAAGE+IERP+  +KEL+EN+LDA + R+E   AGGG +  ++ D+G
Sbjct: 1   MPIRALADIIINQIAAGEVIERPASVVKELVENALDAGAKRIEVATAGGGLNLIRVIDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+  EE+P+AV RHCTSK++ D  +I T GFRGEALPSIG+V  LTL SR P  + GA+
Sbjct: 61  GGIPPEELPLAVARHCTSKLTSDIHDIRTLGFRGEALPSIGSVGRLTLRSRTPDADGGAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I + G K S+V+PVA N GT VEVRDLFF  PARL F+KSE+ E   IT+V++R+A+A+P
Sbjct: 121 ITVDGGKASAVKPVAANRGTTVEVRDLFFATPARLKFMKSERAEAAAITEVVKRIALAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGN-FPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            V F  S       ++   S +G+    R+ Q+IG+DF  NA+ ++ +   + L GY  I
Sbjct: 181 AVRFMLSGTDRTSTELPAVSADGDGLLRRLGQIIGKDFAENALPIDAEREGVFLTGYASI 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+F RGNA   + ++NGR V+DK I   IR AY + +P  R+ V  L + +DP  VDVNV
Sbjct: 241 PSFTRGNALAQFAYVNGRPVRDKLIAGAIRGAYMDALPRDRHAVTALFISLDPALVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPK------- 352
           HPAK+ +RFR+P ++R  I+ +I++A+   G+  ++  +  M+ +F     P        
Sbjct: 301 HPAKADVRFRDPGLVRGLIVGAIRQALEGAGVRAATTGAAAMLQAFRVPEGPSRANGAND 360

Query: 353 -THLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE------------- 398
            T  P   T        + L  +R    D  P     ++E    V +             
Sbjct: 361 FTGRPFSGTERPRGGWSMELSPSR-PLEDAFPPAANGFAEAQQVVFDIGSVVSADARAGT 419

Query: 399 ----SEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITS 454
               S+     LG A AQ+H+NYI++QT D LVIVDQHAAHERL++E ++   +S  + S
Sbjct: 420 LEALSDLVGRPLGAARAQVHENYIVAQTEDSLVIVDQHAAHERLVYEALKDAIHSKPLPS 479

Query: 455 QTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLR 514
           Q LL PEI+DL E +   +  H E L RLG   ERFGP AI +RE P++L + +I  L+R
Sbjct: 480 QMLLMPEIVDLPEEDAERLCAHAEFLARLGFGVERFGPGAICVRETPSMLGEVDIAALIR 539

Query: 515 DIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCN 574
           D+ DEI D+ T  +L+ RI++I ATMAC+GSIRSGR+++  EMN LLR+ME  P S  CN
Sbjct: 540 DLADEIADNDTANSLKKRIDHIAATMACHGSIRSGRRLKPEEMNALLRQMEATPGSGTCN 599

Query: 575 HGRPTFIKLKLSDIEKLFGR 594
           HGRPT+I+LKL+DIE+LFGR
Sbjct: 600 HGRPTYIELKLADIERLFGR 619


>gi|306840954|ref|ZP_07473695.1| DNA mismatch repair protein MutL [Brucella sp. BO2]
 gi|306289011|gb|EFM60276.1| DNA mismatch repair protein MutL [Brucella sp. BO2]
          Length = 618

 Score =  571 bits (1472), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 277/617 (44%), Positives = 402/617 (65%), Gaps = 28/617 (4%)

Query: 6   LSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTS 65
           +SE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG G+ +
Sbjct: 1   MSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNGSGIPA 60

Query: 66  EEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAISG 125
           +E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL SRP   ++G ++ ++G
Sbjct: 61  DELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSRPQDADSGFEVCVTG 120

Query: 126 EKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVSFT 185
             +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P + F+
Sbjct: 121 GHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFPHIRFS 180

Query: 186 FSTIKSNRYKMNFQSTNGNFP-ERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNR 244
            +      ++M    T      ERI QV+G +F  NA+ ++ + + + L G+ GIP+FNR
Sbjct: 181 LAGTDRTPFEMPATGTGAEATLERIGQVLGREFGENALAIDAERDGVRLAGFVGIPSFNR 240

Query: 245 GNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKS 304
           GNA   + ++NGR V+DK I   +R AY++ I   R+PV VL L +DP  VDVNVHPAK+
Sbjct: 241 GNALHQFAYVNGRPVRDKQIFGALRGAYSDVIARDRHPVAVLFLTLDPALVDVNVHPAKA 300

Query: 305 YIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH------QDNAPK---THL 355
            +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F       Q +AP+   ++ 
Sbjct: 301 DVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRPANSYS 360

Query: 356 P-KYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDP---------------VEES 399
           P  + T+    + +   Q    +   L     P + ED                  V E+
Sbjct: 361 PASWRTAPPAPRSEWSPQTAHPAHRPLDLQAAPAFREDGQAILGDVAAPAADARASVAEA 420

Query: 400 --EATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTL 457
             E     LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++  I  Q L
Sbjct: 421 PVELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHARPIAGQML 480

Query: 458 LTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDII 517
           L PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+ QL+RD+ 
Sbjct: 481 LIPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLGEMNVQQLIRDLA 540

Query: 518 DEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGR 577
           DEI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P S  CNHGR
Sbjct: 541 DEIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPGSGTCNHGR 600

Query: 578 PTFIKLKLSDIEKLFGR 594
           PT+I+LKL+DIE+LFGR
Sbjct: 601 PTYIELKLTDIERLFGR 617


>gi|294853233|ref|ZP_06793905.1| DNA mismatch repair protein mutL [Brucella sp. NVSL 07-0026]
 gi|294818888|gb|EFG35888.1| DNA mismatch repair protein mutL [Brucella sp. NVSL 07-0026]
          Length = 618

 Score =  570 bits (1470), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 279/620 (45%), Positives = 403/620 (65%), Gaps = 34/620 (5%)

Query: 6   LSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTS 65
           +SE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG G+ +
Sbjct: 1   MSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNGSGIPA 60

Query: 66  EEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAISG 125
           +E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL S P   ++G ++ ++G
Sbjct: 61  DELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSHPQDADSGFEVCVTG 120

Query: 126 EKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVSFT 185
             +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P + F+
Sbjct: 121 GHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFPHIRFS 180

Query: 186 FSTIKSNRYKMNFQSTNGNFP-ERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNR 244
            +      ++M    T      ERI QV+G +F  NA+ ++ + + + L G+ GIP+FNR
Sbjct: 181 LAGTDRTPFEMPATGTGAEATLERIGQVLGREFGENALAIDAERDGVRLAGFVGIPSFNR 240

Query: 245 GNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKS 304
           GNA   + ++NGR V+DK I   +R AY++ I   R+PV VL L +DP  VDVNVHPAK+
Sbjct: 241 GNALHQFAYVNGRPVRDKQIFGALRGAYSDVIARDRHPVAVLFLTLDPALVDVNVHPAKA 300

Query: 305 YIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH------QDNAP------- 351
            +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F       Q +AP       
Sbjct: 301 DVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRPANSYS 360

Query: 352 ----KTHLPKYATSLT-----------NTQEKLFLQENRLST-NDL-LPSDDPTYSEDND 394
               +T  P   +  +           + Q    L+EN  +   D+ +P+ D   S    
Sbjct: 361 PASWRTAPPAPRSEWSPQTAHPAHRPLDLQAAPALRENGQAVLGDVAVPAADARASVAEA 420

Query: 395 PVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITS 454
           PV   E     LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++  I  
Sbjct: 421 PV---ELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHARPIAG 477

Query: 455 QTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLR 514
           Q LL PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+ QL+R
Sbjct: 478 QMLLIPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLGEMNVQQLIR 537

Query: 515 DIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCN 574
           D+ DEI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P S  CN
Sbjct: 538 DLADEIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPGSGTCN 597

Query: 575 HGRPTFIKLKLSDIEKLFGR 594
           HGRPT+I+LKL+DIE+LFGR
Sbjct: 598 HGRPTYIELKLTDIERLFGR 617


>gi|260464400|ref|ZP_05812591.1| DNA mismatch repair protein MutL [Mesorhizobium opportunistum
           WSM2075]
 gi|259029870|gb|EEW31155.1| DNA mismatch repair protein MutL [Mesorhizobium opportunistum
           WSM2075]
          Length = 641

 Score =  570 bits (1468), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 281/628 (44%), Positives = 403/628 (64%), Gaps = 39/628 (6%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+LSE +INQIAAGE+IERP+  +KEL+EN+LDA +S+VE V AGGG +  ++TD+G
Sbjct: 18  MPIRQLSETMINQIAAGEVIERPASVVKELVENALDAGASKVEVVTAGGGLNLIRVTDDG 77

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+   E+ +A+ RHCTSK+++D  +I + GFRGEALPSIG+VS L++ SR    ++ A+
Sbjct: 78  SGIPEHELSLAIARHCTSKLAEDIHDIRSLGFRGEALPSIGSVSRLSIRSRTALGDSAAE 137

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I I G +I  VRP A N GT VEVRDLFF  PARL F+K E+ E++ I+DV++R+AIA+P
Sbjct: 138 IGIEGGRILPVRPAAANRGTTVEVRDLFFATPARLKFMKGERAESSAISDVVKRIAIAFP 197

Query: 181 KVSFTFSTIKSNRYKMNFQSTN----GNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
            V FT +   S+R  +   +T+    G+   R++QV+G +F +N++ ++     + L G+
Sbjct: 198 AVRFTLA--GSDRSTLELPATDESAEGSL-RRVAQVMGAEFPDNSIAIDAMREGVHLTGH 254

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
             IP+F R NA Q Y ++NGR V+DK I   IR A+A+ +P  R+ V VL L +DP  VD
Sbjct: 255 VSIPSFTRANALQQYAYVNGRPVRDKLIAGAIRGAFADVLPRDRHAVTVLFLTLDPGTVD 314

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA------ 350
           VNVHPAK+ +RFR+P ++R  I+ +I++A+   GI +++  +  M+++F    A      
Sbjct: 315 VNVHPAKADVRFRDPGLVRGLIVGAIRQALADAGIRSATTGAAGMMAAFRPSAASYGHGG 374

Query: 351 PKTHLPKYATSLTNTQEKLF-------------LQENRLSTNDLLPSDDPTYSEDNDPVE 397
           P      Y  S   +    F              +        L   D   +  D  P+ 
Sbjct: 375 PANGHRSYEASYHASGSAGFDPARSSQRPLDMGFEGGGFEHRGLREPDQAAF--DAGPLA 432

Query: 398 ESEATHYQ-----------LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQD 446
            ++A   Q           LG A AQ+H+NYI++QT D LVIVDQHAAHERL++E ++  
Sbjct: 433 SADARAGQSEAAETLLGAVLGAARAQVHENYIVAQTRDSLVIVDQHAAHERLVYEALKNA 492

Query: 447 FNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSK 506
            +S  + SQ LL PEIIDL E +   +  H E L R G+  ERFGP A+A+RE P++L +
Sbjct: 493 LHSRPVPSQMLLLPEIIDLPEEDAERLAMHSETLARFGLGIERFGPGAVAVRETPSMLGE 552

Query: 507 KNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEK 566
            N+ QL+RD+ DEI D+ T  TL++R++ I ATMAC+GS+RSGR ++  EMN LLR+ME 
Sbjct: 553 TNVGQLVRDLADEIADNDTVETLKERLDKIAATMACHGSVRSGRLLKPEEMNALLRQMEA 612

Query: 567 NPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            P S  CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 613 TPGSGTCNHGRPTYIELKLADIERLFGR 640


>gi|319784249|ref|YP_004143725.1| DNA mismatch repair protein MutL [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170137|gb|ADV13675.1| DNA mismatch repair protein MutL [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 624

 Score =  569 bits (1467), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 281/628 (44%), Positives = 407/628 (64%), Gaps = 39/628 (6%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+LSE +INQIAAGE+IERP+  +KEL+EN+LDA +SRVE V +GGG +  ++TD+G
Sbjct: 1   MPIRQLSETMINQIAAGEVIERPASVVKELVENALDAGASRVEIVTSGGGLNLIRVTDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+   E+ +A+ RHCTSK+++D ++I + GFRGEALPSIG+VS L++ SR   +++ A+
Sbjct: 61  SGIPERELALAIARHCTSKLTEDINDIRSLGFRGEALPSIGSVSRLSIRSRTAASDSAAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I I G ++  VRP A N GT VEVRDLFF  PARL F+K E+ E++  +DV++R+AIA+P
Sbjct: 121 IGIEGGRVLPVRPAAANRGTTVEVRDLFFATPARLKFMKGERAESSATSDVVKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNF----QSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
            V FT +   S+R  +       S  G+   R++QV+G DF +N++ L+   + + L G+
Sbjct: 181 AVRFTLA--GSDRSTLELPAADDSAEGSL-RRVAQVMGTDFPDNSIALDAMRDGVHLTGH 237

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
             IP+F R NA Q Y ++NGR V+DK I   IR AYA+ +P  R+ V VL L +DP  VD
Sbjct: 238 ASIPSFTRANALQQYAYVNGRPVRDKLIAGAIRGAYADVLPRDRHAVTVLFLTLDPAIVD 297

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF----------- 345
           VNVHPAK+ +RFR+P ++R  I+ +I++A+   G+  ++  +  M+++F           
Sbjct: 298 VNVHPAKADVRFRDPGLVRGLIVGAIRQALADAGVRAATTGAAGMMAAFRPGAASYGHGG 357

Query: 346 ----HQ--DNAPKTHLPKYATSLTNTQEKLFL--QENRLSTNDLLPSDDPTYSEDNDPVE 397
               H+  D A +   P       + Q  L +           L  S+   +  D  P+ 
Sbjct: 358 PANGHRSYDAAYRASGPSGFDPARSPQRPLDMGFDGAGFEQRGLRESEQAAF--DAGPLA 415

Query: 398 ESEATHYQ-----------LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQD 446
            ++A   Q           LG A AQ+H+NYI++QT D L+IVDQHAAHERL++E ++  
Sbjct: 416 SADARAGQDEAAETLLGAVLGAARAQVHENYIVAQTRDSLIIVDQHAAHERLVYEALKNA 475

Query: 447 FNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSK 506
            +S  + SQ LL PEIIDL E +   +  H E L R G+  ERFGP A+A+RE P++L +
Sbjct: 476 LHSRPVPSQMLLLPEIIDLPEEDAERLALHSETLARFGLGIERFGPGAVAVRETPSMLGE 535

Query: 507 KNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEK 566
            N+ QL+RD+ DEI D+ T  TL++R++ I ATMAC+GS+RSGR +++ EMN LLR+ME 
Sbjct: 536 ANVQQLVRDLADEIADNDTVDTLKERLDKIAATMACHGSVRSGRLLKAEEMNALLRQMEA 595

Query: 567 NPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            P S  CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 596 TPGSGTCNHGRPTYIELKLADIERLFGR 623


>gi|13476839|ref|NP_108408.1| DNA mismatch repair protein [Mesorhizobium loti MAFF303099]
 gi|20455124|sp|Q983L2|MUTL_RHILO RecName: Full=DNA mismatch repair protein mutL
 gi|14027600|dbj|BAB53869.1| DNA mismatch repair protein; MutL [Mesorhizobium loti MAFF303099]
          Length = 627

 Score =  568 bits (1464), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 282/629 (44%), Positives = 412/629 (65%), Gaps = 38/629 (6%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+LSE +INQIAAGE+IERP+  +KEL+EN+LDA +SRVE V AGGG +  ++TD+G
Sbjct: 1   MPIRQLSETMINQIAAGEVIERPASVVKELVENALDAGASRVEVVTAGGGLNLIRVTDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+   E+ +A+ RHCTSK+++D ++I + GFRGEALPSIG+VS L++ SR    ++ A+
Sbjct: 61  SGIPEPELALAIARHCTSKLAEDINDIRSLGFRGEALPSIGSVSRLSIRSRTALGDSAAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I I G ++  VRP A N GT VEVRDLFF  PARL F+K E+ E++  +DV++R+AIA+P
Sbjct: 121 IGIEGGRVLPVRPAAANRGTTVEVRDLFFATPARLKFMKGERAESSATSDVVKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQGY 236
            V FT +   S+R  +   +T+ + PE    R++QV+G +F +N++ ++     + L G+
Sbjct: 181 AVRFTLA--GSDRSTLELPATD-DSPEGSLRRVAQVMGAEFPDNSIAIDAMREGVHLTGH 237

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
             IP+F+R NA Q Y ++NGR V+DK I   IR A+A+ +P  R+ V VL L +DP  VD
Sbjct: 238 VSIPSFSRANALQQYAYVNGRPVRDKLIAGAIRGAFADVLPRDRHAVTVLFLTLDPAIVD 297

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD-------- 348
           VNVHPAK+ +RFR+P ++R  I+ +I++A+   GI +++  +  M+++F           
Sbjct: 298 VNVHPAKADVRFRDPGLVRGLIVGAIRQALADAGIRSATTGAAGMMAAFRPGAASYNHGG 357

Query: 349 --NAPKTHLPKYATSLT-------NTQEKLFLQEN---RLSTNDLLPSDDPTYSEDNDPV 396
             N  +++   Y  S +       + Q  L +Q     R        S+    + D  P+
Sbjct: 358 PANGHRSYEAAYRASGSAGFDPARSPQRPLDMQFGDFERAGARHGGFSEPGQAAFDTGPL 417

Query: 397 EESEATHYQ-----------LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQ 445
             ++A   Q           LG A AQ+H+NYI++QT D LVIVDQHAAHERL++E ++ 
Sbjct: 418 VSADARVGQNETTETLLGTVLGAARAQVHENYIVAQTRDSLVIVDQHAAHERLVYEALKN 477

Query: 446 DFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILS 505
             +S  + SQ LL PEIIDL E +   +  H E L R G+  ERFGP A+A+RE P++L 
Sbjct: 478 ALHSRPVPSQMLLLPEIIDLPEEDAERLAMHSETLARFGLGIERFGPGAVAVRETPSMLG 537

Query: 506 KKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREME 565
           + N+ QL+RD+ DEI D+ T  TL++R++ I ATMAC+GS+RSGR +++ EMN LLR+ME
Sbjct: 538 ETNVQQLVRDLADEIADNDTVETLKERLDKIAATMACHGSVRSGRLLKAEEMNALLRQME 597

Query: 566 KNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
             P S  CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 598 ATPGSGTCNHGRPTYIELKLADIERLFGR 626


>gi|239833562|ref|ZP_04681890.1| DNA mismatch repair protein MutL [Ochrobactrum intermedium LMG
           3301]
 gi|239821625|gb|EEQ93194.1| DNA mismatch repair protein MutL [Ochrobactrum intermedium LMG
           3301]
          Length = 626

 Score =  568 bits (1463), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 287/637 (45%), Positives = 410/637 (64%), Gaps = 55/637 (8%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V  GGGK+  ++TDNG
Sbjct: 1   MPIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTGGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+  +E+P+AV RHCTSK+SDD  +I   GFRGEALPSIG+V+ L L SRP   ++G +
Sbjct: 61  SGIPVDELPLAVSRHCTSKLSDDVHDIRALGFRGEALPSIGSVAKLVLKSRPQDADSGFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           +++SG  +   RP A+N GTI EVRDLF+  PARL F+K+++ E + ITDVI+R+AIA+P
Sbjct: 121 VSVSGGHLDGPRPSALNRGTIAEVRDLFYATPARLKFMKTDRAEASAITDVIKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFP---ERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            + F+ +   S+R  +   +T        ERI+QV+G++F  NA+ ++ + + + L G+ 
Sbjct: 181 HIRFSLA--GSDRTPLELAATGSGAEATLERINQVLGKEFGENALAIDAERDGVRLAGFV 238

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           GIP+ NRGNA   + ++NGR V+DK +   +R AYA+ +   R+PV VL L +DP  VDV
Sbjct: 239 GIPSHNRGNALHQFAYVNGRPVRDKQLFGALRGAYADVMARDRHPVAVLFLTLDPALVDV 298

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDN-------- 349
           NVHPAK+ +RFR+P ++R  I+ +I++A+ + GI  ++  +  M+ +F  +         
Sbjct: 299 NVHPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGADAMLQAFRAEGLQPSPSSF 358

Query: 350 -------------------APKT----------HLP-KYATSLTNTQEKLFLQENRLSTN 379
                              AP+T          H P  +ATS  + QE    ++  L+  
Sbjct: 359 ASRSSSTGYASGGWRPAPPAPRTEWSPQTAHPAHRPLDFATS-PSFQES---EQATLAAV 414

Query: 380 DLLPSDDPTYSEDNDPVEESEATHYQ--LGIACAQIHQNYIISQTTDGLVIVDQHAAHER 437
           ++L +D          V E+ A   Q  LG A AQIH NYI+SQT D LVIVDQHAAHER
Sbjct: 415 NVLAADARAT------VHEAPAELQQKPLGAARAQIHANYIVSQTEDSLVIVDQHAAHER 468

Query: 438 LIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAI 497
           L++E ++   +S  I  Q LL PEI+DL E +   +  H E L R G+  E+FGP AI +
Sbjct: 469 LVYEALKNALHSRPIPGQMLLIPEIVDLPEEDAERLATHAETLARFGLGIEQFGPGAIVV 528

Query: 498 REIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEM 557
           RE PA+L + N+ QL+RD+ DEI +  T+  L+  + ++ ATMAC+GS+RSGR+++  EM
Sbjct: 529 RETPAMLGEMNVQQLIRDLSDEIAEHDTSDGLKAMLNHVAATMACHGSVRSGRRLKPEEM 588

Query: 558 NRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           N LLREME  P S  CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 589 NALLREMESTPGSGTCNHGRPTYIELKLTDIERLFGR 625


>gi|49473918|ref|YP_031960.1| DNA mismatch repair protein [Bartonella quintana str. Toulouse]
 gi|81827643|sp|Q6G0J4|MUTL_BARQU RecName: Full=DNA mismatch repair protein mutL
 gi|49239421|emb|CAF25760.1| DNA mismatch repair protein mutL [Bartonella quintana str.
           Toulouse]
          Length = 612

 Score =  564 bits (1453), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 280/619 (45%), Positives = 406/619 (65%), Gaps = 33/619 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  +KEL+EN++DA ++R+E V A GGKSF +++DNG
Sbjct: 1   MIIRHLSENIINQIAAGEVIERPANVVKELVENAIDAGATRIEIVTANGGKSFIKVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++++ +A+ RHCTSKI+DD  NI+  GFRGEALPSIG+V+ L L SR  +     +
Sbjct: 61  CGIPADQLTLAISRHCTSKITDDVHNIYFLGFRGEALPSIGSVAKLKLTSRTQEAENATE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ++  KI   +P A NPGTIVEVRDLFF  PARL F+K+++ ETN I+D+I+R+AIA+P
Sbjct: 121 IIVTAGKIIGPKPAAANPGTIVEVRDLFFVTPARLKFMKTDRAETNAISDMIKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKM--NFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            + F+ S +     ++     ST G   +RI+Q++G++F  N++ LN K   I L G+  
Sbjct: 181 HIRFSLSGLDRTSMELPATANSTQGQL-QRITQIMGKEFAPNSIALNAKRESIRLTGFAC 239

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +P+FNR N+   + ++N R V+DKF+  TIR AYA+ +   RYPV +L +++ P  VDVN
Sbjct: 240 LPSFNRSNSLHQFAYVNRRPVRDKFLWGTIRGAYADVMARDRYPVSILFIDLPPADVDVN 299

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF------------H 346
           VHP K+ +RFR+P +IR  I+ +I +A+++ G+  +S  S+ M+S+F            H
Sbjct: 300 VHPTKADVRFRDPGLIRGLIVGAIHEALHQIGVRPASTCSEAMLSAFQTSQPLGTFKSTH 359

Query: 347 QD-----------NAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDP 395
           Q             A   H P  AT+  N +E+       L     +PS D   + +  P
Sbjct: 360 QTFSSQHHHLASAAASPLHKPLDATNFVNLREEAVPLMECLD----MPSGD-ICTANTTP 414

Query: 396 VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQ 455
              SE  HY LG A AQIH+NYII+QT D L+IVDQHAAHERL++E ++    S  + SQ
Sbjct: 415 --SSEELHYPLGAARAQIHKNYIIAQTQDSLIIVDQHAAHERLVYEALKDALYSKPLPSQ 472

Query: 456 TLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRD 515
            LL PEI++L E +   ++ H + L + G+  E FGP AI +RE P++L + N+  L++D
Sbjct: 473 LLLIPEIVELSEEDATCLLTHKDALQKFGLGIESFGPGAIVVRETPSMLGEVNVQALIKD 532

Query: 516 IIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNH 575
           + DE  +  TT  L+  I+ + ATMAC+GSIRSGR +++ EMN LLR++E  P++  CNH
Sbjct: 533 LADEAAEYDTTNNLKAMIDCVAATMACHGSIRSGRLLRAEEMNALLRQIEATPHTGTCNH 592

Query: 576 GRPTFIKLKLSDIEKLFGR 594
           GRPT+I+LKL+DIE+LFGR
Sbjct: 593 GRPTYIELKLADIERLFGR 611


>gi|119385437|ref|YP_916493.1| DNA mismatch repair protein [Paracoccus denitrificans PD1222]
 gi|119375204|gb|ABL70797.1| DNA mismatch repair protein MutL [Paracoccus denitrificans PD1222]
          Length = 606

 Score =  562 bits (1449), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 266/598 (44%), Positives = 394/598 (65%), Gaps = 9/598 (1%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E   N+IAAGE++ERP+ A+KEL+EN+LDA +SR+E  IA GGK+  +++D+G G
Sbjct: 12  IRQLDEAAANRIAAGEVVERPASAVKELVENALDAGASRIEVAIAKGGKALIRVSDDGCG 71

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT+E++P+A+ RH TSKI   D  +I +FGFRGEALPS+GAV  L++ SR    + GAQI
Sbjct: 72  MTAEDLPLALARHATSKIDGSDLLDIRSFGFRGEALPSLGAVGRLSITSRAAGFD-GAQI 130

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           A++G +I  V+P A N GT+VE+RDLFF  PARL FL+S++ ET  + +VIRR+A+A P 
Sbjct: 131 AVAGGRIGPVKPAAGNRGTVVELRDLFFATPARLKFLRSDRAETQAVAEVIRRLAMAEPY 190

Query: 182 VSFTFSTIKSNRYKMNFQSTNGNF----PERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           V FT S     R      +  G        R+++V+G DFI+NA+ ++   + ITL G+ 
Sbjct: 191 VGFTLSDEDEGRVLFRADAEQGELFGALQTRLARVMGRDFIDNALAVDATRDGITLTGFA 250

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
            +PT++RG A   ++++NGR V+DK +   +R  Y + +  GR+P  VL L  DP QVDV
Sbjct: 251 ALPTYSRGAAVAQHLYVNGRPVRDKLLTGALRAGYMDVLASGRHPAAVLFLTCDPHQVDV 310

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPK 357
           NVHPAK+ +RFR P I R  ++ +++ A+   G   SS ++   + +   +  P +  P+
Sbjct: 311 NVHPAKAEVRFREPDIARGLVVSALRHALAGAGHRASSTVAMAALGAARPE--PASEQPR 368

Query: 358 -YATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQN 416
            Y  S    +         L+      ++ PT   +  P    E T   LG A AQ+H+N
Sbjct: 369 RYQASYAPARPSAPAIAASLAFQAPGFAEAPTARVEPQPEALPEPTQAPLGAARAQLHEN 428

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEH 476
           +I++QT DG+VIVDQHAAHERL++E+++   ++T I SQ LL PEI++L E +   I+  
Sbjct: 429 WIVAQTADGIVIVDQHAAHERLVYERLKAQLDATGIASQALLIPEIVELSEADAHRILAI 488

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
             +L  LG+  E FG  A+A+RE+PA++ + N   L+RDI+D++ D   +  L+ R++ +
Sbjct: 489 AGELAALGLVIEPFGGGAVAVREVPALIQRLNAAALIRDILDDLADQGASDRLRARVDAV 548

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           L++MAC+GS+RSGR+M + EMN LLREME+ P S QCNHGRPT+I+LKL+DIE+LFGR
Sbjct: 549 LSSMACHGSVRSGRRMSADEMNALLREMERVPKSGQCNHGRPTWIELKLADIERLFGR 606


>gi|163867560|ref|YP_001608759.1| DNA mismatch repair protein [Bartonella tribocorum CIP 105476]
 gi|189030391|sp|A9IN82|MUTL_BART1 RecName: Full=DNA mismatch repair protein mutL
 gi|161017206|emb|CAK00764.1| DNA mismatch repair protein MutL [Bartonella tribocorum CIP 105476]
          Length = 617

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 281/623 (45%), Positives = 415/623 (66%), Gaps = 36/623 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  +KEL+EN++DA ++R+E + A GGK+F +++DNG
Sbjct: 1   MIIRHLSENIINQIAAGEVIERPANVVKELVENAIDAGATRIEIITANGGKNFIKVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++++ +AV RHCTSKI+DD  NI   GFRGEALPSIG+V+ L L+SR  +    A+
Sbjct: 61  CGIPADQLTLAVSRHCTSKITDDVHNICFLGFRGEALPSIGSVAKLKLISRTKEAENAAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I+++  KI   +P A N GTIVEVRDLFF  PARL F+K+++ ETN I+D+I+R+AIA+P
Sbjct: 121 ISVTAGKIVGPKPAAANLGTIVEVRDLFFVTPARLKFMKTDRAETNAISDMIKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFP---ERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            + F+ S +  +R  M   +T  N     +RI+Q++G++F  N++ L+ +   + L G+ 
Sbjct: 181 HIRFSLSGL--DRTSMELSATENNTQGQLQRITQIMGKEFAPNSIALDAERESVRLTGFA 238

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
            +P+FNR N+   + ++NGR V+DKF+   IR AYA+ +   RYPV +L +++ P +VDV
Sbjct: 239 CLPSFNRNNSLHQFAYVNGRPVRDKFLWGAIRGAYADVMTRDRYPVAILFIDLPPAEVDV 298

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF------------ 345
           NVHPAK+ +RFR+P +IR  I+ +I++A+ + GI  +S  S+ M+++F            
Sbjct: 299 NVHPAKADVRFRDPGLIRGLIVGAIREALQQSGIRPTSTRSEAMLAAFQTQKPLTQQSLG 358

Query: 346 -----HQDN--APKTHLPKYATSLT-----NTQEKLFLQENRLSTNDLL--PSDDPTYSE 391
                HQ +  +P++H   +AT+       ++     L+EN     + L  PS D  Y  
Sbjct: 359 NFKNAHQSSSYSPQSH--HFATASMVHKPLDSTNSFGLKENATPIMEGLNTPSGD-AYIP 415

Query: 392 DNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK 451
              P   SE   Y LG A AQIH+NYII+QT D L+IVDQHAAHERL++E ++    +  
Sbjct: 416 STIP--SSEELSYPLGAARAQIHKNYIIAQTQDSLIIVDQHAAHERLVYEALKNALYAKP 473

Query: 452 ITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQ 511
           + SQ LL PEI++L E +   ++ H + L + G+  E FGP AI +RE P++L K N+  
Sbjct: 474 LPSQLLLIPEIVELSEEDATCLLTHKDALQKFGLGIEPFGPGAILVRETPSMLGKINVQA 533

Query: 512 LLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSS 571
           L++D+ DE  +  TT  L+  ++ + ATMAC+GSIRSGR ++  EMNRLLR+ME  PN+S
Sbjct: 534 LIKDLADEAAEYDTTNNLKAMLDYVAATMACHGSIRSGRLLRPEEMNRLLRQMEAIPNTS 593

Query: 572 QCNHGRPTFIKLKLSDIEKLFGR 594
            CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 594 TCNHGRPTYIELKLADIERLFGR 616


>gi|49475080|ref|YP_033121.1| DNA mismatch repair protein [Bartonella henselae str. Houston-1]
 gi|81827745|sp|Q6G4R4|MUTL_BARHE RecName: Full=DNA mismatch repair protein mutL
 gi|49237885|emb|CAF27081.1| DNA mismatch repair protein mutL [Bartonella henselae str.
           Houston-1]
          Length = 612

 Score =  560 bits (1442), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 278/615 (45%), Positives = 401/615 (65%), Gaps = 25/615 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  +KEL+EN++DAE++R+E V   GGK+F +++DNG
Sbjct: 1   MIIRHLSENIINQIAAGEVIERPANVVKELVENAIDAEATRIEIVTTNGGKNFIRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++++ +AV RHCTSKI+DD  NI   GFRGEALPSIG+V+ L L SR     + A+
Sbjct: 61  CGIPADQLTLAVSRHCTSKITDDVHNICFLGFRGEALPSIGSVAKLKLTSRTQNAESAAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ++  KI   +P A NPGTIVEVRDLFF  PARL F+K+++ ETN ITD+I+R+AIA+P
Sbjct: 121 IIVTAGKIVGPKPAAANPGTIVEVRDLFFVTPARLKFMKTDRAETNSITDMIKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFP---ERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            + F+ S   S+R  +   +T  N     +RI+Q++G++F  N++ LN +   + L G+ 
Sbjct: 181 HIHFSLS--GSDRTSLELPATANNTQGQLQRITQIMGKEFAPNSIVLNAERESVRLTGFA 238

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
            +P+FNR N+   + ++NGR V+DKF+   IR AYA+ +   RYPV +L +++ P  VDV
Sbjct: 239 CLPSFNRSNSLHQFAYVNGRPVRDKFLWGAIRGAYADVMTRDRYPVSILFIDLPPADVDV 298

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPK 357
           NVHP K+ +RFR+P  IR  I+ +I++A++  G+ ++S  S+ M+++F      KT    
Sbjct: 299 NVHPTKADVRFRDPGFIRGLIVGAIREALHHTGVRSTSTRSEAMLAAFQTQKPLKTFKST 358

Query: 358 YATSLTNTQEKLFLQENRLSTNDLLPSDDPT-YSEDNDPVEE-----------------S 399
           Y  S  + Q   +  E+    N  L    P    ED  P+ E                 S
Sbjct: 359 YKPSSYSPQP--YHVESASMVNKPLDIISPVGLKEDAPPLMEGLDIPSGDAYTPNTPAAS 416

Query: 400 EATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLT 459
           E   Y LG A AQIH+NYII+QT D L+IVDQHAAHERL++E ++    S  + SQ LL 
Sbjct: 417 EECSYPLGAARAQIHKNYIIAQTQDSLIIVDQHAAHERLVYEALKNALYSKPLPSQLLLI 476

Query: 460 PEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDE 519
           PEI++L E +   ++ H + L + G+  E FGP AI +RE P++L + N+  L++D+ DE
Sbjct: 477 PEIVELSEEDATCLLTHKDALQKFGLGIEAFGPGAIVVRETPSLLGEINVEALIKDLADE 536

Query: 520 IIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPT 579
             +  TT  L+  ++ + ATMAC+GSIRSGR +   EMN LLR++E  PN+  CNHGRPT
Sbjct: 537 AAEYDTTDNLKTMLDYVAATMACHGSIRSGRLLHPEEMNALLRQIEATPNTGTCNHGRPT 596

Query: 580 FIKLKLSDIEKLFGR 594
           +I+LKL+DIE+LFGR
Sbjct: 597 YIELKLADIERLFGR 611


>gi|319405154|emb|CBI78760.1| DNA mismatch repair protein MutL [Bartonella sp. AR 15-3]
          Length = 612

 Score =  559 bits (1441), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 285/617 (46%), Positives = 409/617 (66%), Gaps = 29/617 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  +KEL+EN++DA +SR+E VIA GGKS  +++DNG
Sbjct: 1   MIIRHLSETIINQIAAGEVIERPANVVKELVENAIDAGASRIEIVIANGGKSLIRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+  +++ +A+ RHCTSKI DD  NI   GFRGEALPSIG+VS L L SR   +N+ A+
Sbjct: 61  CGIPEDQLILAISRHCTSKIIDDVHNICFLGFRGEALPSIGSVSKLKLTSRTQNSNSAAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ++  +I   +P A NPGTIVEVRDLFF  PARL F+KS++ ETN ITD I+R+AIA+P
Sbjct: 121 IIVTAGRIEEPKPSAANPGTIVEVRDLFFVTPARLKFMKSDRAETNAITDTIKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNF----QSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
            + F+ + I  +R  M F    ++T G   +RI+Q++G++F  N++ L+ K   + L G+
Sbjct: 181 HIRFSLAGI--DRAPMEFPAMEKNTQGQL-QRITQIMGKEFAPNSLLLDAKRESVHLTGF 237

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
            G+P+FNR N+   + ++NGR V+DK +   IR AYA+ I   R+ V +L + + P  VD
Sbjct: 238 VGLPSFNRSNSLYQFAYVNGRPVRDKLLWGAIRGAYADVIAQNRHAVAILFIHLPPTDVD 297

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF----------H 346
           VNVHPAK  +RFR+P++IR  II +I++A+++ GI  +S  S+ M+++F          H
Sbjct: 298 VNVHPAKMDVRFRDPSLIRGLIIGAIREALHQTGIRPTSTGSEAMLAAFRTQPLETVKMH 357

Query: 347 Q---DNAPKTHLPKYATSL----TNTQEKLFLQENRLSTNDLL--PSDDPTYSEDNDPVE 397
           Q   D+ P  H     TS+     +    + LQE+ +   D L  PS D T +  N P  
Sbjct: 358 QPFSDSTPPYHFGPEITSIFHKPLDMTSSIDLQEDTIPIIDRLSTPSGD-TRAAINKPT- 415

Query: 398 ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTL 457
            SE  HY LG A AQIH+NYI++QT D L+IVDQHAAHERL++E ++    S  + SQ L
Sbjct: 416 -SEELHYPLGAARAQIHKNYIVAQTQDSLIIVDQHAAHERLVYESLKNALYSKPLPSQLL 474

Query: 458 LTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDII 517
           L PEI+++ E +   ++ H + L + G+  + FG  AI + EIP++L + N+  L++D+ 
Sbjct: 475 LIPEIVEISEEDATCLLSHKDALKKFGLGIDSFGIGAIVVHEIPSMLGEINVQALIKDLA 534

Query: 518 DEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGR 577
           DE  +  T   L+  ++ + ATMAC+ SIRSGR +   EMN LLR++E  PNS+ CNHGR
Sbjct: 535 DEAAEYDTIDNLKGMLDYVAATMACHSSIRSGRLLHPEEMNALLRQIEATPNSATCNHGR 594

Query: 578 PTFIKLKLSDIEKLFGR 594
           PT+I+LKL+DIE+LFGR
Sbjct: 595 PTYIELKLADIERLFGR 611


>gi|240849931|ref|YP_002971320.1| DNA mismatch repair protein MutL [Bartonella grahamii as4aup]
 gi|240267054|gb|ACS50642.1| DNA mismatch repair protein MutL [Bartonella grahamii as4aup]
          Length = 617

 Score =  558 bits (1438), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 276/619 (44%), Positives = 407/619 (65%), Gaps = 28/619 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  +KEL+EN++DA ++R+E + A GGK+F +++DNG
Sbjct: 1   MIIRHLSENIINQIAAGEVIERPANVVKELVENAIDAGATRIEIITANGGKNFIKVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +G+ ++++ +AV RHCTSKI+DD  NI   GFRGEALPSIG+V+ L L+SR     + A+
Sbjct: 61  YGIPADQLTLAVSRHCTSKITDDVHNICFLGFRGEALPSIGSVAKLKLISRTKDAESAAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I+++  KI   +P A N GTIVEVRDLFF  PARL F+K+++ ETN I+D+I+R+AIA+P
Sbjct: 121 ISVTAGKIVGPKPAAANLGTIVEVRDLFFVTPARLKFMKTDRAETNAISDMIKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFP---ERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            + F+ S +  +R  M   +T  N     +RI+Q++G++F  N++ LN +   + L G+ 
Sbjct: 181 HIRFSLSGL--DRTSMELSATENNIQGQLQRITQIMGKEFAPNSIALNAEREAVRLTGFA 238

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
            +P+FNR N+   + ++NGR V+DKF+   IR AYA+ +   RYPV +L +++ P +VDV
Sbjct: 239 CLPSFNRNNSLHQFAYVNGRPVRDKFLWGAIRGAYADVMTRDRYPVAILFIDLPPAEVDV 298

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPK 357
           NVHPAK+ +RFR+P +IR  I+ +I++A+ + GI  +S  S+  +++F Q   P    P 
Sbjct: 299 NVHPAKADVRFRDPGLIRGLIVGAIREALQQSGIRPTSTRSEATLAAF-QIQKPLVQQPL 357

Query: 358 YATSLTNTQEKLFLQENRLSTNDLL--PSDDPT---YSEDNDPVEE-------------- 398
                T+       Q +  +   ++  P D  +     ED  P+ E              
Sbjct: 358 GNFKNTHQSSSYSPQPHHFAAASMVHKPLDITSSFGLKEDATPIMEGLNIPSGDTYIPNT 417

Query: 399 ---SEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQ 455
              SE   Y LG A AQIH+NYII+QT D L+IVDQHAAHERL++E ++    S  + SQ
Sbjct: 418 TSSSEELSYPLGAARAQIHKNYIIAQTQDSLIIVDQHAAHERLVYEALKNALYSKPLPSQ 477

Query: 456 TLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRD 515
            LL PEI++L E +   ++ H + L + G+  E FGP AI +RE P++L + N+  L++D
Sbjct: 478 LLLIPEIVELSEEDATCLLTHKDALQKFGLGIEPFGPGAIVVRETPSMLGEINVQALIKD 537

Query: 516 IIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNH 575
           + DE  +  TT  L+  ++ + ATMAC+GSIRSGR ++  EMN LLR+ME  PN+S CNH
Sbjct: 538 LADEAAEYDTTNNLKAMLDYVAATMACHGSIRSGRLLRPEEMNTLLRQMEAIPNTSTCNH 597

Query: 576 GRPTFIKLKLSDIEKLFGR 594
           GRPT+I+LKL+DIE+LFGR
Sbjct: 598 GRPTYIELKLADIERLFGR 616


>gi|304393197|ref|ZP_07375125.1| DNA mismatch repair protein MutL [Ahrensia sp. R2A130]
 gi|303294204|gb|EFL88576.1| DNA mismatch repair protein MutL [Ahrensia sp. R2A130]
          Length = 620

 Score =  558 bits (1437), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 271/622 (43%), Positives = 404/622 (64%), Gaps = 31/622 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E I+NQIAAGE++ERP+  ++EL++N++DA + R++ VIA GGK   ++TD+G
Sbjct: 1   MPVRRLHETIVNQIAAGEVVERPASVVRELLDNAIDAGAKRIDLVIASGGKGLIRVTDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM ++++ +AV+RHCTSK++DD  +IHT GFRGEALPSIG+VS LT+ +R   +++G +
Sbjct: 61  RGMDADDLALAVERHCTSKLTDDLLDIHTLGFRGEALPSIGSVSRLTIRTRQDGSDSGYE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I++ G KI+ VRP A N GT+VEV DLF+  PARL FLK+E+ ET  I DV+RR A+A+P
Sbjct: 121 ISVDGGKITQVRPAAFNRGTVVEVADLFYATPARLKFLKTERAETTAILDVLRRAALAHP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGN--FPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           ++ F+      +R  ++  +  G+  +  R  QV+G DF  NA+ ++ +   + L G   
Sbjct: 181 EIHFSLG--GPDRQPVDHPAAQGDDAWLHRARQVLGVDFAENALTIDAEREGVRLTGLAA 238

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTFNRGNA   +V +NGR+V+D+ +   IR AY + +  GR+P+V L + I+P  VDVN
Sbjct: 239 LPTFNRGNALSQFVTVNGRSVKDRQLTGAIRGAYMDHLARGRHPMVSLDIAIEPELVDVN 298

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHPAKS +RFR+P ++R  I+ ++++AI   G   SS     M+++F      +  +   
Sbjct: 299 VHPAKSEVRFRDPGLVRGLIVGALRQAIEAAGHRASSRGGVDMMAAFTPGGLGEQAVRAA 358

Query: 359 ATSLTNTQEKLFLQENRLSTNDL------------------LPSDDPTY------SEDND 394
           A  L       F Q    S  +                   L     T+      S D  
Sbjct: 359 AGGLAENAAGHFDQTGYTSPGNANHDWQQSPNRPVQAGPIGLQEAPATFDMTGAPSADQR 418

Query: 395 PVEESEATHYQ--LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
           P E ++ T+    LG A AQ+H+NYII+QT  GLVIVDQHAAHERL++E+M+       +
Sbjct: 419 PSENTD-TYLANPLGAARAQVHENYIIAQTEGGLVIVDQHAAHERLVYERMKAQIAEKGV 477

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
            +Q LL P+I+DL E + A +++H  +L +LG+  E FGP  +A+RE P +L + N   L
Sbjct: 478 EAQMLLIPQIVDLAEDDAARLLDHSVELAQLGLCFEEFGPGTLAVRETPTLLGEVNAAAL 537

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           L+D+ DEI +  T  T+++RI+++ ATMAC+GS+RSGR+++  EM+ LLR+ME  PNS Q
Sbjct: 538 LQDLADEIAEWGTATTVRERIDHVAATMACHGSVRSGRRLRPQEMDALLRDMEATPNSGQ 597

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT+++LKLSDIE+LFGR
Sbjct: 598 CNHGRPTYVELKLSDIERLFGR 619


>gi|90419989|ref|ZP_01227898.1| DNA mismatch repair protein MutL [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336030|gb|EAS49778.1| DNA mismatch repair protein MutL [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 621

 Score =  557 bits (1436), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 268/622 (43%), Positives = 405/622 (65%), Gaps = 30/622 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I++LS+ +I+QIAAGE++ERP+  +KEL+EN+LDA + R+E   AGGGK+  +I+D+G
Sbjct: 1   MPIQQLSDALIDQIAAGEVVERPASVVKELVENALDAGARRIEIATAGGGKNLIRISDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ + EIP+AV+RHCTSK++     I T GFRGEALPSIG+V  L+L SR   ++   +
Sbjct: 61  CGIPAAEIPLAVRRHCTSKLAGGLDAIGTLGFRGEALPSIGSVGRLSLKSRAAGSDEAYE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I +   + S +RP A++ GT++EVRDLF  +PARL FLKS++ E++ IT+++RR+AIA+P
Sbjct: 121 ICVEAGRPSELRPTALSRGTVIEVRDLFHAVPARLKFLKSDRAESSAITEIVRRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFP-ERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            V F  S    +R    F++  G+ P  RI+ V+  DF +NA+ ++    ++ L+G+ GI
Sbjct: 181 GVRFELS--GPDRTTTVFEAVPGDAPLPRIADVLTPDFADNAIPVDAMREDVRLRGFAGI 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT+NRGN  Q + ++NGR V+DK + S +R AYA+ +   R+PV VL LE+DP  VDVNV
Sbjct: 239 PTYNRGNGQQQFFYVNGRPVRDKTLHSALRGAYADVLARDRHPVAVLFLELDPALVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH----QDNAPKTHL 355
           HPAK+ +RFR+P ++R  I+ S+++A N+ G+ +++  S  +++ F      + AP T  
Sbjct: 299 HPAKADVRFRDPGLVRGLIVGSLRQAFNEAGLRSATTNSSGLMARFRGAAPAEPAPVTPA 358

Query: 356 PKYATSL----------------TNTQEKLFLQENRLSTNDLLPSDDPT------YSEDN 393
           P+                      +    L +     + +    +  P        + D 
Sbjct: 359 PRRFDGFAPGGFAAPRQAAYAAEASPYRPLDMGAGATTLDRGPDAGSPAQAPVAIAAPDT 418

Query: 394 DPVEESE-ATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
           +  E++   + + LG A AQ H+N+I+S+T DG+VIVDQHAAHERL++E ++   +   +
Sbjct: 419 ESAEDAANGSDHPLGAAKAQFHRNFIVSETEDGIVIVDQHAAHERLVYEALKTALHGRPL 478

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
            SQ LL PEI+DL E +   + E  E   RLG+  ERFGP A+A+RE PAIL   +  +L
Sbjct: 479 ASQLLLIPEIVDLPEDDVDRLAEQAETFARLGLGIERFGPGAVAVRETPAILGSVDCQRL 538

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           +RD+ DE+ ++ T   ++ RI+++ AT+AC+GS+RSGR M+  EMN LLR+ME  P S Q
Sbjct: 539 MRDLADELAEAGTADAVRGRIDHVAATIACHGSVRSGRLMKPEEMNALLRDMEATPGSGQ 598

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPTFI+LKL+DIEK+FGR
Sbjct: 599 CNHGRPTFIELKLADIEKMFGR 620


>gi|294675823|ref|YP_003576438.1| DNA mismatch repair protein MutL [Rhodobacter capsulatus SB 1003]
 gi|294474643|gb|ADE84031.1| DNA mismatch repair protein MutL [Rhodobacter capsulatus SB 1003]
          Length = 617

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 275/605 (45%), Positives = 393/605 (64%), Gaps = 16/605 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +   N+IAAGE++ERP+ A+KEL+EN+LDA +SR+E   A GGK+  +I+D+G G
Sbjct: 15  IRQLDDAAANRIAAGEVVERPASAVKELVENALDAGASRIEIAYADGGKTLIRISDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT+E++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR  +    AQI
Sbjct: 75  MTAEDLPLALCRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLTITSRA-EGFEAAQI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +SG +I +V+P A+N GT+VE+RDLFF  PARL FL++++ E   I D ++R+A+A P 
Sbjct: 134 TVSGGRIGAVKPAALNRGTVVELRDLFFATPARLKFLRTDRTEAQAIADTVKRLAMAEPY 193

Query: 182 VSFTFSTIKSNRYKMNFQSTN------GNFPERISQVIGEDFINNAVELNEKSNEITLQG 235
           VSFT   I  +  +  F++        G    R+ +++G  F +NAV L+     I L G
Sbjct: 194 VSFTLREIAGSETREIFRADAEQGELFGALSGRLGRILGRAFADNAVPLDADREGIRLTG 253

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y  +PT++RG A + ++F+NGR V+DK +L  +R AY + +   R+P  VL L  DP  V
Sbjct: 254 YAALPTYSRGAAVEQFLFVNGRPVRDKMLLGALRAAYIDVLSRDRHPAAVLFLTCDPESV 313

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA-PKTH 354
           DVNVHPAK+ +RFR   + R  I+  I+ A+ + G  +SS ++   + +   + A P+ +
Sbjct: 314 DVNVHPAKAEVRFREAGVPRGLIVTGIRHALAQSGHRSSSTVATATLGAMQPEPAQPRIY 373

Query: 355 LPKYATSLTNTQEKLFLQENRLSTNDLLPSD-----DPTYSEDNDPVEESEATHYQLGIA 409
             +  +S        F  +  L + D  P        P+   +  P   +E  H  LG A
Sbjct: 374 QMERPSS--GAIRNAFAAQMPLQSFDEAPQPFTAPFAPSARVEPAPPGTAELIHRPLGAA 431

Query: 410 CAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGE 469
            AQ+H+NYII+QT  G+VIVDQHAAHERL++E+++       I +Q LL PEI++L   E
Sbjct: 432 RAQLHENYIIAQTERGMVIVDQHAAHERLVYERLKAQSAEKGIAAQALLIPEIVELSAAE 491

Query: 470 CALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTL 529
            A +++  E+LHRLG+  E FG +AIA+RE PAIL + N   LLRDI+DE+ D   +  L
Sbjct: 492 AARLLDVAEELHRLGLAIEPFGGSAIAVRETPAILGEINAAALLRDILDELADQGDSLRL 551

Query: 530 QDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIE 589
           Q +I+ +L+ M+C+GSIRSGR+M+  EMN LLREME  P S QCNHGRPT+++LKLSDIE
Sbjct: 552 QSKIDAVLSRMSCHGSIRSGRQMRVEEMNALLREMEATPLSGQCNHGRPTYVELKLSDIE 611

Query: 590 KLFGR 594
           +LFGR
Sbjct: 612 RLFGR 616


>gi|254502767|ref|ZP_05114918.1| DNA mismatch repair protein MutL [Labrenzia alexandrii DFL-11]
 gi|222438838|gb|EEE45517.1| DNA mismatch repair protein MutL [Labrenzia alexandrii DFL-11]
          Length = 631

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 269/635 (42%), Positives = 411/635 (64%), Gaps = 46/635 (7%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M++R+L E++INQIAAGE+IERP+  IKEL+EN++DA +S+++ V A GGK+  ++ D+G
Sbjct: 1   MQVRQLGEQVINQIAAGEVIERPASVIKELVENAVDAGASQIDIVTAAGGKTLMRVADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM  +++ +A++RHCTSKISDD   +I T GFRGEALPSIG+V+ L + +R  + +   
Sbjct: 61  AGMRQDDLKLAIRRHCTSKISDDDLFDIRTLGFRGEALPSIGSVARLVIQTRHGEEDHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            IA+ G K   + P A + GT VEVRDLFF  PARL FLKS++ E   IT++++R+A+AY
Sbjct: 121 AIAVEGGKEQPIVPAARSKGTQVEVRDLFFATPARLKFLKSDRAEAAAITEIVKRIALAY 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPE--RISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P + F+ S   ++R   ++ +  G+ P   RI+Q++G DF++NA+E++     + L GY 
Sbjct: 181 PHIGFSLSG--ADRQPQSWPAARGDEPHLARIAQILGPDFVDNAMEIDAAREGVRLTGYA 238

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PT +RGNA   + F+NGR V+DK +LS +R AYA+ +   R+PVVVL +++DP  VDV
Sbjct: 239 GLPTHHRGNAQHQFFFVNGRPVKDKLLLSGLRGAYADVLARDRHPVVVLFIDLDPALVDV 298

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPK 357
           NVHPAKS +RFR+  ++R  ++ +I+ A+ + G  +S+  +   + +  +  +P+   P 
Sbjct: 299 NVHPAKSDVRFRDAQLVRGLLVGAIKHALVQAGHRSSTSNAAVALDALRK-QSPQPGWPS 357

Query: 358 YATS-----------------LTNTQEKLFLQENRLSTNDLLPSDDPTYSED-------- 392
            AT+                  T T E+   +       +  P+  P ++ED        
Sbjct: 358 GATAPAYGSAASVSASAHGFGATATAERWAPEA--FQPLETAPNPVPGFAEDRVSEVQNG 415

Query: 393 -------------NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLI 439
                        +D    SE T   LG A AQ+H+ YII+QT DG+VIVDQHAAHERL+
Sbjct: 416 FSALATPSADARAHDVPLASEKTELPLGAARAQVHETYIIAQTEDGVVIVDQHAAHERLV 475

Query: 440 FEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIRE 499
           +E++++      +  Q LL PE++DL E + A + +  EDL ++G+  E FGP AIA+RE
Sbjct: 476 YERLKEALAKKDVARQILLIPEVVDLPEEDAARLADRAEDLEKVGLSLEAFGPGAIAVRE 535

Query: 500 IPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNR 559
            PAIL   +I  ++R + DE+ +  T  +L+++++++ ATMAC+GS+R+GR+M+  EM+ 
Sbjct: 536 TPAILGDMDIQGMVRTLADELAEWETADSLREKLDHVAATMACHGSVRAGRRMRPEEMDA 595

Query: 560 LLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LLR+ME  P S QCNHGRPT+++LKLSDIEKLFGR
Sbjct: 596 LLRDMEATPLSGQCNHGRPTWVELKLSDIEKLFGR 630


>gi|121602207|ref|YP_989454.1| DNA mismatch repair protein [Bartonella bacilliformis KC583]
 gi|166231105|sp|A1UU01|MUTL_BARBK RecName: Full=DNA mismatch repair protein mutL
 gi|120614384|gb|ABM44985.1| DNA mismatch repair protein MutL [Bartonella bacilliformis KC583]
          Length = 611

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 278/615 (45%), Positives = 408/615 (66%), Gaps = 26/615 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  IKEL+EN++DA+++R+E  I  GGK+F +++DNG
Sbjct: 1   MIIRHLSENIINQIAAGEVIERPANVIKELVENAIDAQATRIEISIVNGGKNFIRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++++ +AV RHCTSKI DD SNI   GFRGEALPSIG+V+ L L SR    +   +
Sbjct: 61  CGIPADQLTLAVSRHCTSKIVDDVSNICFLGFRGEALPSIGSVAKLKLTSRTQDADNANE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I++   KI   +P A NPGTIVEVRDLFF  PARL F+K+++ ET+ ITD+I+R+AIA+P
Sbjct: 121 ISVIAGKIEGPKPAAANPGTIVEVRDLFFVTPARLKFMKTDRAETSAITDMIKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFP---ERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            + F+ S+  ++R  M F +T  N     +RI+Q++G++F  N++ LN +   + L G+T
Sbjct: 181 HIRFSLSS--TDRMLMEFPATENNTQGQLQRITQIMGKEFAPNSIALNAERESVRLTGFT 238

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
            +P+FNR N+   + ++NGR V+DK +   IR AYA+ I   R+ V ++ +++ P  VDV
Sbjct: 239 CLPSFNRSNSLHQFAYVNGRPVRDKLLWGAIRGAYADAIARDRHAVSIIFIDLPPADVDV 298

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH----------Q 347
           NVHP K+ +RFR+P +IR  II +I +A+++ G+  +S  S+ ++++F           Q
Sbjct: 299 NVHPTKADVRFRDPGLIRGLIIGAIHEALHQAGVRHTSTHSESVLTAFQIHPLENLKSAQ 358

Query: 348 DNAPKTHLPKYATSLTNT------QEKLFLQENRLSTNDLL--PSDDPTYSEDNDPVEES 399
                T  P +  S T +       + + L+E  +   + L  PS D   +    P EE 
Sbjct: 359 RPFSYTSQPYHRVSTTTSMLQKPLDDSIDLREGIVPMMECLSAPSSDTRATIQTSPTEE- 417

Query: 400 EATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLT 459
              HY LG A AQIH+NYIISQT D L+IVDQHAAHERL++E ++    S  ++SQ LL 
Sbjct: 418 --LHYPLGAAKAQIHKNYIISQTQDSLIIVDQHAAHERLVYEALKNALYSKPLSSQLLLI 475

Query: 460 PEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDE 519
           PEI++L E + A ++ H + L + G+  E FGP AI +RE PA+L + N   L++D+ DE
Sbjct: 476 PEIVELSEEDAACLLTHKDSLQKFGLGIEPFGPGAILVRETPAMLGEINAQALIKDLADE 535

Query: 520 IIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPT 579
             +  TT  L+  ++ + ATMAC+ S+RSGR ++  EMN LLR++E+ P+SS CNHGRPT
Sbjct: 536 AAEYDTTNNLKAMLDYVAATMACHSSVRSGRLLRPEEMNALLRQIEETPHSSTCNHGRPT 595

Query: 580 FIKLKLSDIEKLFGR 594
           +I+LKL+DIE+LFGR
Sbjct: 596 YIELKLADIERLFGR 610


>gi|149200821|ref|ZP_01877796.1| DNA mismatch repair protein [Roseovarius sp. TM1035]
 gi|149145154|gb|EDM33180.1| DNA mismatch repair protein [Roseovarius sp. TM1035]
          Length = 611

 Score =  555 bits (1431), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 265/603 (43%), Positives = 393/603 (65%), Gaps = 16/603 (2%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR+L E  IN+IAAGE++ERP+ A+KEL+EN+LDA ++R+E   A GGK+  +++D+G 
Sbjct: 14  QIRQLDEGAINRIAAGEVVERPASAVKELVENALDAGATRIEVSYADGGKTLIRVSDDGC 73

Query: 62  GMTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           GMT +E+P+A+ RH TSKI   D  NIH+FGFRGEALPS+GAV  LT++SR       A+
Sbjct: 74  GMTPDELPLALARHATSKIDGSDLLNIHSFGFRGEALPSLGAVGRLTIVSR--AGAEAAE 131

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + ++G ++ +V+P A+N GT+V +RDLF+  PARL F++S++ E   I D ++R+A+A P
Sbjct: 132 MTVAGGQMGAVKPAALNSGTVVTLRDLFYATPARLKFMRSDRAEAQAIADTVKRLAMAEP 191

Query: 181 KVSFTFSTIKSN---RYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITL 233
            V FT   +      R        +G+  +    R+++V+G +F  NA++++     + L
Sbjct: 192 FVGFTLRDVSGGGEGRIVFRADPESGDLFDALHGRLARVLGAEFAENALKIDATREGLRL 251

Query: 234 QGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPR 293
            GY  +PT+ RG+A   Y+F+NGR V+DK +   +R AY + +   R+P   L L  DP 
Sbjct: 252 TGYAALPTYARGSAVAQYLFVNGRPVRDKMLYGALRAAYQDVLSRDRHPAAALFLGCDPT 311

Query: 294 QVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKT 353
            VDVNVHPAKS +RFR+P + R  I+  ++ A+ + G   S+ ++   + +F  + A + 
Sbjct: 312 LVDVNVHPAKSEVRFRDPGLARGLIVSGLRHALAEAGHRASTTVAGATLGAFRAEPAGRI 371

Query: 354 HLPKYATSLTNTQEK-LFLQENRLSTNDLLPSDDPTYSEDNDP-VEESEATHYQLGIACA 411
               Y     + Q + L  Q       D+            +P VEE  AT   LG A A
Sbjct: 372 ----YQMDRPSPQARSLAYQAQAPGFADMGADWSARVESAPEPEVEEQPATALPLGAARA 427

Query: 412 QIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECA 471
           Q+H+NYII+QT  G+VIVDQHAAHERL++E++++    + I +Q LL PEI+DL E +CA
Sbjct: 428 QVHENYIIAQTETGMVIVDQHAAHERLVYERLKRQMAESGIAAQALLIPEIVDLSEADCA 487

Query: 472 LIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQD 531
           L+M+H E+L  +G+  E FG  ++A+RE PAIL   N   LLRDI+DE+ D   + TL+ 
Sbjct: 488 LLMDHAEELAGMGLGIEPFGSGSLAVRETPAILGTVNAGALLRDILDELQDQGASGTLKL 547

Query: 532 RIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKL 591
           RI+ IL+ +AC+GS+RSGR+M + EMN LLREME+ P S QCNHGRPT+++L+LSDIE+L
Sbjct: 548 RIDAILSRVACHGSVRSGRRMSADEMNALLREMERTPMSGQCNHGRPTYVELRLSDIERL 607

Query: 592 FGR 594
           FGR
Sbjct: 608 FGR 610


>gi|85705062|ref|ZP_01036162.1| DNA mismatch repair protein [Roseovarius sp. 217]
 gi|85670384|gb|EAQ25245.1| DNA mismatch repair protein [Roseovarius sp. 217]
          Length = 611

 Score =  554 bits (1427), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 263/605 (43%), Positives = 394/605 (65%), Gaps = 20/605 (3%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR+L E  +N+IAAGE++ERP+ A+KEL+EN+LDA ++R+E   A GGK+  ++ D+G 
Sbjct: 14  QIRQLDEAAVNRIAAGEVVERPASAVKELVENALDAGATRIEVGFADGGKTLIRVMDDGC 73

Query: 62  GMTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           GM  +++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR    +  A+
Sbjct: 74  GMAPDQLPLALARHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLTIASR--AGDAAAE 131

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ++G +  +V+P A+N GT+V +RDLF+  PARL F++S++ E   I D ++R+A+A P
Sbjct: 132 ITVAGGQAGAVKPAALNAGTVVTLRDLFYATPARLKFMRSDRAEAQAIADTVKRLAMAEP 191

Query: 181 KVSFTFSTIKSN---RYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITL 233
            V F    +      R        +G+  +    R+++V+G +F  NA+ ++     + +
Sbjct: 192 FVGFVLREVSGGGEGRIVFRADPESGDLFDALHGRLARVLGAEFAENALRIDATREGVRM 251

Query: 234 QGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPR 293
            GY  +PT++RG+A   Y+F+NGR V+DK +   +R AY + +   R+P V L L+ DP 
Sbjct: 252 TGYAALPTYSRGSAVAQYLFVNGRPVRDKMLYGALRAAYQDVLSRDRHPAVALFLDCDPT 311

Query: 294 QVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKT 353
            VDVNVHPAKS +RFR+P + R  I+  ++ A+ + G   S+ ++   + +F  +   + 
Sbjct: 312 LVDVNVHPAKSEVRFRDPGLARGLIVSGLRHALAEAGHRASTTVAGATLGAFRPEPVGRI 371

Query: 354 HLPKYATSLTNTQEK-LFLQENRLSTNDLLPSDDPTYSEDNDP---VEESEATHYQLGIA 409
               Y     + Q + L          D+  ++D +   ++ P   VEE  AT   LG A
Sbjct: 372 ----YQMDRPSPQARALAYSAQAPGFADM--AEDWSARVESAPEPQVEEPPATALPLGAA 425

Query: 410 CAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGE 469
            AQ+H+NYII+QT  G+VIVDQHAAHERL++E++++    + + +Q LL PEI+DL E +
Sbjct: 426 RAQVHENYIIAQTETGMVIVDQHAAHERLVYERLKRQMAESGVAAQALLIPEIVDLSEAD 485

Query: 470 CALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTL 529
           CAL+MEH E L  LG+  E FGP ++A+RE PAIL   N   LLRDI+DE+ D   + TL
Sbjct: 486 CALLMEHAEALAGLGLGIEPFGPGSLAVRETPAILGPVNAGALLRDILDELQDQGASGTL 545

Query: 530 QDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIE 589
           + RI+ IL+ +AC+GS+RSGR+M + EMN LLR+ME+ P S QCNHGRPT+++L+LSDIE
Sbjct: 546 KLRIDAILSRVACHGSVRSGRRMSAEEMNALLRKMERTPMSGQCNHGRPTYVELRLSDIE 605

Query: 590 KLFGR 594
           +LFGR
Sbjct: 606 RLFGR 610


>gi|319898390|ref|YP_004158483.1| DNA mismatch repair protein MutL [Bartonella clarridgeiae 73]
 gi|319402354|emb|CBI75893.1| DNA mismatch repair protein MutL [Bartonella clarridgeiae 73]
          Length = 612

 Score =  551 bits (1419), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 283/617 (45%), Positives = 408/617 (66%), Gaps = 29/617 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  +KELIEN++DA ++R+E VIA GGK+  +++DNG
Sbjct: 1   MIIRHLSETIINQIAAGEVIERPTNVVKELIENAIDAGANRIEIVIANGGKNLIKVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+  +++ +A+ RHCTSKI+DD  NI   GFRGEALPSIG+VS L L SR   +++ A+
Sbjct: 61  CGIPEDQLTLAISRHCTSKITDDVHNICFLGFRGEALPSIGSVSKLKLTSRTQNSDSAAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ++  KI   +P A NPGTIVEVRDLFF  PARL F+KS++ ET+ I D I+R+AIA+P
Sbjct: 121 IIVTAGKIEGPKPSAANPGTIVEVRDLFFVTPARLKFMKSDRAETSSIIDTIKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNF----QSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
            + F+ + I  +R  M F    Q+T G   +RI+Q++G++F +N++ L+ K   + L G+
Sbjct: 181 HIRFSLAGI--DRASMEFPAMEQNTQGQL-QRITQIMGKEFASNSLILDAKRESVHLTGF 237

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
            G+P+FNR N+   + ++NGR V+DK +   IR AYA+ I   R+ + +L + + P  VD
Sbjct: 238 AGLPSFNRSNSLHQFAYVNGRPVRDKLLWGAIRGAYADVIARDRHAIAILFINLPPTDVD 297

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF----------H 346
           VNVHPAK  +RFR+P++IR  II +I++A+++ G+  +S  S+ M+++F          H
Sbjct: 298 VNVHPAKMDVRFRDPSLIRGLIIGAIREALHQTGVRPTSTGSEAMLAAFRTQSLETVKTH 357

Query: 347 QDN---APKTHLPKYATSL----TNTQEKLFLQENRLSTNDLL--PSDDPTYSEDNDPVE 397
           Q +   A   HL    TS+     N    + LQE+ +   + L  PS D T +  N  V 
Sbjct: 358 QTSSYGARPCHLEPELTSIFHKPLNINSSIDLQEDTIPIMECLSRPSGD-TRATIN--VS 414

Query: 398 ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTL 457
            SE  HY LG A AQIH+NYI+SQT + L+IVDQHAAHERL++E ++    S  + SQ L
Sbjct: 415 TSEELHYPLGAARAQIHKNYIVSQTQNSLIIVDQHAAHERLVYEALKNALYSKPLPSQLL 474

Query: 458 LTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDII 517
           L PEI++L E +   ++ H + L + G+  E FG  AIA+ E P++L + NI  L++D+ 
Sbjct: 475 LIPEIVELSEEDATCLLSHKDALKKFGLGIESFGIGAIAVHETPSMLGEINIQALIKDLA 534

Query: 518 DEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGR 577
           DE  +  T   L+  ++ + ATMAC+ SI SGR +   EMN LLR++E  PNS  CNHGR
Sbjct: 535 DEAAEYDTIDNLKGMLDYVAATMACHSSICSGRLLHPEEMNALLRQIEATPNSGTCNHGR 594

Query: 578 PTFIKLKLSDIEKLFGR 594
           PT+I+LKL+DIE+LFGR
Sbjct: 595 PTYIELKLADIERLFGR 611


>gi|319406600|emb|CBI80242.1| DNA mismatch repair protein MutL [Bartonella sp. 1-1C]
          Length = 612

 Score =  550 bits (1418), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 287/617 (46%), Positives = 406/617 (65%), Gaps = 29/617 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  +KELIEN++DA +SR+E VIA GGKS  +++DNG
Sbjct: 1   MIIRHLSETIINQIAAGEVIERPANVVKELIENAIDAGASRIEIVIANGGKSLIRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+  +++ +AV RHCTSKI+DD  NI   GFRGEALPSIG+VS L L SR   +++ A+
Sbjct: 61  CGIPEDQLTLAVSRHCTSKITDDVHNICFLGFRGEALPSIGSVSKLKLTSRIQNSDSAAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ++  KI   +P A NPGTIVEVRDLFF  PARL F+KS++ ET  ITD I+R+AIA+P
Sbjct: 121 IIVNAGKIEGPKPSAANPGTIVEVRDLFFVTPARLKFMKSDRSETIAITDTIKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNF----QSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
            + F+ + I  +R  M F    Q+T G   +RI+Q++G++F  N++ L+ K   + L G+
Sbjct: 181 HIRFSLAGI--DRAPMEFPAMEQNTQGQL-QRITQIMGKEFAPNSLILDAKRESVHLTGF 237

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
            G+P+FNR N+   + ++NGR V+DK +   IR AYA+ I   R+ V +L + + P  VD
Sbjct: 238 IGLPSFNRSNSLHQFAYVNGRPVRDKLLWGAIRGAYADVIARDRHAVAILFIHLPPTDVD 297

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF----------H 346
           VNVHPAK  +RFR+P++IR  II +I++A+++ GI  +S  S+ M+++F          H
Sbjct: 298 VNVHPAKMDVRFRDPSLIRGLIIGAIREALHQTGIRPTSTDSEAMLAAFRTEPLETEKMH 357

Query: 347 Q----DNAPKTHLPKYATSL---TNTQEKLFLQENRLSTNDLL--PSDDPTYSEDNDPVE 397
           Q    D  P+   PK  +      +    +  QE+ +   + L  PS D T +  N    
Sbjct: 358 QSFSYDARPRHIDPKLTSIFHKPLDINSSIDFQEDTIPIMEHLSTPSGD-TRATIN--AL 414

Query: 398 ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTL 457
            SE  HY LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++    S  + SQ L
Sbjct: 415 TSEELHYPLGAARAQIHKNYIVAQTQDSLVIVDQHAAHERLVYEALKNALYSQPLPSQLL 474

Query: 458 LTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDII 517
           L PEI++L E +   ++ H + L + G+  E FG  AIA+ E P++L + NI  L++D+ 
Sbjct: 475 LIPEIVELSEEDATCLLSHKDALKKFGLGIESFGIGAIAVHETPSMLGEINIQALIKDLA 534

Query: 518 DEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGR 577
           DE  +  T   L+  ++ + ATMAC+ SIRSGR +   EMN LLR++E  PNS+ CNHGR
Sbjct: 535 DEATEYDTIDNLKGMLDYVAATMACHSSIRSGRLLHPEEMNALLRQIEATPNSATCNHGR 594

Query: 578 PTFIKLKLSDIEKLFGR 594
           PT+I+LKL+DIE+LFGR
Sbjct: 595 PTYIELKLADIERLFGR 611


>gi|84515075|ref|ZP_01002438.1| DNA mismatch repair protein [Loktanella vestfoldensis SKA53]
 gi|84511234|gb|EAQ07688.1| DNA mismatch repair protein [Loktanella vestfoldensis SKA53]
          Length = 607

 Score =  550 bits (1418), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 263/599 (43%), Positives = 391/599 (65%), Gaps = 17/599 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+ENS+DA + R+E VIA GGK+  +++D+G G
Sbjct: 18  IRQLDEAAINRIAAGEVLERPASAVKELVENSIDAGAQRIEVVIADGGKTLIRVSDDGCG 77

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M ++++P+A+ RH TSKI   D  NI +FGFRGEAL S+GAV  L + SR P +   + I
Sbjct: 78  MAADDLPLALSRHATSKIDGSDLLNITSFGFRGEALASLGAVGRLLITSRTPGDGAHS-I 136

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           A+SG +IS VRP A+  GT+VE+RD+F+  PARL FL++++ E   +TDV++R+A+A P 
Sbjct: 137 AVSGGRISDVRPAALTSGTVVELRDMFYATPARLKFLRTDRAEAQAVTDVVKRLAMAEPF 196

Query: 182 VSFTFSTIKSNRYKMNFQST--NGNFPE----RISQVIGEDFINNAVELNEKSNEITLQG 235
           V+F          ++ F++    G+  +    R+  V+G DF +NA+ ++ + +   L G
Sbjct: 197 VTFILRDASDGDTRVVFRADAQTGDLFDALHGRLQTVLGRDFADNALRIDAERDGFHLTG 256

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y  +PT++RG A   ++F+NGR V+DK +L  +R AY + +   R+PV  L ++ DP  V
Sbjct: 257 YAALPTYSRGAAVAQFLFVNGRPVRDKMLLGALRAAYMDVLSRDRHPVAALFVDCDPMLV 316

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL 355
           DVNVHPAKS +RFR+P ++R  I+  ++ A+   G   SS ++   + +           
Sbjct: 317 DVNVHPAKSEVRFRDPGVVRGLIVSGLRHALAGAGHRASSTVADATLGAME--------- 367

Query: 356 PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQ 415
           P++AT      ++       L+     P      S   +P  +  +    LG A AQ+H+
Sbjct: 368 PQHATPRVYQMDRPSFSARSLTFQAQAPGFAEMPSARVEPPADDTSADLPLGAARAQVHE 427

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           NYII+QT  G+VIVD HAAHERL++EK++    +  + +Q LL PEI++L + E A +++
Sbjct: 428 NYIIAQTATGIVIVDGHAAHERLVYEKLKSQMATNGVAAQALLIPEIVELSDHETAALLD 487

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
             +DL RLG+  E FG NAIA+RE PAIL + N   +LRDI DE+ D   + ++Q RIE 
Sbjct: 488 IADDLARLGLTIEPFGGNAIAVRETPAILGEINAAAMLRDISDELADQGDSASVQARIEA 547

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           IL+ +AC+GSIR+GR+MQ+ EMN LLREME  P+S QCNHGRPT+++LKLSDIE+LFGR
Sbjct: 548 ILSRVACHGSIRTGRRMQAAEMNALLREMEATPHSGQCNHGRPTYVELKLSDIERLFGR 606


>gi|319403683|emb|CBI77268.1| DNA mismatch repair protein MutL [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 612

 Score =  550 bits (1416), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 288/621 (46%), Positives = 404/621 (65%), Gaps = 37/621 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  +KELIEN++DA +SR+E VIA GGKS  +++DNG
Sbjct: 1   MIIRHLSETIINQIAAGEVIERPANVVKELIENAIDAGASRIEIVIANGGKSLIRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+  +++ +A+ RHCTSKI+DD  NI   GFRGEALPSIG+VS L L SR   +++ A+
Sbjct: 61  CGIPEDQLTLAISRHCTSKITDDVHNICFLGFRGEALPSIGSVSKLKLTSRTKNSDSAAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ++  KI   +P A NPGTIVEVRDLFF  PARL F+KS++ ET  ITD I+R+AIA+P
Sbjct: 121 IIVNAGKIEGPKPSAANPGTIVEVRDLFFVTPARLKFMKSDRSETITITDTIKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNF----QSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
            + F+ + I  +R  M F    Q+T G   +RI+Q++G++F  N++ L+ K   + L G+
Sbjct: 181 HIRFSLAGI--DRAPMEFPAMEQNTQGQL-QRITQIMGKEFAPNSLILDAKRESVHLTGF 237

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
            G+P+FNR N+   + ++NGR V+DK +   IR AYA+ I   R+ V +L + + P  VD
Sbjct: 238 IGLPSFNRSNSLHQFAYVNGRPVRDKLLWGAIRGAYADVIARDRHAVAILFIHLPPTDVD 297

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF----------H 346
           VNVHPAK  +RFR+P++IR  II +I++A+++ GI  +S  S+ M+++F          H
Sbjct: 298 VNVHPAKMDVRFRDPSLIRGLIIGAIREALHQTGIRPTSTGSEAMLAAFRTEPLETAKMH 357

Query: 347 Q----DNAPKT---------HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDN 393
           Q    D  P+          H P    S  + QE        LST    PS D T +  N
Sbjct: 358 QPFSYDARPRHIDPNLTSIFHKPLDINSSIDFQEDTVPIMEHLST----PSGD-TRATIN 412

Query: 394 DPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKIT 453
                SE  HY LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++    S  + 
Sbjct: 413 --ALTSEELHYPLGAARAQIHKNYIVAQTQDSLVIVDQHAAHERLVYEALKNALYSKPLP 470

Query: 454 SQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLL 513
           SQ LL PEI++L E +   ++ H + L + G+  E FG  AIA+ E P++L + N+  L+
Sbjct: 471 SQLLLIPEIVELSEEDATCLLSHKDALKKFGLGIESFGIGAIAVHETPSMLGEINVQALI 530

Query: 514 RDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQC 573
           +D+ DE  +  T   L+  ++ + ATMAC+ SIRSGR +   EMN LLR++E  PNS+ C
Sbjct: 531 KDLADEAAEYDTIDNLKGMLDYVAATMACHSSIRSGRLLHPEEMNALLRQIEATPNSATC 590

Query: 574 NHGRPTFIKLKLSDIEKLFGR 594
           NHGRPT+I+LKL+DIE+LFGR
Sbjct: 591 NHGRPTYIELKLADIERLFGR 611


>gi|260432213|ref|ZP_05786184.1| DNA mismatch repair protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416041|gb|EEX09300.1| DNA mismatch repair protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 618

 Score =  548 bits (1412), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 260/610 (42%), Positives = 390/610 (63%), Gaps = 25/610 (4%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+EN++DA ++R+   IA GGK+  ++TD+G G
Sbjct: 15  IRQLDEAAINRIAAGEVVERPASAVKELVENAIDAGATRIAIDIADGGKTLIRVTDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           +  E++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR P     AQI
Sbjct: 75  IAPEDLPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLTITSRAP-GAEAAQI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            ++G K+  V+P A+  GT+VE+RDLF+  PARL F+++++ E   I+D ++R+A+A P 
Sbjct: 134 RVAGGKMEPVKPAALRAGTVVELRDLFYATPARLKFMRTDRAEAQAISDTVKRLAMAEPS 193

Query: 182 VSFTFSTIKSN---RYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           ++FT   +      R        NG+  +    R+++++G +F  NA+ ++     I L 
Sbjct: 194 ITFTLRDVSGGGEGRVVFRADRENGDLFDALHARLARILGREFAENALRIDATREGIRLY 253

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   ++F+NGR V+DK +   +R AY + +   R+P   L ++ +P  
Sbjct: 254 GYAALPTYSRGAAVAQFLFVNGRPVRDKMLTGALRAAYFDFLSRDRHPAAALFIDCEPTL 313

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR+P + R  I+ S++ A+ + G   S+ ++   + +   + AP   
Sbjct: 314 VDVNVHPAKSEVRFRDPGVARGLIVSSLRHALAEAGHRASTTVANATLGAMRPEPAPVAP 373

Query: 355 LPKYATSLTNTQEKLFLQE----------NRLSTNDLLPSDDPTYSEDNDPVEESEATHY 404
              Y     +   +    +          N  S + + P  +P   +   P       H 
Sbjct: 374 ARVYQMDRPSPAARAMAYQAQAPGFADLANAYSGSVVEPVAEPAQPDQTPP------EHL 427

Query: 405 QLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIID 464
            LG A  Q+H+NYII+QT DG+VIVDQHAAHERL++EK+++      + +Q LL PEI++
Sbjct: 428 PLGAARGQVHENYIIAQTADGMVIVDQHAAHERLVYEKLKKQMAENGVAAQALLIPEIVE 487

Query: 465 LLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSS 524
           L EG+CA ++   +DL RLG+  E FG  A+A+RE PAIL + N   ++ DI+DE+ D  
Sbjct: 488 LSEGDCARLIAVADDLSRLGLTIEPFGGGAVAVRETPAILGEVNARAMILDILDELADQG 547

Query: 525 TTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLK 584
            + T+Q RIE IL+ +AC+GS+RSGR+M++ EMN LLREME  P+S QCNHGRPT+++LK
Sbjct: 548 ESQTVQARIEAILSRVACHGSVRSGRRMRAEEMNALLREMEATPHSGQCNHGRPTYVELK 607

Query: 585 LSDIEKLFGR 594
           LSDIE+LFGR
Sbjct: 608 LSDIERLFGR 617


>gi|99079943|ref|YP_612097.1| DNA mismatch repair protein [Ruegeria sp. TM1040]
 gi|99036223|gb|ABF62835.1| DNA mismatch repair protein MutL [Ruegeria sp. TM1040]
          Length = 644

 Score =  548 bits (1412), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 268/620 (43%), Positives = 396/620 (63%), Gaps = 29/620 (4%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA ++R+   IA GGK+  ++ DNG G
Sbjct: 25  IRQLDDGAINRIAAGEVVERPASAVKELVENAIDAGATRITVEIADGGKTLIRVIDNGCG 84

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT E++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  L + SR  + +  AQI
Sbjct: 85  MTPEDLPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLAITSRA-EGHDAAQI 143

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +SG  +  VRP A+  G+IVE+RDLFF  PARL F+++++ E   I+D ++R+A+A P 
Sbjct: 144 RVSGGHMEPVRPAALRQGSIVELRDLFFATPARLKFMRTDRAEMQAISDTVKRLAMAEPS 203

Query: 182 VSFTFSTIKSN---RYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT   +      R        NG+  +    R++ VIG +F  NA++++     I L 
Sbjct: 204 VGFTLRDVSGGGEGRVTFRADPMNGDLFDALHGRLAHVIGREFAENALKIDATREGIRLY 263

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   ++F+N R V+DK +   +R AY + +   R+P   L ++ DP  
Sbjct: 264 GYAALPTYSRGAAVTQFLFVNARPVKDKMLTGALRAAYMDFLSRDRHPAAALFIDCDPTL 323

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD-----N 349
           VDVNVHPAKS +RFR+P + R  I+ +++ A+ + G   SS ++   + +   +      
Sbjct: 324 VDVNVHPAKSEVRFRDPGLARGLIVSALRHALAEAGHRASSTVAGATLGAMRPEQPTATG 383

Query: 350 APKTH---LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSE----------DNDPV 396
           AP+ +    P      +    +   Q    S     PSD   ++E          +  P+
Sbjct: 384 APRVYQMDRPSLGARHSAYAAQTPAQPQAPSYAAPPPSDAVGFAEFSGTYSGRLVEETPL 443

Query: 397 EESE--ATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITS 454
           EE++  A    LG A  Q+H+NYII+QT DG+VIVDQHAAHERL++E++++      + +
Sbjct: 444 EEAQPPAEDQPLGAARGQVHENYIIAQTRDGMVIVDQHAAHERLVYERLKRQLAENGVAT 503

Query: 455 QTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLR 514
           Q LL PEII+L +G+CA ++E  EDL RLG+  E FG +A+A+RE PAIL + N   ++R
Sbjct: 504 QGLLIPEIIELSDGDCARLLEVAEDLARLGLGIEAFGGSAVAVRETPAILGEVNAEAMIR 563

Query: 515 DIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCN 574
           DI+DE+ D   +  +Q R+E IL+ +AC+GSIRSGR+M+  EMN LLREME+ P+S QCN
Sbjct: 564 DILDELADQGESQLVQARLEAILSRVACHGSIRSGRRMRGEEMNALLREMEQTPHSGQCN 623

Query: 575 HGRPTFIKLKLSDIEKLFGR 594
           HGRPT+++LKL+DIE+LFGR
Sbjct: 624 HGRPTYVELKLADIERLFGR 643


>gi|254438381|ref|ZP_05051875.1| DNA mismatch repair protein MutL [Octadecabacter antarcticus 307]
 gi|198253827|gb|EDY78141.1| DNA mismatch repair protein MutL [Octadecabacter antarcticus 307]
          Length = 613

 Score =  548 bits (1411), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 268/611 (43%), Positives = 400/611 (65%), Gaps = 38/611 (6%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+  +KELIEN+LDA +SRVE  +A GGK+  ++TDNG G
Sbjct: 21  IRQLDDAAINRIAAGEVVERPASVVKELIENALDARASRVEVFVADGGKTLIRVTDNGVG 80

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT++++P+A+ RH TSKI   D  NIH+FGFRGEALPS+GAV  LT+ SR      G +I
Sbjct: 81  MTAQDLPLALSRHATSKIDGSDLLNIHSFGFRGEALPSLGAVGRLTIRSRT-DGGEGCEI 139

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           ++SG   ++VRP A+  GTIVE+RDLF+  PARL FL++++ E   I+D ++R+A+A P 
Sbjct: 140 SVSGGAHTAVRPAALTVGTIVELRDLFYATPARLKFLRTDRAEMQAISDAVKRLAMAEPF 199

Query: 182 VSFTFSTIKSNRYKMNFQSTNGNFPE-------RISQVIGEDFINNAVELNEKSNEITLQ 234
           V+F  + +     ++ F++ NG   +       R+  V+G+DF  NA+ ++     + L 
Sbjct: 200 VTFVLTDVSGGNSRVTFRA-NGETGDMFDALHARLRSVLGKDFAENALAIDALREGVHLT 258

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG+A Q ++++NGR V+DK ++  +R AY +T+   R+P   L +++DP +
Sbjct: 259 GYAALPTYSRGSAVQQFLYVNGRPVRDKVLIGALRGAYMDTLSRDRHPAACLFIDVDPTR 318

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR+PTI+R  I+ +++ A+   G   SS ++   + +      P+  
Sbjct: 319 VDVNVHPAKSEVRFRDPTIVRGLIVSALRAALADAGHRASSTVASDTLGAMQ----PEQM 374

Query: 355 LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSED--------NDPVEESEATHYQ- 405
            P+              Q +R  T  + P+  P+   D         + VE ++    Q 
Sbjct: 375 EPR------------IYQMDR-PTGGIGPAYRPSGFADIATDMSGRVEVVEANDGPSAQE 421

Query: 406 --LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEII 463
             LG A AQ+H+NYII+QT  G+VIVD HAAHERL++EK++       + +Q LL PEII
Sbjct: 422 RPLGAARAQLHENYIIAQTETGIVIVDGHAAHERLVYEKLKTQMAENGVAAQALLIPEII 481

Query: 464 DLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDS 523
           ++  G+ A ++   +DL R G+  E FG NAIA+RE PAIL + N   +LRDI+DE+ D 
Sbjct: 482 EMSYGDAAQLLAVADDLSRFGLTIEPFGGNAIAVRETPAILGEVNAEAMLRDILDELSDQ 541

Query: 524 STTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKL 583
            ++  +Q+++E IL+ +AC+GSIR+GR M+  EMN LLREME+ P S QCNHGRPT+++L
Sbjct: 542 GSSTLVQEKLEAILSRVACHGSIRTGRSMRGEEMNALLREMERTPRSGQCNHGRPTYVEL 601

Query: 584 KLSDIEKLFGR 594
           KLSDIE+LFGR
Sbjct: 602 KLSDIERLFGR 612


>gi|118590698|ref|ZP_01548099.1| DNA mismatch repair protein [Stappia aggregata IAM 12614]
 gi|118436674|gb|EAV43314.1| DNA mismatch repair protein [Stappia aggregata IAM 12614]
          Length = 630

 Score =  546 bits (1406), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 267/635 (42%), Positives = 404/635 (63%), Gaps = 47/635 (7%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           MK+R+L E++INQIAAGE+IERP+  IKELIEN++DA + +VE V A GGK+  ++ D+G
Sbjct: 1   MKVRQLGEQVINQIAAGEVIERPASVIKELIENAVDAGAKQVEIVTAAGGKTLMRVADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM  E++ +A++RHCTSKISDD   +I T GFRGEALPSIG+V+ L + +R    +   
Sbjct: 61  EGMRREDLQLAIRRHCTSKISDDDLFDIRTLGFRGEALPSIGSVARLAIQTRHKDEDHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            IA+ G +   + P A   GT VEVRDLFF  PARL FLKS++ E   IT++++R+A+AY
Sbjct: 121 AIAVEGGREQPLVPAARTKGTQVEVRDLFFATPARLKFLKSDRAEAAAITEIVKRIALAY 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPE--RISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P++ F+     ++R   ++ +  G+ P   RI+Q++G+DF++NA+E++     + L G+ 
Sbjct: 181 PEIGFSLGG--ADRQSQSWPAARGSEPHLARIAQILGQDFVDNAMEIDAAREGVRLTGFA 238

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PT +RGNA   + F+NGR V+DK +LS +R AYA+ +   R+PVVVL +++DP  VDV
Sbjct: 239 GLPTHHRGNAQNQFFFVNGRPVKDKLLLSGLRGAYADVLARDRHPVVVLFIDLDPTLVDV 298

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA------P 351
           NVHPAK+ +RFR+  ++R  ++ +I+ A+ + G  +S+  +   + +    +A      P
Sbjct: 299 NVHPAKADVRFRDSQLVRGLLVGAIKHALVQSGHRSSTSNAAVALDAIRAQSAGFAQPGP 358

Query: 352 KTHLPKY--------------------------------ATSLTNTQEKLFLQENRLSTN 379
               P                                  AT      +  F ++N  + +
Sbjct: 359 TPSAPAGSGGYGGGSYTRTSAAPHWAPDAFSPLQMESTPATGFAEAPQPAFERQNGFA-D 417

Query: 380 DLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLI 439
              PS D   +  ND   E+E T   LG A AQ+H+ YII+QT DG+VIVDQHAAHERL+
Sbjct: 418 FARPSAD---ARANDVPVETEKTRLPLGAARAQVHETYIIAQTEDGVVIVDQHAAHERLV 474

Query: 440 FEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIRE 499
           +E++++      +  Q LL PEI++L E +   + +  EDL ++G+  E FGP AIA+RE
Sbjct: 475 YERLKEALARKDVARQILLIPEIVELPEEDAIRLADRAEDLEKVGLSLEAFGPGAIAVRE 534

Query: 500 IPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNR 559
            PAIL   +I  ++R++ DE+ +  T   L+++++++ ATMAC+GS+R+GR+M+  EM+ 
Sbjct: 535 TPAILGDMDIQGMVRNLADELAEWDTAEGLKEKLDHVAATMACHGSVRAGRRMRPEEMDA 594

Query: 560 LLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LLR+ME  P S QCNHGRPT+++LKL DIEKLFGR
Sbjct: 595 LLRDMEATPLSGQCNHGRPTWVELKLGDIEKLFGR 629


>gi|307941694|ref|ZP_07657049.1| DNA mismatch repair protein MutL [Roseibium sp. TrichSKD4]
 gi|307775302|gb|EFO34508.1| DNA mismatch repair protein MutL [Roseibium sp. TrichSKD4]
          Length = 630

 Score =  545 bits (1405), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 271/625 (43%), Positives = 402/625 (64%), Gaps = 36/625 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M++R+L E IIN+IAAGE+IERP+  IKEL+EN++DA +S V+ V A GGK+  +++D+G
Sbjct: 10  MQVRQLGEAIINRIAAGEVIERPASVIKELVENAIDAGASSVDIVTAAGGKTLMRVSDDG 69

Query: 61  FGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM   ++ +A++RHCTSKISDD   +I T GFRGEALPSIG+V+ L + +R  +     
Sbjct: 70  IGMRRSDLELAIRRHCTSKISDDDLFDIRTLGFRGEALPSIGSVARLAIQTRHSEEENAW 129

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            I + G K SS+ P A   GT +EVRDLFF  PARL FLKS++ E   IT+++RR+A+AY
Sbjct: 130 TIKVEGGKESSIIPAARTKGTQIEVRDLFFATPARLKFLKSDRAEAAAITEIVRRIALAY 189

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPE--RISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P + F+ S   S+R   N+ +  G+ P   RISQV+G++F++NA+E++     + L G+ 
Sbjct: 190 PHIGFSLSG--SDRQPANWPAARGDEPHLARISQVLGKEFVDNAMEIDAAREGVRLSGFA 247

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PTF+RGNA   + F+NGR V+DK +LS +R AYA+ +   R+ VVVL +++DP  VDV
Sbjct: 248 GLPTFHRGNAQHQFFFVNGRPVKDKLLLSGLRGAYADVLARDRHSVVVLFIDLDPAFVDV 307

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKG-ISTSSVLSKKMISSFHQDNAPKT--- 353
           NVHPAK+ +RFR+  ++R  ++ SI++A+ + G  S++S  +  M     Q  AP+    
Sbjct: 308 NVHPAKADVRFRDGQLVRGLLVGSIKQALVQAGHRSSTSNAAAAMDVIRAQGFAPRAPSG 367

Query: 354 ---HLPKY--------------------ATSLTNTQEKLFLQENRLSTNDL-LPSDDPTY 389
                P Y                    A   ++ ++ +F        + L +PS D   
Sbjct: 368 SGNATPAYQPQRSNAAWSQDAFRPLEPTARGFSDGEQSVFDAPREAGLSGLSMPSADARA 427

Query: 390 SEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
            E      E E T   LG   AQ+H+ YII+QT DG+VIVDQHAAHERL++EK+++    
Sbjct: 428 HEKQI---EPEKTSLPLGAPRAQVHETYIIAQTDDGVVIVDQHAAHERLVYEKLKESLAK 484

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             +  Q LL PEI+++ E +   + +H  +L  +G+  E FGP A+A+RE PAIL   NI
Sbjct: 485 KDVARQLLLIPEIVEMPEEDVGRLTDHATELEEVGLVLEAFGPGAVAVRETPAILGDMNI 544

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
             ++ ++ DE+ +  T   L+++++++ ATMAC+GSIR+GR+M+  EM +LLR+ME  P 
Sbjct: 545 KGMVLNLADELAEWETASGLKEKLDHVAATMACHGSIRAGRRMRVEEMAQLLRDMEATPL 604

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+++LKL DIEKLFGR
Sbjct: 605 SGQCNHGRPTWVELKLDDIEKLFGR 629


>gi|83951218|ref|ZP_00959951.1| DNA mismatch repair protein [Roseovarius nubinhibens ISM]
 gi|83839117|gb|EAP78413.1| DNA mismatch repair protein [Roseovarius nubinhibens ISM]
          Length = 636

 Score =  545 bits (1403), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 270/622 (43%), Positives = 397/622 (63%), Gaps = 31/622 (4%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN+LD+ ++R+E   A GGKS  ++TDNG G
Sbjct: 15  IRQLDDAAINRIAAGEVVERPASAVKELVENALDSGATRIEISQAQGGKSLIRVTDNGCG 74

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT +++P+A+ RH TSKI   D  NIH+FGFRGEALPS+GAV  LT+ SR   ++  A+I
Sbjct: 75  MTPQDLPLALSRHATSKIDGSDLLNIHSFGFRGEALPSLGAVGRLTIQSRAAGHDA-AEI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +SG  +S+ RP A++ GT+V +RDLF+  PARL F++S++ ET  I DV++R+A+A P 
Sbjct: 134 TVSGGDMSAPRPTALSAGTVVTLRDLFYATPARLKFMRSDRAETQAIADVVKRLAMAEPS 193

Query: 182 VSFTFSTIKSN---RYKMNFQSTNGNF----PERISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT   +      R         G+       R+++V+G +F  NA++++     + + 
Sbjct: 194 VGFTLRDVTGGGEGRVTFRADPEQGDLFDALHRRLARVLGAEFAENAIKIDASREALRMT 253

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   Y+F+NGR V+DK +   +R AY + +   R+P  VL L  DP  
Sbjct: 254 GYAALPTYSRGAAVAQYLFVNGRPVRDKMLTGALRAAYHDLLSRDRHPAAVLFLTCDPTL 313

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD-----N 349
           VDVNVHPAKS +RFR+P + R  I+  ++ A+ ++G   SS ++   + +F  +      
Sbjct: 314 VDVNVHPAKSEVRFRDPALARGLIVSGLRHALAEEGHRASSTVAGATLGAFRPEATAPGQ 373

Query: 350 APKTH---LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESE--ATH- 403
           AP+ +    P  A+     Q +  L    LS +         YS   +P E S   A H 
Sbjct: 374 APRVYQMDRPGPASRAMAYQAQAPLTGAPLSQSPGFADLQAGYSARVEPDELSAPLADHP 433

Query: 404 -----------YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
                        LG A AQIH+NYII+QT DGLVIVDQHAAHERL++EK++       +
Sbjct: 434 GHEAQADAPLSAPLGAARAQIHENYIIAQTEDGLVIVDQHAAHERLVYEKLKTQQAERGV 493

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
            +Q LL PEI++L +G+   +++  EDL  LG+  E FG +A+A+RE+PAIL   +   L
Sbjct: 494 AAQALLIPEIVELSDGDRGALLDAAEDLAALGLVIEEFGGSAVAVREVPAILGAVDARAL 553

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           L D++DE+ D  ++ T++ RI+ IL+ +AC+GSIRSGR+M++ EMN LLREME  P+S Q
Sbjct: 554 LLDVLDELSDQGSSMTIRGRIDAILSRVACHGSIRSGRRMRAEEMNALLREMEATPHSGQ 613

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT++KL+L+DIE+LFGR
Sbjct: 614 CNHGRPTYVKLQLADIERLFGR 635


>gi|319408063|emb|CBI81717.1| DNA mismatch repair protein MutL [Bartonella schoenbuchensis R1]
          Length = 615

 Score =  544 bits (1402), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 276/617 (44%), Positives = 400/617 (64%), Gaps = 26/617 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  +KEL+EN++DA ++R+E V A GGK+  +++DNG
Sbjct: 1   MIIRHLSETIINQIAAGEVIERPANVVKELVENAIDAGATRIEIVTANGGKNLIRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+  +++ +A+ RHCTSK+ DD  NI   GFRGEALPSIG+V+ L L+SR    ++ A+
Sbjct: 61  CGIPKDQLTLAISRHCTSKLVDDVHNICFLGFRGEALPSIGSVAKLKLVSRTQDADSAAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ++  KI   +P A N GT VEVRDLFF  PARL F+K++  E N ITD+I+R+AIA+P
Sbjct: 121 IIVTAGKIEGPKPAAANSGTTVEVRDLFFVTPARLKFMKTDSAEMNAITDMIKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFP---ERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            + F+ S    +R  +   +T  N     ERI+Q++G++F +N + LN +     L G+ 
Sbjct: 181 HIRFSLS--GKDRTLIELPATENNTQGQLERITQIMGKEFGSNTITLNAERETARLTGFA 238

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
            +P+FNRGN+   +V++NGR V+DKF+   IR AY + +   R+ V +L +++ P  VDV
Sbjct: 239 CLPSFNRGNSLHQFVYVNGRPVRDKFLSGAIRGAYTDVMAPNRHAVSILFIDLPPADVDV 298

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKT-HLP 356
           NVHPAK+ +RFR+P +IR  II +I +A+ + GI  SS  SK M+++F + ++ KT   P
Sbjct: 299 NVHPAKADVRFRDPGLIRGLIIGAIHEALRQTGIRPSSTGSKAMLAAFQRQSSFKTFRSP 358

Query: 357 KYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYS---EDNDPVEE--------------- 398
                 + + +  ++     S  D  P D P +S   ED  P+ E               
Sbjct: 359 SPHQPFSYSPQPQYVAPGTTSA-DHKPVDIPDFSGLREDITPMIEYVNTPSSDVGFVNTS 417

Query: 399 -SEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTL 457
            SE  +Y LG A AQIH+NYI++QT + L+IVDQHAAHERL++E ++    S  + SQ L
Sbjct: 418 TSEELYYPLGAAKAQIHKNYIVAQTKNSLIIVDQHAAHERLVYEALKNALYSKPLPSQLL 477

Query: 458 LTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDII 517
           L PEI++L E + A ++ H + L + G+  E FG  AI +RE P +L + N   L++D++
Sbjct: 478 LIPEIVELSEEDAACLLVHKDVLQKFGLGIEAFGSGAIVVRETPTMLGEINAQALIKDLV 537

Query: 518 DEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGR 577
           DE  +  TT  L+  + ++ ATMAC+ SIRSGR +   EMN LLR+ME  PNSS CNHGR
Sbjct: 538 DEASEYDTTDNLKAMLNHVAATMACHSSIRSGRLLHPKEMNALLRQMEATPNSSTCNHGR 597

Query: 578 PTFIKLKLSDIEKLFGR 594
           PT+I+LKL+DIE+LFGR
Sbjct: 598 PTYIELKLADIERLFGR 614


>gi|154250749|ref|YP_001411573.1| DNA mismatch repair protein [Parvibaculum lavamentivorans DS-1]
 gi|154154699|gb|ABS61916.1| DNA mismatch repair protein MutL [Parvibaculum lavamentivorans
           DS-1]
          Length = 602

 Score =  543 bits (1400), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 249/604 (41%), Positives = 393/604 (65%), Gaps = 16/604 (2%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR+LSE  IN+IAAGE++ERP+ A+KEL+EN+LDA +  ++ VI GGG+   ++TD+G 
Sbjct: 3   RIRRLSEGTINRIAAGEVVERPASAVKELVENALDAGARHIDIVIDGGGRDLIRVTDDGI 62

Query: 62  GMTSEEIPMAVQRHCTSKI------SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQN 115
           GM +EE+ +AV+RH TSK+       +D  +I T GFRGEALPSIGAV+ L+++SR    
Sbjct: 63  GMNAEELALAVERHATSKLRIDAGGQEDLHDIATLGFRGEALPSIGAVARLSIVSRTRDA 122

Query: 116 NTGAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRM 175
           ++  +I++ G +++ V P +   GT +EVRDLF+  PARL F+KSE+ ET  ++DV++R+
Sbjct: 123 DSAERISVEGGRVTDVEPASGRAGTQIEVRDLFYATPARLKFMKSERAETLAVSDVVKRL 182

Query: 176 AIAYPKVSFTFSTIKSN--RYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITL 233
           A+A+P+V FT ++ + N  R +       G    R+  ++G DF  NA+ ++    EI L
Sbjct: 183 AMAHPEVGFTLTSAERNLLRLEPELPGDAGRL-MRLGAIMGRDFAENAIAIDAMREEIGL 241

Query: 234 QGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPR 293
            G+ G+PT+NRG A   Y+F+NGR V+DK ++  +R AYA+ +   R+P V L + IDPR
Sbjct: 242 AGFAGLPTYNRGTAQMQYLFVNGRPVRDKLLVGAVRGAYADFLARDRHPAVALFVTIDPR 301

Query: 294 QVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKT 353
            VDVNVHPAK+ +RFR+  ++R  I+ ++++A+ + G   S+ ++   + +   + A  +
Sbjct: 302 DVDVNVHPAKAEVRFRDAGLVRGLIVGALKRALAEAGHRASTTVAGATLDALRPEMAAAS 361

Query: 354 HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEES---EATHYQLGIAC 410
             P Y  +        F +E          +     S   +P+ ES    A  + LG+A 
Sbjct: 362 --PAYTGTWRPEPRPGFAEERGAWQGAF--AGLAAQSARVEPLPESGAETAAGFALGVAR 417

Query: 411 AQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGEC 470
            Q+H+ Y+I+QT DG+VIVDQHAAHERL++E+M++   +  ++ Q LL PE+++L E E 
Sbjct: 418 GQLHETYVIAQTADGIVIVDQHAAHERLVYERMKKAMAAQGVSRQMLLIPEVVELDEAEA 477

Query: 471 ALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQ 530
             +     +L  LG   E FG  A+ +RE+P+I  K ++  L+RD+ D++ +     +L+
Sbjct: 478 ERLAARVGELAELGFVLEAFGTGAVVVREVPSIFGKLDVQALVRDLADDLTELDEALSLK 537

Query: 531 DRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEK 590
           +++E +  T+AC+GS+R+GR++ + EMN LLREME  P+S QCNHGRPT+++LKLSDIE+
Sbjct: 538 EKLEEVCGTIACHGSVRAGRRLTAEEMNALLREMEATPHSGQCNHGRPTYVELKLSDIER 597

Query: 591 LFGR 594
           LFGR
Sbjct: 598 LFGR 601


>gi|254510493|ref|ZP_05122560.1| DNA mismatch repair protein MutL [Rhodobacteraceae bacterium KLH11]
 gi|221534204|gb|EEE37192.1| DNA mismatch repair protein MutL [Rhodobacteraceae bacterium KLH11]
          Length = 616

 Score =  543 bits (1400), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 265/606 (43%), Positives = 389/606 (64%), Gaps = 19/606 (3%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA ++R+   IA GGK+  ++TD+G G
Sbjct: 15  IRQLDDAAINRIAAGEVVERPASAVKELVENAIDAGATRIAIDIADGGKTLIRVTDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           + + ++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  L++ SR P     A I
Sbjct: 75  IAASDLPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLSITSRVP-GAEAASI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +SG ++ +VRP A+  GT+VE+RDLF+  PARL F+++++ E   I+D+++R+A+A P 
Sbjct: 134 RVSGGQMQAVRPAALRAGTVVELRDLFYATPARLKFMRTDRAEAQAISDIVKRLAMAEPA 193

Query: 182 VSFTFSTIKSN---RYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           VSFT   +      R        NG+  +    R+++V+G +F  NA++++     I L 
Sbjct: 194 VSFTLRDVSGGGEGRVTFRTDRENGDLFDALHARLARVLGREFAENALQIDATREGIRLY 253

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   Y+F+NGR V+DK +   +R AY + +   R+P   L ++ DP  
Sbjct: 254 GYAALPTYSRGAAVAQYLFVNGRPVRDKMLTGALRAAYFDFLSRDRHPAAALFIDCDPTL 313

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR+P + R  I+ S++ A+ + G   SS ++   + +   + AP   
Sbjct: 314 VDVNVHPAKSEVRFRDPGLARGLIVSSLRHALAEAGHRASSTVANATLGAMRPEPAPSAP 373

Query: 355 LPKYATSLTNTQEKLFLQENRLSTNDLLPSD------DPTYSEDNDPVEESEATHYQLGI 408
              Y     +   +      +      L  D      DP  + +  PVEE +     LG 
Sbjct: 374 ARVYQMDRPSPAARQAAYRAQSPGFAELSQDYSGRVVDP--APEVAPVEEPQ--DLPLGA 429

Query: 409 ACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEG 468
           A  Q+H+NYII+QT DG+VIVDQHAAHERL++EK++       + +Q LL PEI++L +G
Sbjct: 430 ARGQVHENYIIAQTADGMVIVDQHAAHERLVYEKLKSQMAENGVAAQALLIPEIVELSDG 489

Query: 469 ECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYT 528
           +C  +M   EDL RLG+  E FG  AIAIRE PAIL + +   ++ DI+DE+ D   +  
Sbjct: 490 DCTRLMAVAEDLSRLGLTIEAFGGGAIAIRETPAILGEVDARAMILDILDELADQGESQM 549

Query: 529 LQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDI 588
           +Q RIE IL+ +AC+GSIRSGR+M++ EMN LLREME  P+S QCNHGRPT+++LKL DI
Sbjct: 550 VQARIEAILSRVACHGSIRSGRRMRAEEMNALLREMEATPHSGQCNHGRPTYVELKLGDI 609

Query: 589 EKLFGR 594
           E+LFGR
Sbjct: 610 ERLFGR 615


>gi|84684369|ref|ZP_01012270.1| DNA mismatch repair protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84667348|gb|EAQ13817.1| DNA mismatch repair protein [Rhodobacterales bacterium HTCC2654]
          Length = 610

 Score =  542 bits (1397), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 273/607 (44%), Positives = 394/607 (64%), Gaps = 25/607 (4%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA S+R++   A GGK+  ++TD+G G
Sbjct: 13  IRQLDDAAINRIAAGEVVERPASAVKELVENTIDAGSTRIDVAYADGGKTLIRVTDDGCG 72

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           + +E++P+A+ RH TSKI   D  +IHTFGFRGEALPS+GAV  LT+ SR   +   A I
Sbjct: 73  IPAEDLPLAMSRHATSKIDGSDLLDIHTFGFRGEALPSLGAVGRLTITSR--CDGAAASI 130

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            ++G K   VRP A++ GT+VE+RDLFF  PARL FL++++ E   ITDV++R+A+A P 
Sbjct: 131 RVAGGKAEPVRPAALSRGTVVELRDLFFATPARLKFLRTDRAEAQAITDVVKRLAMAEPH 190

Query: 182 VSFTFSTIKSN---RYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           + FT   +      R        NG+  +    R+  V+G DF  NAV L+       L 
Sbjct: 191 IGFTLRDVSGGGEGRVTFRAAPENGDLFDALHARLGGVLGRDFAENAVPLDALREGFRLT 250

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   ++F+NGR V+DK ++  +R AYA+ +   R+P   L +  DP+ 
Sbjct: 251 GYAALPTYSRGAAVAQFLFVNGRPVRDKLLIGALRGAYADFLSRDRHPAAALFVTCDPKL 310

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR P ++R  I+ +I+ A+ + G   SS +++  + +   +    TH
Sbjct: 311 VDVNVHPAKSEVRFREPGLVRGLIVTTIRHALAEAGHRASSTVAQSTLGAMRPE---PTH 367

Query: 355 LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPV-------EESEATHYQLG 407
              Y     +   ++ L   R + + +  ++ P  S   DPV       E   A    LG
Sbjct: 368 ARVYQM---DRPSQVVLHTAREAQSPMGFAETP--SARFDPVIEPEPTPETPPAESLPLG 422

Query: 408 IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLE 467
            A AQ+H+NYI++QT DG+VIVDQHAAHERL++EK+++      + SQ LL PEI+DL E
Sbjct: 423 AARAQVHENYIVAQTEDGMVIVDQHAAHERLVYEKLKRQMAENGVASQALLIPEIVDLSE 482

Query: 468 GECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTY 527
           G+ +L++   +DL RLG+  E FG  AIA+RE PAIL + N   ++RDI+DE+ D   + 
Sbjct: 483 GDASLLLGLADDLARLGLVIEPFGGGAIAVRETPAILGQVNAEAMIRDILDELADLGQSQ 542

Query: 528 TLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSD 587
           TLQ RIE +L+ +AC+GSIRSGR M+  EMN LLREME  P+S QCNHGRPT+++LKL+D
Sbjct: 543 TLQARIEAVLSRVACHGSIRSGRWMRPEEMNALLREMEATPHSGQCNHGRPTYVELKLAD 602

Query: 588 IEKLFGR 594
           IE+LFGR
Sbjct: 603 IERLFGR 609


>gi|254450749|ref|ZP_05064186.1| DNA mismatch repair protein MutL [Octadecabacter antarcticus 238]
 gi|198265155|gb|EDY89425.1| DNA mismatch repair protein MutL [Octadecabacter antarcticus 238]
          Length = 621

 Score =  542 bits (1397), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 260/610 (42%), Positives = 404/610 (66%), Gaps = 36/610 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+  +KELIEN+LDA +SRVE  +A GGK+  ++TDNG G
Sbjct: 29  IRQLDDAAINRIAAGEVVERPASVVKELIENALDARASRVEVFVADGGKTLIRVTDNGVG 88

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT++++P+A+ RH TSKI   D  NIH+FGFRGEALPS+GAV  LT+ SR      G +I
Sbjct: 89  MTAQDLPLALSRHATSKIDGSDLLNIHSFGFRGEALPSLGAVGRLTIRSRT-NGGEGCEI 147

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           ++SG   ++VRP A+  GTIVE+RDLF+  PARL FL++++ E   I++V++R+A+A P 
Sbjct: 148 SVSGGAHTAVRPAALTAGTIVELRDLFYATPARLKFLRTDRAEMQAISEVVKRLAMAEPF 207

Query: 182 VSFTFSTIKSNRYKMNFQS---TNGNFPE---RISQVIGEDFINNAVELNEKSNEITLQG 235
           V+F  + +   + ++ F++   T   F     R+  V+G+DF  NA+ ++ + + + L G
Sbjct: 208 VTFVLTDVSGGKSRVTFRADGETGDMFDALHARLRGVLGKDFAENALAIDAQRDGVHLTG 267

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           +  +PT++RG+A Q ++++NGR V+DK ++  +R AY +T+   R+P   L ++++P +V
Sbjct: 268 FAALPTYSRGSAVQQFLYVNGRPVRDKVLIGALRGAYMDTLSRDRHPAACLFIDVEPTRV 327

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL 355
           DVNVHPAKS +RFR+P I+R  I+ +++ A+ + G   SS ++ + + +   +       
Sbjct: 328 DVNVHPAKSEVRFRDPAIVRGLIVSALRAALAQAGHRASSTVANETLGAMQPEQ------ 381

Query: 356 PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDN-----------DPVEESEATHY 404
                    T+ +++ Q +R  T  + P+  P+   D            +P +   A  +
Sbjct: 382 ---------TEPRVY-QMDR-PTGGIGPAYRPSGFADMAQDMSGRVEMIEPNDGPRAEEH 430

Query: 405 QLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIID 464
            LG A AQ+H+NYII+QT  G+VIVD HAAHERL++EK++       + +Q LL PEII+
Sbjct: 431 PLGAARAQVHENYIIAQTETGIVIVDGHAAHERLVYEKLKTQMAENGVAAQALLIPEIIE 490

Query: 465 LLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSS 524
           + + + A ++   ++L R G+  E FG  AIA+RE PAIL + N   +LRDI+DE+ D  
Sbjct: 491 MSDDDAAQLLAVADELSRFGLTIEPFGGRAIAVRETPAILGEVNAEAMLRDILDELSDQG 550

Query: 525 TTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLK 584
           ++  +Q+++E IL+ +AC+GSIR+GR M+  EMN LLREME+ P S QCNHGRPT+++LK
Sbjct: 551 SSTLVQEKLEAILSRIACHGSIRTGRSMRGEEMNALLREMERTPRSGQCNHGRPTYVELK 610

Query: 585 LSDIEKLFGR 594
           LSDIE+LFGR
Sbjct: 611 LSDIERLFGR 620


>gi|254462767|ref|ZP_05076183.1| DNA mismatch repair protein MutL [Rhodobacterales bacterium
           HTCC2083]
 gi|206679356|gb|EDZ43843.1| DNA mismatch repair protein MutL [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 609

 Score =  542 bits (1396), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 262/603 (43%), Positives = 391/603 (64%), Gaps = 20/603 (3%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA + R+E   A GGK+  ++ D+G G
Sbjct: 15  IRQLDDAAINRIAAGEVVERPASAVKELVENAIDAGAHRIEVAYADGGKTLIRVVDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           +  + +P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT++SR   ++   +I
Sbjct: 75  IIPQALPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLTIISRAVGHDA-FEI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           A++G  +S+V+P A++ GT+VE+RDLFF  PARL F+++++ E+  ITDV++R+A+A P 
Sbjct: 134 AVNGGAMSAVKPAALSKGTVVELRDLFFATPARLKFMRTDRAESQAITDVVKRLAMAEPF 193

Query: 182 VSFTFSTIKSN---RYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT   +      R      + +G+  +    R++ +IG +F +N++ +  +   + L 
Sbjct: 194 VGFTLRDVTGGGEGRVTFRADAESGDLFDALYGRLAGIIGREFADNSLRIEAEREGLHLT 253

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           G+  +PT++RG+A   Y+F+NGR V+DK +   +R AY + +   R+P   L L+ DP+ 
Sbjct: 254 GFAALPTYSRGSAVTQYLFVNGRPVRDKLLYGALRGAYFDFLSRDRHPAAALFLDCDPQL 313

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR+P + R  I+ +++ A+ + G   S+ ++   + +      P+  
Sbjct: 314 VDVNVHPAKSEVRFRDPGLARGLIVSALRHALAEAGHRASTTVADATLGAMR----PEQT 369

Query: 355 LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPT---YSEDNDPVEESEATHYQLGIACA 411
            P     +    +       R S     P    T   +S     VEE  A  + LG A  
Sbjct: 370 GPARVYQMDRPSQGAL----RASYQVQAPGFGETAGVFSRVEPLVEEPPAEQFPLGAARG 425

Query: 412 QIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECA 471
           Q+H+NYII+QT DG+VIVDQHAAHERL++EK++       + +Q LL PEI++L + +CA
Sbjct: 426 QVHENYIIAQTADGMVIVDQHAAHERLVYEKLKDQMAENGVAAQALLIPEIVELSDNDCA 485

Query: 472 LIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQD 531
            +ME   DL RLG+  ERFG  AIA+RE PAIL + N   +L DI+DE+ D   +  LQ 
Sbjct: 486 RLMEIATDLERLGLGIERFGGGAIAVRETPAILGEVNAKAMLLDILDELTDQGESIALQA 545

Query: 532 RIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKL 591
           +IE IL+ +AC+GSIRSGR+M+  EMN LLREME  P+S QCNHGRPT+++LKL+DIE+L
Sbjct: 546 KIEAILSRVACHGSIRSGRRMRGEEMNALLREMEATPHSGQCNHGRPTYVELKLADIERL 605

Query: 592 FGR 594
           FGR
Sbjct: 606 FGR 608


>gi|114763561|ref|ZP_01442966.1| DNA mismatch repair protein [Pelagibaca bermudensis HTCC2601]
 gi|114543841|gb|EAU46853.1| DNA mismatch repair protein [Roseovarius sp. HTCC2601]
          Length = 621

 Score =  541 bits (1394), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 267/626 (42%), Positives = 405/626 (64%), Gaps = 44/626 (7%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA + RV   +A GGK+  ++TD+G G
Sbjct: 5   IRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGARRVTIELADGGKTLIRVTDDGCG 64

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M+++E+P+A+ RH TSKI   D  NIH+FGFRGEALPS+GAV  LT+ SR       A+I
Sbjct: 65  MSADELPLALSRHATSKIDGSDLLNIHSFGFRGEALPSLGAVGRLTIQSRA-SGEEAAEI 123

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           A++G ++++V+P A+N GT+V +RDLFF  PARL FL+S++ E   I++VI+R+A+A P 
Sbjct: 124 AVAGGQMAAVKPCALNGGTVVTLRDLFFATPARLKFLRSDRAEMQAISEVIKRLAMAEPS 183

Query: 182 VSFTFSTIKSNRYKMNFQS--TNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQG 235
           V FT   +   + +  F++   +G+  +    R++QV+G +F +NA+ ++ +     L G
Sbjct: 184 VGFTLRDVSEGKDRTTFRADPCSGDLFDALRGRLAQVMGAEFTDNALNIDAEREGFRLTG 243

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
              +PT++RG++   ++F+NGR VQD+ +L  +R AYA+ +   R+P V L ++ DP +V
Sbjct: 244 LAALPTYSRGSSVAQHLFVNGRPVQDRLLLGALRGAYADYLSRERHPAVALFVDCDPHKV 303

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVL------------------ 337
           DVNVHPAKS +RFR P ++R  I+ +++ A+ + G   S+ +                  
Sbjct: 304 DVNVHPAKSEVRFREPGLVRGLIVSALRHALAEAGHRASTTVAGATLGAMRPEPSGPPRV 363

Query: 338 ------SKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSE 391
                 S+  +SS ++  AP T    Y        +    Q  R +          ++S 
Sbjct: 364 YQMDRPSQGALSSAYRAQAPMTPAEPY--------QPFEAQAPRPAETGFAEFAG-SFSG 414

Query: 392 DNDPVEESEATHYQ---LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFN 448
             DPVEES     +   LG A  Q+H+NYII+QT DG+VIVDQHAAHERL++EK++    
Sbjct: 415 RVDPVEESPQGSDETLPLGAARGQVHENYIIAQTGDGIVIVDQHAAHERLVYEKLKHQMA 474

Query: 449 STKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKN 508
              + +Q LL PEI++L   + + ++   +DL R+G+  E FG +A+A+RE PAIL + N
Sbjct: 475 ERGVAAQALLIPEIVELSADDLSRLLSIADDLSRMGLTIEAFGGSAVAVRETPAILGEVN 534

Query: 509 IPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNP 568
              LL DI+DEI D  ++  +Q++IE IL+ +AC+GSIRSGR+M++ EMN LLREME  P
Sbjct: 535 AKALLTDILDEIADFGSSQLVQEKIEAILSRVACHGSIRSGRRMRAEEMNALLREMEATP 594

Query: 569 NSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +S QCNHGRPT+++LKLSDIE+LFGR
Sbjct: 595 HSGQCNHGRPTYVELKLSDIERLFGR 620


>gi|56698186|ref|YP_168558.1| DNA mismatch repair protein [Ruegeria pomeroyi DSS-3]
 gi|56679923|gb|AAV96589.1| DNA mismatch repair protein MutL [Ruegeria pomeroyi DSS-3]
          Length = 621

 Score =  541 bits (1394), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 261/611 (42%), Positives = 395/611 (64%), Gaps = 22/611 (3%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR+L E  IN+IAAGE++ERP+ A+KEL+EN++DA ++R+   +A GGK+  +++D+G 
Sbjct: 14  EIRQLDETAINRIAAGEVVERPASAVKELVENAIDAGATRIAIDLADGGKTLIRVSDDGC 73

Query: 62  GMTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           GMT +++P+A+ RH TSKI   D  NIHTFGFRGEALPS+G+V  LT+ SR  +    A 
Sbjct: 74  GMTPDQLPLALARHATSKIDGSDLLNIHTFGFRGEALPSLGSVGRLTITSRA-RGAEAAN 132

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I +SG ++  V+P A+  GT+VE+RDLFF  PARL F+++++ E   + D ++R+A+A P
Sbjct: 133 IRVSGGRVDPVKPAALRAGTVVELRDLFFATPARLKFMRTDRAEAQAVADTVKRLAMAEP 192

Query: 181 KVSFTFSTIKSN---RYKMNFQSTNGNF----PERISQVIGEDFINNAVELNEKSNEITL 233
            VSFT   +      R      +  G+      +R++QV+G +F +NA+ ++     + L
Sbjct: 193 SVSFTLRDVSGGGEGRLVFRADAETGDLFDALRDRLAQVMGREFTDNALRIDTMREGLRL 252

Query: 234 QGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPR 293
            GY  +PT++RG A   Y+F+NGR V+DK +   +R AY + +   R+P   L ++ DP 
Sbjct: 253 YGYAALPTYSRGAAVAQYLFVNGRPVRDKMLTGALRAAYFDFLSRDRHPAAALFIDCDPT 312

Query: 294 QVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAP-- 351
            VDVNVHPAKS +RFR+P + R  I+ +++ A+ + G   S+ ++   + +   +     
Sbjct: 313 LVDVNVHPAKSEVRFRDPGVARGLIVSALRHALAEAGHRASTTVAGATLGAMRPEQTGAR 372

Query: 352 --KTHLPKYATSLTNTQEKL--FLQENRLSTNDLLPSDDPTYSED----NDPVEESEATH 403
             +   P  A  + + Q +   F + +   +  ++   +P   ED     +P  E+    
Sbjct: 373 IYQMDRPSPAARMASHQAQAPGFAELSSSYSGRMV---EPEPGEDARRAEEPPAETPPES 429

Query: 404 YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEII 463
             LG A  Q+H+NYII+QT DG+VIVDQHAAHERL++EK+++    T + +Q LL PEI+
Sbjct: 430 LPLGAARGQVHENYIIAQTADGMVIVDQHAAHERLVYEKLKRQMAETGVAAQALLIPEIV 489

Query: 464 DLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDS 523
           +L   +CA +++  +DL RLG+  E FG  A+A+RE PAIL   +   +LRDI+DE+ D 
Sbjct: 490 ELSTADCARLLDLSDDLARLGLTIEPFGGGAVAVRETPAILGPVDAGAMLRDILDELADQ 549

Query: 524 STTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKL 583
             + TLQ RIE IL+ +AC+GSIRSGR+M+  EMN LLREME  P+S QCNHGRPT+++L
Sbjct: 550 GESATLQARIEAILSRVACHGSIRSGRRMRGEEMNALLREMEATPHSGQCNHGRPTYVEL 609

Query: 584 KLSDIEKLFGR 594
           KLSDIE+LFGR
Sbjct: 610 KLSDIERLFGR 620


>gi|146278965|ref|YP_001169124.1| DNA mismatch repair protein [Rhodobacter sphaeroides ATCC 17025]
 gi|145557206|gb|ABP71819.1| DNA mismatch repair protein MutL [Rhodobacter sphaeroides ATCC
           17025]
          Length = 612

 Score =  536 bits (1381), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 259/602 (43%), Positives = 391/602 (64%), Gaps = 15/602 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+EN+LDA + RV   IA GGK+  ++TD+G G
Sbjct: 15  IRQLDEAAINRIAAGEVVERPASAVKELVENALDAGARRVSVDIADGGKTLIRVTDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT+E++P+A+ RH TSKI   D  +I +FGFRGEALPS+ AV  LT+ SR      GA +
Sbjct: 75  MTAEDLPLALSRHATSKIDGSDLLDIRSFGFRGEALPSLAAVGRLTMTSRV-AGGEGAAV 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +S  ++  VRP A+  GT+VE+RDLFF  PARL FL++++ ET  I +V+RR+A+A P+
Sbjct: 134 TVSAGRMEPVRPAALGAGTVVELRDLFFATPARLKFLRTDRAETQAIAEVVRRLALAEPE 193

Query: 182 VSFTFSTIKSNRYKMNF--QSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQG 235
           V FT +   +   ++ F  ++  G+  +    R+++V+G DF  NA+ ++     + LQG
Sbjct: 194 VGFTLTDHSAGEPRLLFRAEAEGGDLFDALHRRVARVVGADFAENALRIDVAREGLRLQG 253

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y  +PT++RG+A   ++F+NGR V D+ +L  +R  Y + +   RYP  VL L  DP++V
Sbjct: 254 YAALPTYSRGSAVAQFLFVNGRPVLDRMLLGALRAGYMDVLSRDRYPAAVLNLICDPQRV 313

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL 355
           DVNVHPAK+ +RFR    +R  I+ ++++A+   G   S+ ++ + + +F  + A     
Sbjct: 314 DVNVHPAKAEVRFRESGEVRGLIVTALRQALAGAGHRASTTVAGETLEAFRPEAAAPPAA 373

Query: 356 PKYAT---SLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQ 412
             Y     S  +       Q  + +   L  ++ P    +  PV+ +E     LG A AQ
Sbjct: 374 RIYQMDRPSAASVARSFAFQAPQAAMPGL--AEAPAARVEEAPVDAAE--DRPLGAARAQ 429

Query: 413 IHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECAL 472
           IH N+I++QT  GLVIVDQHAAHERL++E++++  +   I  Q LL PEI++L   + A 
Sbjct: 430 IHGNWILAQTARGLVIVDQHAAHERLVYERLKRQRDGAGIARQVLLIPEIVELSPSDAAR 489

Query: 473 IMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDR 532
           ++E  ++L  LG+  E FG  A+A+RE+PAIL K     LLRDI+D++ D  ++  LQ R
Sbjct: 490 LLEAADELAALGLVLEPFGGGAVAVREVPAILGKVEAAPLLRDILDDLADLGSSDRLQAR 549

Query: 533 IENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLF 592
           ++ +L+ MAC+GS+RSGR +++ EMN LLREME  P S QCNHGRPT+++LKL+DIE+LF
Sbjct: 550 MDAVLSRMACHGSVRSGRALRAEEMNALLREMEATPLSGQCNHGRPTYVELKLADIERLF 609

Query: 593 GR 594
           GR
Sbjct: 610 GR 611


>gi|126727787|ref|ZP_01743617.1| DNA mismatch repair protein [Rhodobacterales bacterium HTCC2150]
 gi|126702914|gb|EBA02017.1| DNA mismatch repair protein [Rhodobacterales bacterium HTCC2150]
          Length = 617

 Score =  536 bits (1380), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 256/605 (42%), Positives = 396/605 (65%), Gaps = 14/605 (2%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR+L E  +N+IAAGE++ERP+ A+KEL+EN++DA ++R++   A GGK+  ++ D+G 
Sbjct: 14  QIRQLDEAAVNRIAAGEVVERPASAVKELVENAIDAGATRIDVSYAAGGKNLIRVVDDGH 73

Query: 62  GMTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           G+T++E+P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  L+L+SR   +++  +
Sbjct: 74  GITADELPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLSLVSRAIGSDSAFE 133

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I+++G   S V+P A+  GTIV + DLF+  PARL F+++++ E   I+DVI+R+A+A P
Sbjct: 134 ISVNGSIQSPVKPAALTKGTIVTLADLFYATPARLKFMRTDRSEAQAISDVIKRLAMAEP 193

Query: 181 KVSFTFSTIK---SNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITL 233
            V FT   +      R  +   +  G+F +    R+ +++G DF  NA+ +  +    TL
Sbjct: 194 HVGFTLRDVSEGGQGRVVLRLDAEQGDFFDALHSRLKRLLGADFAANALRIEAEREGHTL 253

Query: 234 QGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPR 293
            GY  +PT++RG +   ++F+NGR V+D+ ++  +R AYA+ +   R+P VVL +  DP 
Sbjct: 254 TGYAALPTYSRGTSVAQFLFVNGRPVKDRLLIGALRGAYADFLSRDRHPAVVLNISCDPA 313

Query: 294 QVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKT 353
           +VDVNVHPAKS +RFR+P + R  I+  ++ A+   G   S+ ++   + +F Q+     
Sbjct: 314 RVDVNVHPAKSEVRFRDPGLARGLIVSGLKHALAGAGHRASTTVADATLGAFTQEPVQGR 373

Query: 354 HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEAT----HYQLGIA 409
                  S +       +Q   L ++      +P ++  +  VE +EA        LG A
Sbjct: 374 VYQMDRPSSSAIGRSFAMQS--LDSSFGFAEANPDFNATSARVEMAEAAPELLDRPLGAA 431

Query: 410 CAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGE 469
            AQ+H+NYI++QT DG+++VDQHAAHERL++EK++       + +Q LL PEII+L  G+
Sbjct: 432 RAQVHENYIVAQTRDGMILVDQHAAHERLVYEKLKNQMAENGVAAQALLIPEIIELSVGD 491

Query: 470 CALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTL 529
             LI+E   DL  LG++ E FG  AIAIR  PA+L + N   ++ D++DE+ D   + +L
Sbjct: 492 RDLILEMAGDLAALGLEMEPFGGTAIAIRATPAVLGEVNAAAMIHDVLDELSDQGESRSL 551

Query: 530 QDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIE 589
           ++RIE +L+ +AC+GSIRSGR+MQ+ EMN LLREME  P+S QCNHGRPT+++LKL+DIE
Sbjct: 552 RERIEAVLSRIACHGSIRSGRRMQADEMNALLREMEATPHSGQCNHGRPTYVELKLADIE 611

Query: 590 KLFGR 594
           +LFGR
Sbjct: 612 RLFGR 616


>gi|260429288|ref|ZP_05783265.1| DNA mismatch repair protein [Citreicella sp. SE45]
 gi|260419911|gb|EEX13164.1| DNA mismatch repair protein [Citreicella sp. SE45]
          Length = 627

 Score =  535 bits (1379), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 261/613 (42%), Positives = 399/613 (65%), Gaps = 23/613 (3%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+EN++DA + RV   IA GGK+  ++TD+G G
Sbjct: 16  IRQLDESAINRIAAGEVVERPASAVKELVENAIDAGARRVAIEIADGGKTLIRVTDDGCG 75

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M ++E+P+A+ RH TSKI   D  +IH+FGFRGEALPS+GAV  LT+ SR      GA+I
Sbjct: 76  MRADELPLALSRHATSKIDGSDLLDIHSFGFRGEALPSLGAVGRLTIQSRA-AGEEGAEI 134

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           +++G +    +P A+N GT+V +RDLF+  PARL FL++++ E   I++VI+R+A+A P 
Sbjct: 135 SVAGGQTGGAKPCALNGGTVVTLRDLFYATPARLKFLRTDRAEMQAISEVIKRLAMAEPS 194

Query: 182 VSFTFSTIKSNRYKMNFQS--TNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQG 235
           V FT   +   + ++ F++   +G+  +    R+ QV+G +F +NA+ ++ +     L G
Sbjct: 195 VGFTLRDVSDGKDRVTFRADPCSGDLFDALRGRMGQVMGAEFTDNALSIDAEREGFRLTG 254

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
              +PT++RG++   ++F+NGR VQD+ +   +R AYA+ +   R+P V L ++ DP +V
Sbjct: 255 LAALPTYSRGSSVAQHLFVNGRPVQDRLLHGALRGAYADFLSRERHPAVALFVDCDPHKV 314

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL 355
           DVNVHPAKS +RFR+P I+R  I+ +++ A+ + G   S+ ++   + +   +  P    
Sbjct: 315 DVNVHPAKSEVRFRDPGIVRGLIVSALRHALAEAGHRASTTVAGATLGAMRPEPQPAA-A 373

Query: 356 PKYATSLTNTQEKL---FLQENRLSTNDLLPSDDPT---------YSEDNDPVEESE--A 401
           P+       +Q  L   +  +         P+  PT         YS   D VEE E  A
Sbjct: 374 PRVYQMDRPSQGALSSAWRAQAPAPQPYTPPAPQPTSGFAEFSRDYSGRVDVVEEPEQPA 433

Query: 402 THYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPE 461
               LG A  Q+H+NYII+QT DG+VIVDQHAAHERL++EK+++      + +Q LL PE
Sbjct: 434 EALPLGAARGQVHENYIIAQTADGVVIVDQHAAHERLVYEKLKRQMAERGVPAQALLIPE 493

Query: 462 IIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEII 521
           I++    + + ++   ++L R+G+  E FG  A+A+RE PAIL + N   LL DI+DE+ 
Sbjct: 494 IVEFSADDLSRLLSVADELSRMGLTVEPFGGGAVAVRETPAILGEVNAKALLNDILDELA 553

Query: 522 DSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFI 581
           D  ++  +Q++IE IL+ +AC+GSIRSGR+M++ EMN LLREME  P+S QCNHGRPT++
Sbjct: 554 DYGSSQLVQEKIEAILSRVACHGSIRSGRRMRAEEMNALLREMEATPHSGQCNHGRPTYV 613

Query: 582 KLKLSDIEKLFGR 594
           +LKLSDIE+LFGR
Sbjct: 614 ELKLSDIERLFGR 626


>gi|126736240|ref|ZP_01751983.1| DNA mismatch repair protein [Roseobacter sp. CCS2]
 gi|126714406|gb|EBA11274.1| DNA mismatch repair protein [Roseobacter sp. CCS2]
          Length = 603

 Score =  535 bits (1377), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 257/599 (42%), Positives = 384/599 (64%), Gaps = 17/599 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+ENS+DA ++R+E VIA GGK+  ++TD+G G
Sbjct: 14  IRQLDDAAINRIAAGEVLERPASAVKELVENSIDAGATRIEVVIADGGKTLIRVTDDGCG 73

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT  ++PMA+ RH TSKI   D  NI +FGFRGEALPS+GA   L + SR  +N   A I
Sbjct: 74  MTPSDLPMAMLRHATSKIDGSDLLNIQSFGFRGEALPSLGATGRLKITSRA-KNAEAAMI 132

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           A++G +   V+P A++ GT++E+RD+F+  PARL FL++++ E   +TDV++R+A+A P 
Sbjct: 133 AVAGGQAEGVKPAALSAGTVIELRDMFYATPARLKFLRTDRAEAQAVTDVVKRLAMAEPF 192

Query: 182 VSFTF--STIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQG 235
           V+F    ++   NR      +  G+  +    R+  V+G+DF  NA+ ++ +     L G
Sbjct: 193 VTFILRDASKGDNRTVFRADAETGDLFDALHGRLRAVLGKDFAENALRIDTEREGFHLTG 252

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y  +PT++RG A   ++F+NGR V+DK +L  +R AY + +   R+PV  L ++ DP  V
Sbjct: 253 YAALPTYSRGAAVAQFLFVNGRPVRDKMLLGALRAAYMDVLSRDRHPVAALFVDCDPTLV 312

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL 355
           DVNVHPAKS +RFR+P  +R  I+  ++ A+   G   S+ ++   + +           
Sbjct: 313 DVNVHPAKSEVRFRDPGTVRGLIVSGLRHALADAGHRASTTVANATLGAI---------T 363

Query: 356 PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQ 415
           P+         ++       ++     P      S   +P+ E +     LG A AQ+H+
Sbjct: 364 PERTEPRVYQMDRPSFSARSMTFQAQAPGFGEMPSARFEPMVEDDPDDLPLGAARAQVHE 423

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           NYII+QT +G+VIVDQHAAHERL++EK++       + +Q LL PEI++L E E A + +
Sbjct: 424 NYIIAQTENGIVIVDQHAAHERLVYEKLKAQMAENGVAAQALLIPEIVELSENEAAQLRD 483

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
             +DL + G+  E FG  AIA+RE PAIL + N   ++RDI+DE+ D   + ++Q RIE 
Sbjct: 484 IADDLAKFGLTIEPFGGGAIAVRETPAILGEVNAEAMIRDILDELADQGDSASVQARIEA 543

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           IL+ +AC+GSIRSGR+MQ+ EMN LLREME  P S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 544 ILSRVACHGSIRSGRRMQAAEMNALLREMEATPLSGQCNHGRPTYVELKLADIERLFGR 602


>gi|149915456|ref|ZP_01903983.1| DNA mismatch repair protein [Roseobacter sp. AzwK-3b]
 gi|149810745|gb|EDM70586.1| DNA mismatch repair protein [Roseobacter sp. AzwK-3b]
          Length = 611

 Score =  534 bits (1375), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 256/607 (42%), Positives = 388/607 (63%), Gaps = 19/607 (3%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN+LDA + R++   A GGK+  ++TD+G G
Sbjct: 8   IRQLDDAAINRIAAGEVVERPASAVKELVENALDAGARRIDVAYADGGKTLIRVTDDGCG 67

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           +  + + +A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR  + +  A+I
Sbjct: 68  IAPDSLALALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLTITSRA-RGHEAAEI 126

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           A+SG ++  V+P A+N GTIV +RDLF   PARL F++S++ E   I D++RR+A+A P 
Sbjct: 127 AVSGGQMGKVKPAALNGGTIVTLRDLFHATPARLKFMRSDRAEAQAIGDIVRRLAMAEPF 186

Query: 182 VSFTFSTIKSN-RYKMNFQS---TNGNFPE---RISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT   +      +M F++   T   F     R+ +++G DF +NA+ ++   + + + 
Sbjct: 187 VGFTLRDVSGGGEGRMVFRADAETGDMFDALHGRLGRILGSDFADNALRIDATRDGLRMT 246

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG+A   Y+F+NGR V+D+ ++  +R AY + +   R+P   L +E DP  
Sbjct: 247 GYAALPTYSRGSAVAQYLFVNGRPVRDRMMIGALRAAYMDVLSRDRHPAAALFVECDPML 306

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR+P + R  I+  ++ A+ + G   SS ++   + +   + A    
Sbjct: 307 VDVNVHPAKSEVRFRDPGLARGLIVSGLRHALAEAGHRASSTVAGATLGAMRPEPAGPAR 366

Query: 355 L-------PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLG 407
           +        +   +    Q   F +     +  + P  DP    D    ++       LG
Sbjct: 367 VYQMDRPSAQARVAAYQAQAPGFAEMAGAFSARVEPLSDPA---DETATDDVPPEALPLG 423

Query: 408 IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLE 467
            A AQ+H+NYI++QTTDG+VIVD HAAHER+++EK+++    T + SQ LL PEI+++  
Sbjct: 424 AARAQLHENYILAQTTDGIVIVDAHAAHERIVYEKLKRQMAETGVASQALLIPEIVEMSA 483

Query: 468 GECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTY 527
            + A ++E  EDL RLG+  E FG  A+A+RE PAIL   +   +L DI+DE+ D   + 
Sbjct: 484 EDAASLLELAEDLARLGLVIEPFGGGAVAVRETPAILGACDARAMLLDILDELADQGDSG 543

Query: 528 TLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSD 587
           ++Q RIE IL+ +AC+GS+RSGR++++ EMN LLREME  P+S QCNHGRPT++ LKL+D
Sbjct: 544 SVQARIEAILSRVACHGSVRSGRRLRAEEMNALLREMEATPHSGQCNHGRPTYVDLKLAD 603

Query: 588 IEKLFGR 594
           IE+LFGR
Sbjct: 604 IERLFGR 610


>gi|163743610|ref|ZP_02150986.1| DNA mismatch repair protein [Phaeobacter gallaeciensis 2.10]
 gi|161383081|gb|EDQ07474.1| DNA mismatch repair protein [Phaeobacter gallaeciensis 2.10]
          Length = 650

 Score =  534 bits (1375), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 270/638 (42%), Positives = 398/638 (62%), Gaps = 50/638 (7%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA ++R+   IA GGK+  ++TD+G G
Sbjct: 16  IRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGATRITIEIADGGKTLIRVTDDGCG 75

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M+  ++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  L++ SR  ++   AQI
Sbjct: 76  MSPADLPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLSITSRA-KDQEAAQI 134

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            ++G +   V+P A+  GT+VE+RDLF+  PARL F++S++ ET  I DVI+R+A+A P 
Sbjct: 135 RVAGGRTEPVKPAALRVGTVVELRDLFYATPARLKFMRSDRAETQAIGDVIKRLAMAEPS 194

Query: 182 VSFTFSTIKSN---RYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT   +      R         G+  +    R++ V+G +F  NA++++   + + L 
Sbjct: 195 VGFTLRDVSGGGEGRVTFRADPLTGDLFDALHGRLATVLGREFAENALKIDATRDGVRLF 254

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   ++F+N R V+DK +   +R AY + +   R+P   L L+ DP  
Sbjct: 255 GYAALPTYSRGAAVAQFLFVNTRPVKDKMLTGALRAAYFDFLSRDRHPAAALFLDCDPTL 314

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLS---------KKMISSF 345
           VDVNVHPAKS +RFR+P + R  I+ +++  + + G   SS ++         + M S  
Sbjct: 315 VDVNVHPAKSEVRFRDPGVARGLIVSALRHGLAEAGHRASSTVAGATLGAMRPEPMASQP 374

Query: 346 HQDNAPKTH---LPKY-ATSLTNTQEKLFLQENRLSTNDLLP------------------ 383
             D AP+ +    P   A SL+   +     ++ ++  D+ P                  
Sbjct: 375 GADGAPRIYQMDRPSLGARSLSYAAQA--PGQSCIAGGDMPPPSGFAELAQVYSGRVTEA 432

Query: 384 --SDDPTYSEDNDPVEESE-----ATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHE 436
             S +P  +    P+E SE     A    LG A  Q+H+NYII+QT DG+VIVDQHAAHE
Sbjct: 433 PESQNPAMAP-GQPLERSETSAPGAEQLPLGAARGQVHENYIIAQTADGMVIVDQHAAHE 491

Query: 437 RLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIA 496
           RL++EK+++    T + +Q LL PEI++L EG+CA I+   +DL+R G+  E FG  AIA
Sbjct: 492 RLVYEKLKRQMAETGVAAQALLIPEIVELSEGDCARILAVADDLNRFGLGIEAFGGGAIA 551

Query: 497 IREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIE 556
           +RE PAIL   N   ++RDI+DE+ D   +  +Q +IE IL+ +AC+GSIRSGR M+  E
Sbjct: 552 VRETPAILGTVNAEAMVRDILDELDDQGESQLVQAKIEAILSRVACHGSIRSGRWMRGEE 611

Query: 557 MNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           MN LLREME  P+S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 612 MNALLREMEATPHSGQCNHGRPTYVELKLADIERLFGR 649


>gi|163739395|ref|ZP_02146806.1| DNA mismatch repair protein MutL [Phaeobacter gallaeciensis BS107]
 gi|161387465|gb|EDQ11823.1| DNA mismatch repair protein MutL [Phaeobacter gallaeciensis BS107]
          Length = 650

 Score =  534 bits (1375), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 270/638 (42%), Positives = 398/638 (62%), Gaps = 50/638 (7%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA ++R+   IA GGK+  ++TD+G G
Sbjct: 16  IRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGATRITIEIADGGKTLIRVTDDGCG 75

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M+  ++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  L++ SR  ++   AQI
Sbjct: 76  MSPADLPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLSITSRA-KDQEAAQI 134

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            ++G +   V+P A+  GT+VE+RDLF+  PARL F++S++ ET  I DVI+R+A+A P 
Sbjct: 135 RVAGGRTEPVKPAALRVGTVVELRDLFYATPARLKFMRSDRAETQAIGDVIKRLAMAEPS 194

Query: 182 VSFTFSTIKSN---RYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT   +      R         G+  +    R++ V+G +F  NA++++   + + L 
Sbjct: 195 VGFTLRDVSGGGEGRVTFRADPLTGDLFDALHGRLATVLGREFAENALKIDATRDGVRLF 254

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   ++F+N R V+DK +   +R AY + +   R+P   L L+ DP  
Sbjct: 255 GYAALPTYSRGAAVAQFLFVNTRPVKDKMLTGALRAAYFDFLSRDRHPAAALFLDCDPTL 314

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLS---------KKMISSF 345
           VDVNVHPAKS +RFR+P + R  I+ +++  + + G   SS ++         + M S  
Sbjct: 315 VDVNVHPAKSEVRFRDPGVARGLIVSALRHGLAEAGHRASSTVAGATLGAMRPEPMASQP 374

Query: 346 HQDNAPKTH---LPKY-ATSLTNTQEKLFLQENRLSTNDLLP------------------ 383
             D AP+ +    P   A SL+   +     ++ ++ +D+ P                  
Sbjct: 375 GADGAPRIYQMDRPSLGARSLSYAAQA--PGQSGIAGSDMPPPSGFAELAQSYSGRVTET 432

Query: 384 --SDDPTYSEDNDPVEESE-----ATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHE 436
             S +P  +    P E SE     A    LG A  Q+H+NYII+QT DG+VIVDQHAAHE
Sbjct: 433 PESQNPAMAP-GQPFERSETSAPGAEQLPLGAARGQVHENYIIAQTADGMVIVDQHAAHE 491

Query: 437 RLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIA 496
           RL++EK+++    T + +Q LL PEI++L EG+CA I+   +DL+R G+  E FG  AIA
Sbjct: 492 RLVYEKLKRQMAETGVAAQALLIPEIVELSEGDCARILAVADDLNRFGLGIEAFGGGAIA 551

Query: 497 IREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIE 556
           +RE PAIL   N   ++RDI+DE+ D   +  +Q +IE IL+ +AC+GSIRSGR M+  E
Sbjct: 552 VRETPAILGTVNAEAMVRDILDELDDQGESQLVQAKIEAILSRVACHGSIRSGRWMRGEE 611

Query: 557 MNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           MN LLREME  P+S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 612 MNALLREMEATPHSGQCNHGRPTYVELKLADIERLFGR 649


>gi|114769575|ref|ZP_01447185.1| DNA mismatch repair protein [alpha proteobacterium HTCC2255]
 gi|114549280|gb|EAU52162.1| DNA mismatch repair protein [alpha proteobacterium HTCC2255]
 gi|297183941|gb|ADI20062.1| hypothetical protein [uncultured alpha proteobacterium
           EB080_L11F12]
          Length = 611

 Score =  534 bits (1375), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 273/612 (44%), Positives = 401/612 (65%), Gaps = 36/612 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+LS+   N+IAAGE++ERPS AIKEL+ENS+DA +SR++   + GGK+  ++ DNG G
Sbjct: 15  IRQLSDAAANRIAAGEVVERPSSAIKELVENSIDAGASRIDISYSDGGKTLIRVKDNGHG 74

Query: 63  MTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           +   ++ +A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR    + GA I
Sbjct: 75  IAENQLMLALSRHATSKIDGTDLLNIHTFGFRGEALPSMGAVGRLTITSRIENVSMGATI 134

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            + G  I  VRP   + GTIVE+R+LF   PARL FL++++ E+  I+DVI+R+A++ P 
Sbjct: 135 TVDGGVIHQVRPAPSSIGTIVELRNLFHATPARLKFLRTDRAESGAISDVIKRLAMSEPF 194

Query: 182 VSFTFSTIKSN-RYKMNFQSTNGNFPE----------RISQVIGEDFINNAVELNEKSNE 230
           + FT   I S  + ++ F++     PE          R+S+++G DF  N+  ++ + + 
Sbjct: 195 IGFTLRDITSGGKGRIIFRAD----PEAGDLFDAMYGRLSKILGIDFAKNSFRVDAERDG 250

Query: 231 ITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEI 290
           +TL GY  +PT++RG++   Y+F+NGR V+DK +LS +R AY++ +  GRYP+  L +E 
Sbjct: 251 MTLTGYASLPTYSRGSSVSQYIFVNGRPVKDKSLLSALRAAYSDFLHNGRYPLAALFVEC 310

Query: 291 DPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA 350
           D  +VDVNVHPAK+ +RFR P I+R  +I +++ A+ ++G   SS ++   + +F     
Sbjct: 311 DFERVDVNVHPAKAEVRFREPGIVRGLVISALRHALAEEGHRASSTVADATLGAF----- 365

Query: 351 PKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEAT-------- 402
            K+ +   +T+L   Q         +  N+L   D   +SE  +     +A+        
Sbjct: 366 KKSEISNISTNLRMNQS----WSREMQNNNL---DQVGFSELQNNFSARQASIETNNDQI 418

Query: 403 HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEI 462
             +LG A AQ+H+NYIISQT DG+VIVDQHAAHERL++EK++       ++SQTLL PEI
Sbjct: 419 SNRLGAARAQVHENYIISQTADGIVIVDQHAAHERLVYEKLKNKMALNGVSSQTLLIPEI 478

Query: 463 IDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIID 522
           I+L E + A++M+   DL R G+  E FG N+I +RE PAIL + N   L+ DI+DE+ D
Sbjct: 479 IELSEQDSAVLMDLSADLSRFGLSIENFGGNSIVVRETPAILGEVNAKSLILDILDELKD 538

Query: 523 SSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIK 582
            S +  ++++++ IL+ +AC+GSIRSGR M+  EMN LLREME  P+S QCNHGRPT++K
Sbjct: 539 WSESNLIKEKLDAILSRVACHGSIRSGRIMKGEEMNALLREMEITPHSGQCNHGRPTYVK 598

Query: 583 LKLSDIEKLFGR 594
           LKLSDIEKLFGR
Sbjct: 599 LKLSDIEKLFGR 610


>gi|126729914|ref|ZP_01745726.1| DNA mismatch repair protein [Sagittula stellata E-37]
 gi|126709294|gb|EBA08348.1| DNA mismatch repair protein [Sagittula stellata E-37]
          Length = 629

 Score =  534 bits (1375), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 265/622 (42%), Positives = 399/622 (64%), Gaps = 35/622 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  +N+IAAGE++ERP+ A+KEL+EN++DA + RV   IA GGK+  ++TD+G G
Sbjct: 12  IRQLDDAAVNRIAAGEVVERPASAVKELVENAIDAGARRVGIEIADGGKTLIRVTDDGCG 71

Query: 63  MTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT  E+P+A+ RH TSKI   D  +IH+FGFRGEALPS+GAV  L+L SR  +  +G ++
Sbjct: 72  MTGAELPLALSRHATSKIDGTDLLDIHSFGFRGEALPSLGAVGRLSLQSRV-RGESGVEL 130

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           ++ G  +S+V+P A+N GT+V +RDLF+  PARL FL++++ ET  I+D ++R+A+A P 
Sbjct: 131 SVEGGVMSAVKPCALNGGTVVTLRDLFYATPARLKFLRTDRAETQAISDTVKRLAMAEPA 190

Query: 182 VSFTFSTIKSNRYKMNF--QSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQG 235
           V FT   +     ++ F  +   G+  +    R+++++G +F +NA+ +  +     L G
Sbjct: 191 VGFTLRDVSGGGDRVTFRVEPETGDLFDALRGRLTRIMGAEFTDNALAVEAEREGFRLTG 250

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y  +PT++RG A   Y+F+NGR V+DK ++  +R AY + +   R+P V L ++ DP +V
Sbjct: 251 YAALPTYSRGTAVAQYLFVNGRPVRDKMLIGALRGAYHDFLSRERHPAVALFVDCDPHKV 310

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF-------HQD 348
           DVNVHPAKS +RFR+P ++R  I+ +++ A+ + G   SS ++   + +        +  
Sbjct: 311 DVNVHPAKSEVRFRDPGVVRGLIVSTLRHALAEAGHRASSTVAAATLGAMRPEAGPAYAP 370

Query: 349 NAPKTHLPKYAT----------SLTNTQEKLFLQENRLSTNDLLPSDDPTYSE---DNDP 395
           NAP    P+  +          SL         Q       DL  S    YS    +  P
Sbjct: 371 NAPLGAGPEPVSGPRVYQMDRPSLGARAAAYRAQAPAPGFADLGES----YSGRVVETAP 426

Query: 396 VEESEA---THYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
           V E+ A   T   LG A  Q+H+NYII+QT DG+VIVDQHAAHERL++EK+++      +
Sbjct: 427 VAEAPAEDVTRRPLGAARGQVHENYIIAQTEDGVVIVDQHAAHERLVYEKLKRQMAENGV 486

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
            +Q LL P+++DL   + A ++   +DL R+G+  E FG  AIA+RE PAIL + +   L
Sbjct: 487 PAQALLIPDVVDLSADDAARLLAVADDLSRMGLTVEPFGAGAIAVRETPAILGEVDSQGL 546

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           +RDI+DE+ D   T  +Q++IE IL+ +AC+GSIRSGR M++ EMN LLREME  P+S Q
Sbjct: 547 IRDILDELDDMGETSLVQEKIEAILSRVACHGSIRSGRVMRAEEMNALLREMEATPHSGQ 606

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT+++LKLSDIE+LFGR
Sbjct: 607 CNHGRPTYVELKLSDIERLFGR 628


>gi|126738320|ref|ZP_01754041.1| DNA mismatch repair protein [Roseobacter sp. SK209-2-6]
 gi|126720817|gb|EBA17522.1| DNA mismatch repair protein [Roseobacter sp. SK209-2-6]
          Length = 653

 Score =  533 bits (1374), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 258/627 (41%), Positives = 393/627 (62%), Gaps = 35/627 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA + R+   IA GGK+  ++TD+G 
Sbjct: 27  QIRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGAHRITVEIADGGKTLIRVTDDGC 86

Query: 62  GMTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           GM++E++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR   ++  AQ
Sbjct: 87  GMSAEDLPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLTITSRAAGHDA-AQ 145

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I +SG ++  V+P A+  GT+VE+RDLF+  PARL F+++++ E   I DVI+R+A+A P
Sbjct: 146 IKVSGGRMDPVKPAALRAGTVVELRDLFYATPARLKFMRTDRAEAQAIGDVIKRLAMAEP 205

Query: 181 KVSFTFSTIKSN---RYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITL 233
            V FT   +      R        +G+  +    R++ V+G +F  NA++++ +   + L
Sbjct: 206 SVGFTLRDVSGGGEGRVTFRADPLSGDLFDALHGRLASVLGREFAENALKIDAEREGVRL 265

Query: 234 QGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPR 293
            GY  +PT++RG A   ++F+N R V+DK +   +R AY + +   R+P   L ++ DP 
Sbjct: 266 FGYAALPTYSRGAAVAQFLFVNSRPVKDKMLTGALRAAYFDFLSRDRHPAAALFIDCDPT 325

Query: 294 QVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD----- 348
            VDVNVHPAKS +RFR+P + R  I+ +++ A+ + G   S+ ++   + +   +     
Sbjct: 326 LVDVNVHPAKSEVRFRDPGVARGLIVSALRHALAEAGHRASTTVAGATLGAMRPEAPTAS 385

Query: 349 NAPKTH---LPKY----------------ATSLTNTQEKLFLQENRLSTNDLLP--SDDP 387
            AP+ +    P +                A S      + F +     +  +L   ++ P
Sbjct: 386 GAPRVYQMDRPSFGARNASYAAQSPGQPLAQSADAPPSQGFAELATAYSGRVLEETAEAP 445

Query: 388 TYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDF 447
               D        A    LG A  Q+H+NYII+QT DG+VIVDQHAAHERL++E+++   
Sbjct: 446 GQMPDAPTTSSPGAEELPLGAARGQVHENYIIAQTRDGMVIVDQHAAHERLVYERLKAQM 505

Query: 448 NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKK 507
               + +Q LL PEI++L E +CA ++ H EDL + G+  E FG NA+A+RE PA+L + 
Sbjct: 506 AENGVAAQALLIPEIVELGESDCARLLSHAEDLKKFGLTLEAFGGNAVAVRETPALLGEV 565

Query: 508 NIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKN 567
           N   ++RDI+DE+ D   +  +Q R+E IL+ +AC+GSIRSGR+M+  EMN LLREME  
Sbjct: 566 NAGAMVRDILDELDDLGESQLVQARLEAILSRVACHGSIRSGRRMRGEEMNALLREMEAT 625

Query: 568 PNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           P+S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 626 PHSGQCNHGRPTYVELKLADIERLFGR 652


>gi|332559571|ref|ZP_08413893.1| DNA mismatch repair protein [Rhodobacter sphaeroides WS8N]
 gi|332277283|gb|EGJ22598.1| DNA mismatch repair protein [Rhodobacter sphaeroides WS8N]
          Length = 616

 Score =  533 bits (1373), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 262/604 (43%), Positives = 390/604 (64%), Gaps = 15/604 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+EN+LDA + R+   IA GGK+  ++TD+G G
Sbjct: 15  IRQLDEAAINRIAAGEVVERPASAVKELVENALDAGARRIAVDIACGGKTLIRVTDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT++++P+A+ RH TSKI   D  +I +FGFRGEALPS+ AV  LT+ SR  +   GAQI
Sbjct: 75  MTADDLPLALSRHATSKIDGSDLLDIRSFGFRGEALPSLAAVGRLTITSRVAEGE-GAQI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           A+S  +I  VRP A+  GT+VE+RDLFF  PARL FL++++ ET  I +V+RR+A+A P+
Sbjct: 134 AVSAGRIEPVRPAALGAGTVVELRDLFFATPARLKFLRTDRAETQAIAEVVRRLALAEPE 193

Query: 182 VSFTFSTIKSNRYKMNF--QSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQG 235
           V FT +   +   ++ F  ++  G+  +    R+++V+G +F  NA+ ++     + LQG
Sbjct: 194 VGFTLTDHSAGEPRLLFRAEAEGGDLFDALHRRVARVVGAEFAENALRIDVAREGLRLQG 253

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y  +PT++RG+    ++F+NGR V D+ +L  +R  Y + +   RYP  VL L  DP++V
Sbjct: 254 YAALPTYSRGSGVAQFLFVNGRPVLDRMLLGALRAGYMDVLSRDRYPAAVLNLICDPQRV 313

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL 355
           DVNVHPAK+ +RFR    +R  I+ ++++A+   G   S+ ++ + + +F  +  P    
Sbjct: 314 DVNVHPAKAEVRFREAGEVRGLIVTALRQALAGAGHRASTTVAGETLEAFRPER-PAAAG 372

Query: 356 PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSED-----NDPVEESEATHYQLGIAC 410
           P  A+ +            R           P  +E        PV E EA    LG A 
Sbjct: 373 PGPASRIYQMDRPSAAAVARSFAFQAPEPAMPGLAEAPAARVEAPVAE-EAHDRPLGAAR 431

Query: 411 AQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGEC 470
           AQIH N+I++QT  GLVIVDQHAAHERL++EK+++  + T I  Q LL PEI++L   + 
Sbjct: 432 AQIHGNWILAQTESGLVIVDQHAAHERLVYEKLKRQRDETGIARQALLIPEIVELSPTDA 491

Query: 471 ALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQ 530
           A ++E  ++L   G+  E FG  A+A+RE+PAIL K     LLRDI+D++ D  ++  LQ
Sbjct: 492 ARLLEAADELASAGLVIEPFGGGAVAVREVPAILGKVEAAPLLRDILDDLADLGSSDRLQ 551

Query: 531 DRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEK 590
            R++ +L+ MAC+GS+RSGR +++ EMN LLREME  P S QCNHGRPT+++LKL+DIE+
Sbjct: 552 ARMDAVLSRMACHGSVRSGRALRAEEMNALLREMEATPLSGQCNHGRPTYVELKLADIER 611

Query: 591 LFGR 594
           LFGR
Sbjct: 612 LFGR 615


>gi|221640592|ref|YP_002526854.1| DNA mismatch repair protein [Rhodobacter sphaeroides KD131]
 gi|221161373|gb|ACM02353.1| DNA mismatch repair protein MutL [Rhodobacter sphaeroides KD131]
          Length = 616

 Score =  533 bits (1373), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 261/607 (42%), Positives = 391/607 (64%), Gaps = 21/607 (3%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+EN+LDA + R+   IA GGK+  ++TD+G G
Sbjct: 15  IRQLDEAAINRIAAGEVVERPASAVKELVENALDAGARRIAVDIACGGKTLIRVTDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT++++P+A+ RH TSKI   D  +I +FGFRGEALPS+ AV  LT+ SR  +   GAQI
Sbjct: 75  MTADDLPLALSRHATSKIDGSDLLDIRSFGFRGEALPSLAAVGRLTITSRVAEGE-GAQI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           A+S  +I  VRP A+  GT+VE+RDLFF  PARL FL++++ ET  I +V+RR+A+A P+
Sbjct: 134 AVSAGRIEPVRPAALGAGTVVELRDLFFATPARLKFLRTDRAETQAIAEVVRRLALAEPE 193

Query: 182 VSFTFSTIKSNRYKMNF--QSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQG 235
           V FT +   +   ++ F  ++  G+  +    R+++V+G +F  NA+ ++     + LQG
Sbjct: 194 VGFTLTDHSAGEPRLLFRAEAEGGDLFDALHRRVARVVGAEFAENALRIDVAREGLRLQG 253

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y  +PT++RG+    ++F+NGR V D+ +L  +R  Y + +   RYP  VL L  DP++V
Sbjct: 254 YAALPTYSRGSGVAQFLFVNGRPVLDRMLLGALRAGYMDVLSRDRYPAAVLNLICDPQRV 313

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL 355
           DVNVHPAK+ +RFR    +R  I+ ++++A+   G   S+ ++ + + +F  +  P    
Sbjct: 314 DVNVHPAKAEVRFREAGEVRGLIVTALRQALAGAGHRASTTVAGETLEAFRPER-PAAAG 372

Query: 356 PKYAT--------SLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLG 407
           P  A+        S          Q    +   L  ++ P    +    E  EA    LG
Sbjct: 373 PGSASRIYQMDRPSAAAVARSFAFQAPEPAMPGL--AEAPAARVEAPAAE--EAHDRPLG 428

Query: 408 IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLE 467
            A AQIH N+I++QT  GLVIVDQHAAHERL++EK+++  + T I  Q LL PEI++L  
Sbjct: 429 AARAQIHGNWILAQTESGLVIVDQHAAHERLVYEKLKRQRDETGIARQALLIPEIVELSP 488

Query: 468 GECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTY 527
            + A ++E  ++L   G+  E FG  A+A+RE+PAIL K     LLRDI+D++ D  ++ 
Sbjct: 489 TDAARLLEAADELASAGLVIEPFGGGAVAVREVPAILGKVEAAPLLRDILDDLADLGSSD 548

Query: 528 TLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSD 587
            LQ R++ +L+ MAC+GS+RSGR +++ EMN LLREME  P S QCNHGRPT+++LKL+D
Sbjct: 549 RLQARMDAVLSRMACHGSVRSGRALRAEEMNALLREMEATPLSGQCNHGRPTYVELKLAD 608

Query: 588 IEKLFGR 594
           IE+LFGR
Sbjct: 609 IERLFGR 615


>gi|297184247|gb|ADI20365.1| DNA mismatch repair enzyme (predicted ATPase) [uncultured alpha
           proteobacterium EB080_L27A02]
          Length = 611

 Score =  533 bits (1373), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 273/612 (44%), Positives = 401/612 (65%), Gaps = 36/612 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+LS+   N+IAAGE++ERPS AIKEL+ENS+DA +SR++   + GGK+  ++ DNG G
Sbjct: 15  IRQLSDAAANRIAAGEVVERPSSAIKELVENSIDAGASRIDISYSDGGKTLIRVKDNGHG 74

Query: 63  MTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           +   ++ +A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR    + GA I
Sbjct: 75  IAENQLMLALSRHATSKIDGTDLLNIHTFGFRGEALPSMGAVGRLTITSRIENVSMGATI 134

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            + G  I  VRP   + GTIVE+R+LF   PARL FL++++ E+  I+DVI+R+A++ P 
Sbjct: 135 TVDGGVIHQVRPAPSSIGTIVELRNLFHATPARLKFLRTDRAESGAISDVIKRLAMSEPF 194

Query: 182 VSFTFSTIKSN-RYKMNFQSTNGNFPE----------RISQVIGEDFINNAVELNEKSNE 230
           + FT   I S  + ++ F++     PE          R+S+++G DF  N+  ++ + + 
Sbjct: 195 IGFTLRDITSGGKGRIIFRAD----PEAGDLFDAMYGRLSKILGIDFAKNSFRVDAERDG 250

Query: 231 ITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEI 290
           ITL GY  +PT++RG++   Y+F+NGR V+DK +LS +R AY++ +  GRYP+  L +E 
Sbjct: 251 ITLTGYASLPTYSRGSSVSQYIFVNGRPVKDKSLLSALRAAYSDFLHNGRYPLAALFVEC 310

Query: 291 DPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA 350
           D  +VDVNVHPAK+ +RFR P I+R  +I +++ A+ ++G   SS ++   + +F     
Sbjct: 311 DFERVDVNVHPAKAEVRFREPGIVRGLVISALRHALAEEGHRASSTVADATLGAF----- 365

Query: 351 PKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEAT-------- 402
            K+ +   +T+L   Q         +  N+L   D   +SE  +     +A+        
Sbjct: 366 KKSEISNISTNLRMNQS----WSREMQNNNL---DQVGFSELQNNFSARQASIETNNDQI 418

Query: 403 HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEI 462
             +LG A AQ+H+NYIISQT DG+VIVDQHAAHERL++EK++       ++SQTLL PEI
Sbjct: 419 SNRLGAARAQVHENYIISQTADGIVIVDQHAAHERLVYEKLKNKMALNGVSSQTLLIPEI 478

Query: 463 IDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIID 522
           I+L E + A++M+   DL R G+  E FG N+I +RE PAIL + N   L+ DI+DE+ D
Sbjct: 479 IELSEQDSAVLMDLSADLSRFGLSIENFGGNSIVVRETPAILGEVNAKSLILDILDELKD 538

Query: 523 SSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIK 582
            S +  ++++++ IL+ +AC+GSIRSGR M+  EMN LLREME  P+S QCNHGRPT++K
Sbjct: 539 WSESNLIKEKLDAILSRVACHGSIRSGRIMKGEEMNALLREMEITPHSGQCNHGRPTYVK 598

Query: 583 LKLSDIEKLFGR 594
           LKL+DIEKLFGR
Sbjct: 599 LKLNDIEKLFGR 610


>gi|328545053|ref|YP_004305162.1| DNA mismatch repair protein mutL [polymorphum gilvum SL003B-26A1]
 gi|326414796|gb|ADZ71859.1| DNA mismatch repair protein mutL [Polymorphum gilvum SL003B-26A1]
          Length = 606

 Score =  533 bits (1372), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 263/610 (43%), Positives = 393/610 (64%), Gaps = 26/610 (4%)

Query: 6   LSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTS 65
           + E +IN+IAAGE+IERP+  +KEL+EN++DA +  VE V A GGK+  +++D+G GMT+
Sbjct: 1   MGEAVINRIAAGEVIERPASVVKELVENAVDAGAGMVEIVTAAGGKTLLRVSDDGSGMTA 60

Query: 66  EEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAIS 124
            ++ +AV+RHCTSKI+D D  +I T GFRGEALPSIGAV  L++++R        +IA+ 
Sbjct: 61  ADLALAVRRHCTSKIADEDLFDIRTLGFRGEALPSIGAVGRLSIVTRHVDEPHAWRIAVE 120

Query: 125 GEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVSF 184
           G + + + P A + GT VEVRDLFF  PARL FLKS++ E   IT+V+RR+A+AYP + F
Sbjct: 121 GGRETPLGPAARHRGTQVEVRDLFFATPARLKFLKSDRAEAAAITEVVRRIALAYPHIGF 180

Query: 185 TFSTIKSNRYKMNFQSTNGNFPE--RISQVIGEDFINNAVELNEKSNEITLQGYTGIPTF 242
           + S   ++R   ++       P   RI+Q++G DF++NA+EL+ +   + L G+ G+PTF
Sbjct: 181 SLSG--ADRQAQSWPPARDADPRLARIAQILGRDFVDNALELDAEREGVRLTGFAGLPTF 238

Query: 243 NRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPA 302
           +RG A Q + ++NGR V+DK +LS +R AYA+ +   R+PV VL LE+DP  VDVNVHPA
Sbjct: 239 HRGTAQQQFFYVNGRPVKDKLLLSALRGAYADVLARDRHPVAVLFLELDPAHVDVNVHPA 298

Query: 303 KSYIRFRNPTIIRNFIIQSIQKAINKKG---------ISTSSVLSKKMISSFHQDNAPKT 353
           K+ +RFR+  ++R  ++ +I++A+   G          +  ++ +           AP  
Sbjct: 299 KADVRFRDGQLVRGLLVGAIRQALVTAGHRASTANAAAAMDAIRAGGFGGCAAAAEAPYR 358

Query: 354 HLPKYATSLTNTQEKL--------FLQENRLSTNDLLP-SDDPTYSEDNDPVEESEATHY 404
                A      +           F +  +    D+LP S D        PV+E EA   
Sbjct: 359 SPASGAAGWDWRRSAFRPGPAPAGFSEPMQAGLGDVLPLSADARAG--AVPVDE-EALRR 415

Query: 405 QLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIID 464
            LG A AQ+H  YII+QT DGLVIVDQHAAHERL++E++++   +  +  Q LL PEI++
Sbjct: 416 PLGAARAQVHGTYIIAQTEDGLVIVDQHAAHERLVYERLKEALAARAVARQMLLIPEIVE 475

Query: 465 LLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSS 524
           L E +   + E   +L  +G+  E FGP A+A+RE PA+L + +I  L+RD+ DE+ +  
Sbjct: 476 LPEEDVGRLAERAAELESVGLVLEPFGPGAVAVRETPALLGEIDIRGLVRDLADELAEWD 535

Query: 525 TTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLK 584
           T   L++R++++ ATMAC+GS+R+GR++++ EM+ LLR+ME  P S QCNHGRPT+I+LK
Sbjct: 536 TATGLKERLDHVAATMACHGSVRAGRRLRAEEMDALLRDMEATPLSGQCNHGRPTWIELK 595

Query: 585 LSDIEKLFGR 594
           L DIE+LFGR
Sbjct: 596 LGDIERLFGR 605


>gi|77464678|ref|YP_354182.1| DNA mismatch repair protein [Rhodobacter sphaeroides 2.4.1]
 gi|77389096|gb|ABA80281.1| DNA mismatch repair protein MutL [Rhodobacter sphaeroides 2.4.1]
          Length = 632

 Score =  532 bits (1371), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 261/607 (42%), Positives = 392/607 (64%), Gaps = 21/607 (3%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+EN+LDA + R+   IA GGK+  ++TD+G G
Sbjct: 31  IRQLDEAAINRIAAGEVVERPASAVKELVENALDAGARRIAVDIACGGKALIRVTDDGCG 90

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT++++P+A+ RH TSKI   D  +I +FGFRGEALPS+ AV  LT+ SR  +   GAQI
Sbjct: 91  MTADDLPLALSRHATSKIDGSDLLDIRSFGFRGEALPSLAAVGRLTITSRVAEAE-GAQI 149

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           A+S  +I  VRP A+  GT+VE+RDLFF  PARL FL++++ ET  I +V+RR+A+A P+
Sbjct: 150 AVSAGRIEPVRPAALGAGTVVELRDLFFATPARLKFLRTDRAETQAIAEVVRRLALAEPE 209

Query: 182 VSFTFSTIKSNRYKMNF--QSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQG 235
           V FT +   +   ++ F  ++  G+  +    R+++V+G +F  NA+ ++     + LQG
Sbjct: 210 VGFTLTDHSAGEPRLLFRAEAEGGDLFDALHRRVARVVGAEFAENALRIDVAREGLRLQG 269

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y  +PT++RG+    ++F+NGR V D+ +L  +R  Y + +   RYP  VL L  DP++V
Sbjct: 270 YAALPTYSRGSGVAQFLFVNGRPVLDRMLLGALRAGYMDVLSRDRYPAAVLNLICDPQRV 329

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL 355
           DVNVHPAK+ +RFR    +R  I+ ++++A+   G   S+ ++ + + +F  +  P    
Sbjct: 330 DVNVHPAKAEVRFREAGEVRGLIVTALRQALAGAGHRASTTVAGETLEAFRPER-PAAAG 388

Query: 356 PKYAT--------SLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLG 407
           P  A+        S+         Q    +   L  ++ P    +    E  EA    LG
Sbjct: 389 PGPASRIYQMDRPSVAAVARSFAFQAPEPAMPGL--AEAPAARVEAPAAE--EAHDRPLG 444

Query: 408 IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLE 467
            A AQIH N+I++QT  GLVIVDQHAAHERL++EK+++  + T I  Q LL PEI++L  
Sbjct: 445 AARAQIHGNWILAQTESGLVIVDQHAAHERLVYEKLKRQRDETGIARQALLIPEIVELSP 504

Query: 468 GECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTY 527
            + A ++E  ++L   G+  E FG  A+A+RE+PAIL K     LLRDI+D++ D  ++ 
Sbjct: 505 TDAARLLEAADELASAGLVIEPFGGGAVAVREVPAILGKVEAAPLLRDILDDLADLGSSD 564

Query: 528 TLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSD 587
            LQ R++ +L+ MAC+GS+RSGR +++ EMN LLREME  P S QCNHGRPT+++LKL+D
Sbjct: 565 RLQARMDAVLSRMACHGSVRSGRALRAEEMNPLLREMEATPLSGQCNHGRPTYVELKLAD 624

Query: 588 IEKLFGR 594
           IE+LFGR
Sbjct: 625 IERLFGR 631


>gi|259417261|ref|ZP_05741180.1| DNA mismatch repair protein [Silicibacter sp. TrichCH4B]
 gi|259346167|gb|EEW57981.1| DNA mismatch repair protein [Silicibacter sp. TrichCH4B]
          Length = 643

 Score =  532 bits (1371), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 261/627 (41%), Positives = 390/627 (62%), Gaps = 43/627 (6%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA ++R+   IA GGK+  ++ DNG G
Sbjct: 24  IRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGATRITVEIADGGKTLIRVIDNGCG 83

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT E++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR  +    AQI
Sbjct: 84  MTPEDLPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLTITSRA-EGYDAAQI 142

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            ++G  +  V+P A+  GTIVE+RDLFF  PARL F+++++ E+  I+D ++R+A+A P 
Sbjct: 143 RVAGGHLELVKPAALRQGTIVELRDLFFATPARLKFMRTDRAESQAISDTVKRLAMAEPA 202

Query: 182 VSFTFSTIKSN---RYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT   +      R        +G+  +    R++ VIG +F  NA++++     I L 
Sbjct: 203 VGFTLRDVSGGGEGRVTFRADPMSGDLFDALHGRLAHVIGREFAENALKIDATREGIRLY 262

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   ++F+N R V+DK +   +R AY + +   R+P   L ++ DP  
Sbjct: 263 GYAALPTYSRGAAVTQFLFVNTRPVKDKMLTGALRAAYMDFLSRDRHPAAALFIDCDPTL 322

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR+P + R  I+ S++ A+ + G   SS ++   + +   +    T 
Sbjct: 323 VDVNVHPAKSEVRFRDPGLARGLIVSSLRHALAEAGHRASSTVAGATLGAMRPEQPTATG 382

Query: 355 LPK---------------YATSLTN------------TQEKLFLQENRLSTNDLLPSDDP 387
            P+               YA                  +   F + +   +  L+  +D 
Sbjct: 383 APRVYQMDRPSPGARNSSYAAQAPGQPPAPSYPAPPSAEPAGFAEFSGAYSGRLV--EDA 440

Query: 388 TYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDF 447
               +  PVE+       LG A  Q+H+NYII+QT DG+VIVDQHAAHERL++EK++   
Sbjct: 441 AVEPEAHPVED-----LPLGAARGQVHENYIIAQTRDGMVIVDQHAAHERLVYEKLKHQM 495

Query: 448 NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKK 507
               + +Q LL PEI++L +G+CA +++  +DL + G+  E FG +A+A+RE PAIL + 
Sbjct: 496 AENGVATQGLLIPEIVELSDGDCARLLDVADDLAKFGLGIEAFGGSAVAVRETPAILGEV 555

Query: 508 NIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKN 567
           N   ++RDI+DE+ D   +  +Q R+E IL+ +AC+GSIRSGR+M+  EMN LLREME  
Sbjct: 556 NAEAMIRDILDELADQGESQLVQARLEAILSRVACHGSIRSGRRMRGEEMNALLREMEAT 615

Query: 568 PNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           P+S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 616 PHSGQCNHGRPTYVELKLADIERLFGR 642


>gi|126463518|ref|YP_001044632.1| DNA mismatch repair protein [Rhodobacter sphaeroides ATCC 17029]
 gi|126105182|gb|ABN77860.1| DNA mismatch repair protein MutL [Rhodobacter sphaeroides ATCC
           17029]
          Length = 616

 Score =  531 bits (1369), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 264/612 (43%), Positives = 393/612 (64%), Gaps = 31/612 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+EN+LDA + R+   IA GGK+  ++TD+G G
Sbjct: 15  IRQLDEAAINRIAAGEVVERPASAVKELVENALDAGARRIAVDIACGGKTLIRVTDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT+E++P+A+ RH TSKI   D  +I +FGFRGEALPS+ AV  LT+ SR  +   GAQI
Sbjct: 75  MTAEDLPLALSRHATSKIDGSDLLDIRSFGFRGEALPSLAAVGRLTITSRVTEGE-GAQI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           A+S  +I  VRP A+  GT+VE+RDLFF  PARL FL++++ ET  I +V+RR+A+A P+
Sbjct: 134 AVSAGRIEPVRPAALGAGTVVELRDLFFATPARLKFLRTDRAETQAIAEVVRRLALAEPE 193

Query: 182 VSFTFSTIKSNRYKMNF--QSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQG 235
           V FT +   +   ++ F  ++  G+  +    R+++V+G +F  NA+ ++     + LQG
Sbjct: 194 VGFTLTYHSAGEPRLLFRAEAEGGDLFDALHRRVARVVGAEFAENALRIDVAREGLRLQG 253

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y  +PT++RG+    ++F+NGR V D+ +L  +R  Y + +   RYP  VL L  DP++V
Sbjct: 254 YAALPTYSRGSGVAQFLFVNGRPVLDRMLLGALRAGYMDVLSRDRYPAAVLNLICDPQRV 313

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL 355
           DVNVHPAK+ +RFR    +R  I+ ++++A+   G   S+ ++ + + +F          
Sbjct: 314 DVNVHPAKAEVRFREAGEVRGLIVTALRQALAGAGHRASTTVAGETLEAFR--------- 364

Query: 356 PKYATSLTNTQEKLFLQENRLSTNDLLPS--------DDPTYSED-----NDPVEESEAT 402
           P+   + +        Q +R S   +  S          P  +E        PV E EA 
Sbjct: 365 PEMPAAASPAPATRIYQMDRPSAAAVARSFAFQAPEPAMPGLAEAPAARVEAPVAE-EAH 423

Query: 403 HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEI 462
              LG A AQIH N+I++QT  GLVIVDQHAAHERL++EK+++  + T I  Q LL PEI
Sbjct: 424 DRPLGAARAQIHGNWILAQTASGLVIVDQHAAHERLVYEKLKRQRDETGIARQALLIPEI 483

Query: 463 IDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIID 522
           ++L   + A ++E  ++L   G+  E FG  A+A+RE+PAIL K     LLRDI+D++ D
Sbjct: 484 VELSPTDAARLLEAADELASAGLVIEPFGGGAVAVREVPAILGKVEAAPLLRDILDDLAD 543

Query: 523 SSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIK 582
             ++  LQ R++ +L+ MAC+GS+RSGR +++ EMN LLREME  P S QCNHGRPT+++
Sbjct: 544 LGSSDRLQARMDAVLSRMACHGSVRSGRALRAEEMNALLREMEATPLSGQCNHGRPTYVE 603

Query: 583 LKLSDIEKLFGR 594
           LKL+DIE+LFGR
Sbjct: 604 LKLADIERLFGR 615


>gi|254473678|ref|ZP_05087074.1| DNA mismatch repair protein [Pseudovibrio sp. JE062]
 gi|211957390|gb|EEA92594.1| DNA mismatch repair protein [Pseudovibrio sp. JE062]
          Length = 679

 Score =  531 bits (1367), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 267/654 (40%), Positives = 409/654 (62%), Gaps = 62/654 (9%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+LS+  IN+IAAGE+IERP+  +KEL+EN++DA ++R+E V A GGKS  +ITDNG
Sbjct: 27  MAVRQLSDTTINRIAAGEVIERPASVVKELVENAVDAGATRIEIVTATGGKSLLRITDNG 86

Query: 61  FGMTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT E++ +AV+RHCTSK+  +D  +I T GFRGEALPSIGA+S L + +R        
Sbjct: 87  AGMTKEDLQLAVRRHCTSKLPENDLMDIRTMGFRGEALPSIGAISRLEITTRHASEPHAW 146

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +I + G + S V P A+N GT VEV+D+FF++PARL FLKS++ E   IT++I+R+A+A 
Sbjct: 147 KIEVEGGQNSEVEPAALNAGTRVEVKDIFFSVPARLKFLKSDRAEATAITEIIKRIALAN 206

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPE--RISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P + FT S   S+R ++   +  G+  +  RI Q++G +F  NA+E+      + L GY 
Sbjct: 207 PTIRFTLS--GSDRRQLELPACTGDDADLARIGQILGAEFTKNAMEIEALREGVHLYGYA 264

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PTF+R N+   + F+NGR V+DK +L +++ AY++ +   R+P+VVL +++DP QVDV
Sbjct: 265 GLPTFHRANSQHQFFFVNGRPVRDKLLLGSLKAAYSDVLSRDRHPIVVLNIDLDPHQVDV 324

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF------------ 345
           NVHPAK+ +RFR+  ++R  +I +++ A  + G   S+  ++  I++             
Sbjct: 325 NVHPAKADVRFRDGQLVRGLLIGALKNAFVQSGFRASTANTQSAINAIRPMGQGAGFNVH 384

Query: 346 ----------HQDNAPKTHLPKYATSLTNTQEKLF---------LQENRL----STNDLL 382
                     H++ A      + A     +   ++          QE +L    +T    
Sbjct: 385 SGASAHTQQGHREAAQSYSWRQSAYRPEESSASVWSAADIPEAGTQETQLGLMEATAPYT 444

Query: 383 PSDDPTYSED-------------NDPVEESEA---------THYQLGIACAQIHQNYIIS 420
            S +P+  +D             + P  +S A          ++ LG A AQIH+ YI+S
Sbjct: 445 ASPEPSMGQDSAAEQGHQAYNLVDAPSADSRAHVHELPEDRENFPLGAARAQIHETYIVS 504

Query: 421 QTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDL 480
           QT DGLVIVDQHAAHERL++E++++D     +  Q LL PEI+DL E + A + E   +L
Sbjct: 505 QTKDGLVIVDQHAAHERLVYEQLKEDLAKRDVPRQMLLIPEIVDLPEDDVARLEERASEL 564

Query: 481 HRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATM 540
             +G+  ERFGP AIA+RE P++L + NI  L++D+ D+  +  ++  ++++++ + ATM
Sbjct: 565 EEVGLVLERFGPGAIAVRETPSMLKRLNIKALVQDLADDFAEYDSSTRIREKLDLVAATM 624

Query: 541 ACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           AC+GSIR+GR+M+  EM+ LLR+ME  P S QCNHGRPT+I+LKL DIE+LFGR
Sbjct: 625 ACHGSIRAGRRMRPEEMDNLLRDMEATPKSGQCNHGRPTWIELKLHDIERLFGR 678


>gi|89067221|ref|ZP_01154734.1| DNA mismatch repair protein [Oceanicola granulosus HTCC2516]
 gi|89046790|gb|EAR52844.1| DNA mismatch repair protein [Oceanicola granulosus HTCC2516]
          Length = 608

 Score =  530 bits (1364), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 258/607 (42%), Positives = 390/607 (64%), Gaps = 28/607 (4%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+EN++DA ++R+E   A GGK   ++TD+G G
Sbjct: 14  IRQLDEAAINRIAAGEVVERPASAVKELVENAIDAGATRIEIDYADGGKRLIRVTDDGCG 73

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           +  +++P+A+ RH TSKI   D   I TFGFRGEALPS+GAV  LT+ SR    +  A I
Sbjct: 74  IAGDDLPLALSRHATSKIDGSDLLEISTFGFRGEALPSLGAVGRLTITSR--CGDAAASI 131

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            ++G +  +VRP A++ GT VE+RDLF   PARL FL++++ E   I + ++R+A+A P 
Sbjct: 132 TVTGGRAEAVRPAALSRGTRVELRDLFHATPARLKFLRTDRAEAQAIAETVKRLALAEPF 191

Query: 182 VSFTFSTIKSNRYKMNFQS--TNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQG 235
           V+FT + +  +  +  F++   +G+  +    R +QV+G DF  NA+ L+ +     L G
Sbjct: 192 VAFTLTDLSGDSPRTVFRADAQSGDLFDALHGRTAQVLGRDFAANAIPLDAEREGHHLTG 251

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y  +PT++RG++ Q ++F+NGR VQD+ ++  +R AY + +   R+P  VL ++  PR V
Sbjct: 252 YAALPTYSRGSSVQQFLFVNGRPVQDRLLIGALRAAYMDVLSRDRHPAAVLFIDCAPRLV 311

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL 355
           DVNVHPAKS +RFR+   +R  I+  ++ A+   G   SS ++   + +F  +  P    
Sbjct: 312 DVNVHPAKSQVRFRDGGSVRGLIVSGLRHALAGAGHRASSTVAGATLGAFRAEPGPAP-- 369

Query: 356 PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEAT--------HYQLG 407
                   N   +++ Q +R +    +P   P ++E   P    EA            LG
Sbjct: 370 -------ANEPARVY-QMDRPAPRAAMPPM-PGFAEAPAPSARIEAPAAPAPGDERRPLG 420

Query: 408 IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLE 467
            A AQ+H+NYI++QT  G+V+VDQHAAHERL++EK+++      I +Q LL PEI++L E
Sbjct: 421 AARAQVHENYIVAQTETGIVLVDQHAAHERLVYEKLKRQSAENGIAAQALLIPEIVELSE 480

Query: 468 GECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTY 527
            +CAL++ H + L  LG+  E FG  A+A+RE PA+L + +   L+RDI+DE+ D   + 
Sbjct: 481 SDCALLLSHADTLATLGLVLEPFGGGAVAVRETPALLGQVDAAALVRDILDELADLGEST 540

Query: 528 TLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSD 587
            L+ RI+ IL+ +AC+GSIRSGR+M++ EMN LLREME  P S QCNHGRPT+++LKLSD
Sbjct: 541 ALRARIDAILSRVACHGSIRSGRQMRAEEMNALLREMEATPLSGQCNHGRPTYVELKLSD 600

Query: 588 IEKLFGR 594
           IE+LFGR
Sbjct: 601 IERLFGR 607


>gi|86139358|ref|ZP_01057927.1| DNA mismatch repair protein [Roseobacter sp. MED193]
 gi|85823861|gb|EAQ44067.1| DNA mismatch repair protein [Roseobacter sp. MED193]
          Length = 645

 Score =  529 bits (1363), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 263/632 (41%), Positives = 390/632 (61%), Gaps = 43/632 (6%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA + R+   IA GGK+  ++TD+G G
Sbjct: 16  IRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGAHRITIEIADGGKTLIRVTDDGCG 75

Query: 63  MTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MTS ++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR   ++  AQI
Sbjct: 76  MTSRDLPLALSRHATSKIDGTDLLNIHTFGFRGEALPSLGAVGRLTITSRAAGHDA-AQI 134

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            ++G K+  VRP A+  GTIVE+ DLF+  PARL F+++++ E+  I DV++R+A+A P 
Sbjct: 135 RVAGGKMEPVRPAALRAGTIVELADLFYATPARLKFMRTDRAESQAIGDVVKRLAMAEPS 194

Query: 182 VSFTFSTIKSN---RYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT   +      R         G+  +    R++ V+G +F  NA++++     I L 
Sbjct: 195 VGFTLRDVSGGGEGRVTFRADPLTGDLFDALHGRLASVLGREFAENALKIDATREGIRLF 254

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   ++F+N R V+DK +   +R AY + +   R+P   L ++ DP  
Sbjct: 255 GYAALPTYSRGAAVAQFLFVNSRPVKDKMLTGALRGAYFDFLSRDRHPAAALFIDCDPTL 314

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR+P + R  I+ +++ A+ + G   S+ ++   + +   + AP  +
Sbjct: 315 VDVNVHPAKSEVRFRDPGLARGLIVSALRHALAEAGHRASTTVAGATLGAMRPE-APTAN 373

Query: 355 LP----------------KYATSLTNTQEKL--------------FLQE--NRLSTNDLL 382
                              YA       +++              F  E   RL T+ L 
Sbjct: 374 GAARVYQMDRPSLGARNLSYAAQAPGQPQEMSVPAPPAAAPGFAEFQHEYSGRL-TDPLA 432

Query: 383 PSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEK 442
            ++ P    D        A H  LG A  Q+H+NYII+QT DG+VIVDQHAAHERL++EK
Sbjct: 433 DTEAPGQMSDAPEPTAPGAEHLPLGAARGQVHENYIIAQTADGMVIVDQHAAHERLVYEK 492

Query: 443 MRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPA 502
           ++Q      + +Q LL PEI++L   +CA I+   E+L + G+  E FG NA+A+RE PA
Sbjct: 493 LKQQMAENGVAAQALLIPEIVELGSNDCARILAQAEELKKFGLGLEAFGGNAVAVRETPA 552

Query: 503 ILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLR 562
           IL + N   +++DI+DE+ D   +  +Q R+E IL+ +AC+GS+RSGR+M+  EMN LLR
Sbjct: 553 ILGEVNAEAMVKDILDELDDQGESQLVQARLEAILSRVACHGSVRSGRRMRGEEMNALLR 612

Query: 563 EMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           EME  P+S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 613 EMEATPHSGQCNHGRPTYVELKLADIERLFGR 644


>gi|159042919|ref|YP_001531713.1| DNA mismatch repair protein [Dinoroseobacter shibae DFL 12]
 gi|157910679|gb|ABV92112.1| DNA mismatch repair protein MutL [Dinoroseobacter shibae DFL 12]
          Length = 621

 Score =  529 bits (1363), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 259/603 (42%), Positives = 379/603 (62%), Gaps = 14/603 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE+IERP+ A+KEL+EN+LDA++ ++E   A GGK+  ++TD+G G
Sbjct: 21  IRQLDEAAINRIAAGEVIERPASAVKELVENALDAQARQIEIAYADGGKTLLRVTDDGIG 80

Query: 63  MTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           + + ++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR       A++
Sbjct: 81  IAAGDLPLALARHATSKIDGADLLNIHTFGFRGEALPSLGAVGRLTIASRAAGAEA-AEV 139

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            + G ++  VRP A+N GT+V +RDLF   PARL FL+S++ E   I +V+RR+A+A P 
Sbjct: 140 TVEGGRMGPVRPAALNRGTVVTLRDLFSATPARLKFLRSDRAEVQAIGEVVRRLAMAEPS 199

Query: 182 VSFTFSTIKSN---RYKMNFQSTNGNF----PERISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT   +      R         G+       R+ +V+G +F  NA+ +  +   + L 
Sbjct: 200 VGFTLRDVSGGGEGRVTFRVAPEQGDLFDALHRRLGRVLGSEFAENALRIEGEREGLRLS 259

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   ++F+NGR V+DK ++  +R AYA+ +   R+P  VL ++  P +
Sbjct: 260 GYAALPTYSRGAAVAQFLFVNGRPVRDKLLVGALRGAYADFLSRDRHPAAVLFVDCPPER 319

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR P + R  I+ +++ A+ + G   SS ++   + +F   +A  + 
Sbjct: 320 VDVNVHPAKSEVRFREPGVARGLIVTALRHALAEAGHRASSTVADATLGAFRAPDAVGSG 379

Query: 355 LPKYAT---SLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACA 411
              Y     S          Q    +      ++ P  S   +P E  EA    LG A A
Sbjct: 380 ARIYQMDRPSAAALGRSTAWQAPETAAQGFGFAEAP--SARVEPAETVEAIARPLGAARA 437

Query: 412 QIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECA 471
           Q+H+NYI++QT  G+V+VDQHAAHERL++E+++       + SQ LL PEI+++ E +  
Sbjct: 438 QLHENYIVAQTETGMVLVDQHAAHERLVYERLKALMAENGVPSQALLIPEIVEMSEADAR 497

Query: 472 LIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQD 531
            +++  E+L  LG++ E FGP A+A+RE PA+L       LLRDI+DE+ D   T  LQ 
Sbjct: 498 TLLDRSEELAALGLRIEPFGPGAVAVRETPALLGPVKAEALLRDILDELSDLGQTDALQA 557

Query: 532 RIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKL 591
           RIE IL+ MAC+GS+RSGR+M   EMN LLR+ME  P+S QCNHGRPT+++LKL+DIE+L
Sbjct: 558 RIEAILSRMACHGSVRSGRRMSGEEMNALLRQMEATPHSGQCNHGRPTYVELKLADIERL 617

Query: 592 FGR 594
           FGR
Sbjct: 618 FGR 620


>gi|254466092|ref|ZP_05079503.1| DNA mismatch repair protein MutL [Rhodobacterales bacterium Y4I]
 gi|206687000|gb|EDZ47482.1| DNA mismatch repair protein MutL [Rhodobacterales bacterium Y4I]
          Length = 647

 Score =  528 bits (1361), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 264/632 (41%), Positives = 398/632 (62%), Gaps = 45/632 (7%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA ++R+   IA GGK+  ++TD+G G
Sbjct: 20  IRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGATRITVEIADGGKTLIRVTDDGCG 79

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT +++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR    +  AQI
Sbjct: 80  MTPDDLPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLTITSRA-AGHEAAQI 138

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +SG K+  V+P A+  GT+VE+RDLFF  PARL F+++++ E   I+D ++R+A+A P 
Sbjct: 139 RVSGGKLEPVKPAALRAGTVVELRDLFFATPARLKFMRTDRAEAQAISDTVKRLAMAEPS 198

Query: 182 VSFTFSTIKSN---RYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT   +      R        +G+  +    R++ V+G +F  NA++++     I L 
Sbjct: 199 VGFTLRDVSGGGEGRVTFRADPLSGDLFDALHGRLASVLGREFAENALKIDATREGIRLY 258

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   ++F+N R V+DK +   +R AY + +   R+P   L ++ DP+ 
Sbjct: 259 GYAALPTYSRGAAVAQFLFVNTRPVKDKMLTGALRAAYFDFLSRDRHPAAALFVDCDPQL 318

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD-----N 349
           VDVNVHPAKS +RFR+P + R  I+ S++ A+ + G   S+ ++   + +   +      
Sbjct: 319 VDVNVHPAKSEVRFRDPGLARGLIVSSLRHALAEAGHRASTTVAGATLGAMKPEQPTASG 378

Query: 350 APKTH---LPKY-ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSE-------------- 391
           AP+ +    P Y A SL+   +     + +  + D  PS  P ++E              
Sbjct: 379 APRIYQMDRPSYGARSLSYAAQS--PGQPQAPSYDAPPS--PGFAELAGVYSGRVTEVAE 434

Query: 392 -------DNDPVEESE--ATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEK 442
                   + P E S   A    LG A  Q+H+NYII+QT DG+VIVDQHAAHERL++EK
Sbjct: 435 APTAPGRPSVPPEASAPGAEQLPLGAARGQVHENYIIAQTADGMVIVDQHAAHERLVYEK 494

Query: 443 MRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPA 502
           +++      + +Q LL PEI++L + +CA ++   ++L + G+  E FG NAIA+RE PA
Sbjct: 495 LKRQMAENGVAAQALLIPEIVELSDNDCACLLGVADELAKFGLGIEAFGGNAIAVRETPA 554

Query: 503 ILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLR 562
           IL + N   +++DI+DE+ D   +  +Q +IE IL+ +AC+GSIRSGR+M+  EMN LLR
Sbjct: 555 ILGEVNAKAMIKDILDELSDQGESQLVQAKIEAILSRVACHGSIRSGRRMRGEEMNALLR 614

Query: 563 EMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           EME  P+S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 615 EMEATPHSGQCNHGRPTYVELKLADIERLFGR 646


>gi|254477379|ref|ZP_05090765.1| DNA mismatch repair protein MutL [Ruegeria sp. R11]
 gi|214031622|gb|EEB72457.1| DNA mismatch repair protein MutL [Ruegeria sp. R11]
          Length = 649

 Score =  528 bits (1360), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 264/638 (41%), Positives = 390/638 (61%), Gaps = 51/638 (7%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA ++R+   IA GGK+  ++TD+G G
Sbjct: 16  IRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGATRITIDIADGGKTLIRVTDDGCG 75

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT +++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR   ++  AQI
Sbjct: 76  MTPDDLPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLTITSRAAGHDA-AQI 134

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +SG K+  V+P A+  GT+VE+RDLF+  PARL F++S++ E+  I DVI+R+A+A P 
Sbjct: 135 RVSGGKLEPVKPAALRGGTVVELRDLFYATPARLKFMRSDRAESQAIGDVIKRLAMAEPS 194

Query: 182 VSFTFSTIKSN---RYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT   +      R        +G+  +    R++ V+G +F  NA++++     I L 
Sbjct: 195 VGFTLRDVSGGGDGRVTFRADPLSGDLFDALHGRLAAVLGREFAENALKIDASREGIRLY 254

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   ++F+N R V+DK +   +R AY + +   R+P   L ++ DP  
Sbjct: 255 GYAALPTYSRGAAVAQFLFVNTRPVKDKMLTGALRAAYFDFLSRDRHPAAALFIDCDPTL 314

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR+P + R  I+ S++ A+ + G   SS ++   + +   +    T 
Sbjct: 315 VDVNVHPAKSEVRFRDPGLARGLIVSSLRHALAEAGHRASSTVAGATLGAMRPEQPTATG 374

Query: 355 LPKY---------ATSLTNTQEKLFLQENRLSTNDLLPSDD--PTYS------------- 390
            P+          A SL+   +  +    R     +   DD  P +S             
Sbjct: 375 APRVYQMDRPSMGARSLSYAAQAPY----RADGAPVPQGDDNAPGFSEFASAYSGRVIDA 430

Query: 391 --------------EDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHE 436
                         ED     E  A    LG A  Q+H+NYII+QT DG+VIVDQHAAHE
Sbjct: 431 PAPPHPAMAGQAVQEDQPEPPEQRAEELPLGAARGQVHENYIIAQTRDGMVIVDQHAAHE 490

Query: 437 RLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIA 496
           RL++EK+++      + +Q LL P+I++L E +CA ++   ++L + G+  E FG  A+A
Sbjct: 491 RLVYEKLKRQMAENGVAAQALLIPDIVELSENDCARLLSVADELQKFGLGIEAFGGGAVA 550

Query: 497 IREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIE 556
           +RE PAIL   N   ++RDI+DE+ D   +  +Q +IE IL+ +AC+GSIRSGR M+  E
Sbjct: 551 VRETPAILGTVNAEAMVRDILDELDDQGESQLVQAKIEAILSRVACHGSIRSGRWMRGEE 610

Query: 557 MNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           MN LLREME  P+S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 611 MNALLREMEATPHSGQCNHGRPTYVELKLADIERLFGR 648


>gi|83855187|ref|ZP_00948717.1| DNA mismatch repair protein [Sulfitobacter sp. NAS-14.1]
 gi|83843030|gb|EAP82197.1| DNA mismatch repair protein [Sulfitobacter sp. NAS-14.1]
          Length = 635

 Score =  528 bits (1359), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 262/624 (41%), Positives = 393/624 (62%), Gaps = 36/624 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA + ++    A GGK+  ++TD+G G
Sbjct: 15  IRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGARQITVEYADGGKTLIRVTDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           + ++++ +A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR    + GA+I
Sbjct: 75  IAADDLTLALSRHATSKIDGTDLLNIHTFGFRGEALPSLGAVGRLTICSRVAGQD-GAEI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           +++G     VRP A+N GT+V +RDLFF  PARL FL++++ E   I+D+I+R+A+A P 
Sbjct: 134 SVNGGVAGPVRPAALNGGTVVTLRDLFFATPARLKFLRTDRAEAQAISDIIKRLAMAEPF 193

Query: 182 VSFTFSTIKSN---RYKMNFQSTNGN----FPERISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT   +  +   R     ++  G+       R++QV+G +F  NA+ ++ +   + L 
Sbjct: 194 VRFTLRDVSGDGPGREVFRAEAEQGDMFAALHGRLAQVLGREFAENALAIDAEREGLHLT 253

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG+A   Y+F+NGR V+DK ++  +R AY + +   R+P   L ++ DP+ 
Sbjct: 254 GYAALPTYSRGSAVTQYLFVNGRPVRDKLLVGALRGAYFDLLSRDRHPAAALFVDCDPKL 313

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMI------------ 342
           VDVNVHPAKS +RFR+P + R  I+ +++ A+   G   S+ ++   +            
Sbjct: 314 VDVNVHPAKSEVRFRDPGLARGLIVSALRHALADAGHRASTTVANATLGAMRPEQPGARV 373

Query: 343 -----------SSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSE 391
                      S+ +Q  AP+   P +A +           +      D+   D  T+  
Sbjct: 374 YQMDRPSLGARSAAYQAQAPE---PGFAETAGMWGRVETPPQYEAGGADVQTHDTQTHDA 430

Query: 392 DNDPVEESE-ATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST 450
            +     +E A  + LG A AQ+H+NYII+QT  G+VIVDQHAAHERL++EK+++     
Sbjct: 431 HDAHTPAAEPAPDFPLGTARAQVHENYIIAQTATGMVIVDQHAAHERLVYEKLKRQMAEN 490

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
            + +Q LL PEI+DL   +CA ++E  +DL R G+  E FG +AIA+RE PAIL   +  
Sbjct: 491 GVAAQALLIPEIVDLSASDCARLLEVADDLARFGLGIEPFGGSAIAVRETPAILGTVDAK 550

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
            ++ DI+DE+ D + + TLQ RIE IL+ +AC+GSIRSGR M+  EMN LLREME  P+S
Sbjct: 551 AMVLDILDELADQNESNTLQARIEAILSRVACHGSIRSGRWMRGEEMNALLREMEATPHS 610

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
            QCNHGRPT+++LKLSDIE+LFGR
Sbjct: 611 GQCNHGRPTYVELKLSDIERLFGR 634


>gi|83941709|ref|ZP_00954171.1| DNA mismatch repair protein [Sulfitobacter sp. EE-36]
 gi|83847529|gb|EAP85404.1| DNA mismatch repair protein [Sulfitobacter sp. EE-36]
          Length = 632

 Score =  527 bits (1358), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 263/623 (42%), Positives = 393/623 (63%), Gaps = 37/623 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA + ++    A GGK+  ++TD+G G
Sbjct: 15  IRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGARQITVEYADGGKTLIRVTDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           + ++++ +A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR    + GA+I
Sbjct: 75  IAADDLTLALSRHATSKIDGTDLLNIHTFGFRGEALPSLGAVGRLTICSRVAGQD-GAEI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           +++G     VRP A+N GT+V +RDLFF  PARL FL++++ E   I+D+I+R+A+A P 
Sbjct: 134 SVNGGVTGPVRPAALNGGTVVTLRDLFFATPARLKFLRTDRAEAQAISDIIKRLAMAEPF 193

Query: 182 VSFTFSTIKSN---RYKMNFQSTNGN----FPERISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT   +  +   R     ++  G+       R++QV+G +F  NA+ ++ +   + L 
Sbjct: 194 VRFTLRDVSGDGPGREVFRAEAEQGDMFAALHGRLAQVLGREFAENALAIDAEREGLHLT 253

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG+A   Y+F+NGR V+DK ++  +R AY + +   R+P   L ++ DP+ 
Sbjct: 254 GYAALPTYSRGSAVTQYLFVNGRPVRDKLLVGALRGAYFDLLSRDRHPAAALFVDCDPKL 313

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMI------------ 342
           VDVNVHPAKS +RFR+P + R  I+ +++ A+   G   S+ ++   +            
Sbjct: 314 VDVNVHPAKSEVRFRDPGLARGLIVSALRHALADAGHRASTTVANATLGAMRPEQPGARV 373

Query: 343 -----------SSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSE 391
                      S+ +Q  AP+   P +A +           +      D+   D  T+ +
Sbjct: 374 YQMDRPSLGARSAAYQAQAPE---PGFAETAGMWGRVETPPQYEAGGADVQTHDTRTH-D 429

Query: 392 DNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK 451
            + P  E  A  + LG A  Q+H+NYII+QT  G+VIVDQHAAHERL++EK+++      
Sbjct: 430 AHTPAAEP-APDFPLGTARGQVHENYIIAQTATGMVIVDQHAAHERLVYEKLKRQMAENG 488

Query: 452 ITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQ 511
           + +Q LL PEI+DL   +CA ++E  EDL R G+  E FG +AIA+RE PAIL   +   
Sbjct: 489 VAAQALLIPEIVDLSASDCARLLEVAEDLARFGLGIEAFGGSAIAVRETPAILGTVDAKA 548

Query: 512 LLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSS 571
           ++ DI+DE+ D + + TLQ RIE IL+ +AC+GSIRSGR M+  EMN LLREME  P+S 
Sbjct: 549 MVLDILDELADQNESNTLQARIEAILSRVACHGSIRSGRWMRGEEMNALLREMEATPHSG 608

Query: 572 QCNHGRPTFIKLKLSDIEKLFGR 594
           QCNHGRPT+++LKLSDIE+LFGR
Sbjct: 609 QCNHGRPTYVELKLSDIERLFGR 631


>gi|23015547|ref|ZP_00055320.1| COG0323: DNA mismatch repair enzyme (predicted ATPase)
           [Magnetospirillum magnetotacticum MS-1]
          Length = 600

 Score =  526 bits (1356), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 261/612 (42%), Positives = 382/612 (62%), Gaps = 31/612 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR L   ++NQIAAGE++ERP+ A+KEL+EN++DA ++R++ V+A GG+S   ++D+G
Sbjct: 1   MSIRLLPPTLVNQIAAGEVVERPASAVKELVENAIDAGATRIDVVLAEGGQSLIAVSDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM  +E+ +AV+RH TSK+  DD   I+  GFRGEALPSIG+V+ LTL SRP    +  
Sbjct: 61  CGMAPDEMMLAVERHATSKLPDDDLVRINFLGFRGEALPSIGSVARLTLTSRPRGAESAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            +++ G       P A   GT +EVRDLF+  PARL FLK+ + E     DVI R+ +A+
Sbjct: 121 SLSVEGGVKGRPVPAAHPFGTRIEVRDLFYATPARLKFLKAARTELAHACDVIERLGMAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPE-----RISQVIGEDFINNAVELNEKSNEITLQ 234
           P ++F+ S     R  ++  +  G  PE     RI+QV+G +F  NA+ L+   + + L 
Sbjct: 181 PGIAFSLS--DGGRKVLDLAAKRGE-PEAARLARIAQVVGREFEPNALALDALRDGVRLT 237

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           G+ G+PT+NR  +   Y+++NGR V+D+ ++  +R AY + +   R+PVV L L+++P Q
Sbjct: 238 GWAGLPTYNRATSAAQYLYVNGRPVKDRLVIGAVRGAYQDVLARDRHPVVALFLDLEPDQ 297

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKT- 353
           VDVNVHPAK+ +RFR+  ++R  I+ +I+ A+   G   SS L+   + +    + P + 
Sbjct: 298 VDVNVHPAKAEVRFRDSGLVRGLIVGAIRHALAGAGHRASSTLTGVALGALGSPSQPPSS 357

Query: 354 ---HLPKYATSLT------NTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESE--AT 402
              H P    SL         Q    L E  LS  DL P+          PV E+E   T
Sbjct: 358 FFGHHPPPRPSLPLVRAAIEAQSPFGLAEQSLSL-DLPPAA---------PVTETEEFTT 407

Query: 403 HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEI 462
            Y LG A AQ+H  YI+++T DGLVIVDQHAAHERL+FE+++      ++  Q LL PE+
Sbjct: 408 DYPLGAAKAQLHDTYIVAETKDGLVIVDQHAAHERLVFERLKLGLEDGRVARQGLLLPEV 467

Query: 463 IDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIID 522
           +DL E   A + E   DL RLG+  E FGP A+ +RE+PA+L + ++  L+RD+ DE+ +
Sbjct: 468 VDLGEAGAARVAERAPDLARLGLVVEPFGPGAVVVREVPALLGEGDVQGLVRDLADELAE 527

Query: 523 SSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIK 582
              +  L++R+ ++ ATMAC+GS+R+GR++   EMN LLR ME  P S QCNHGRPT I 
Sbjct: 528 WGASTALEERLLHVCATMACHGSVRAGRRLGIPEMNALLRRMEATPLSGQCNHGRPTHIS 587

Query: 583 LKLSDIEKLFGR 594
           L L+DIEKLFGR
Sbjct: 588 LSLADIEKLFGR 599


>gi|83313515|ref|YP_423779.1| DNA mismatch repair protein [Magnetospirillum magneticum AMB-1]
 gi|123767885|sp|Q2VYV5|MUTL_MAGMM RecName: Full=DNA mismatch repair protein mutL
 gi|82948356|dbj|BAE53220.1| DNA mismatch repair enzyme [Magnetospirillum magneticum AMB-1]
          Length = 607

 Score =  525 bits (1351), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 256/611 (41%), Positives = 375/611 (61%), Gaps = 22/611 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR L   ++NQIAAGE++ERP+ A+KEL+EN++DA +SR++ V+A GG+S   ++D+G
Sbjct: 1   MSIRLLPPTLVNQIAAGEVVERPASAVKELVENAIDAGASRIDVVLAEGGQSLIAVSDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM+ +E+ +AV+RH TSK+  DD   I   GFRGEALPSIG+V+ LTL SRP   ++  
Sbjct: 61  CGMSPDEMMLAVERHATSKLPDDDLVRIRFLGFRGEALPSIGSVARLTLTSRPRGADSAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            +++ G       P A   GT +EVRDLF+  PARL FLK+ + E     DVI R+ +A+
Sbjct: 121 SLSVEGGAKGRPVPAAHPQGTRIEVRDLFYATPARLKFLKAARTELTHAADVIERLGMAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGN----FPERISQVIGEDFINNAVELNEKSNEITLQG 235
           P ++F+ S     R  ++  +  G        RI+QV+G +F  NA+ L+ + + + L G
Sbjct: 181 PDIAFSLS--DGGRKVLDLAAKRGEPGAALLSRIAQVVGREFEPNALALDAERDGVRLTG 238

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           + G+PT+NR  +   Y+F+NGR V+D+ ++  +R AY + +   R+PVV L LE+DP QV
Sbjct: 239 WAGLPTYNRATSAAQYLFVNGRPVKDRLVIGAVRGAYQDVLARDRHPVVALFLELDPDQV 298

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMIS------------ 343
           DVNVHPAK+ +RFR+  ++R  I+ +I+ A+   G   SS L+   +             
Sbjct: 299 DVNVHPAKAEVRFRDSGLVRGLIVGAIRHALAGAGHRASSTLTGVALGALGGGGGNSPPP 358

Query: 344 SFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATH 403
           SF     P+  LP     +   Q  L L E  L  +    +          P E S    
Sbjct: 359 SFAHYPPPRPSLPLIRAGI-GAQAPLGLAEQGLGLHLPPAAPVAPPEAREGPGEAS--VD 415

Query: 404 YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEII 463
           Y LG A AQ+H  YI+++T DGLVIVDQHAAHERL+FE+++      ++  Q LL PE++
Sbjct: 416 YPLGAAKAQLHDTYIVAETADGLVIVDQHAAHERLVFERLKLGLTEGQVARQGLLLPEVV 475

Query: 464 DLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDS 523
           DL +   A + E   DL RLG+  + FGP A+ +RE+PA+L   ++  L+RD+ DE+ + 
Sbjct: 476 DLGDAGAARVTERAGDLARLGLVIDSFGPGAVVVREVPALLGDDDVQGLVRDLADELAEW 535

Query: 524 STTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKL 583
             +  L++R+ +I ATMAC+GS+R+GR++   EMN LLR ME  P S QCNHGRPT + L
Sbjct: 536 GASTVLEERLLHICATMACHGSVRAGRRLSVPEMNALLRRMEATPLSGQCNHGRPTHVSL 595

Query: 584 KLSDIEKLFGR 594
            L+DIEKLFGR
Sbjct: 596 SLNDIEKLFGR 606


>gi|163745482|ref|ZP_02152842.1| DNA mismatch repair protein [Oceanibulbus indolifex HEL-45]
 gi|161382300|gb|EDQ06709.1| DNA mismatch repair protein [Oceanibulbus indolifex HEL-45]
          Length = 623

 Score =  523 bits (1346), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 259/616 (42%), Positives = 386/616 (62%), Gaps = 32/616 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA + R+    A GGK+  ++TD+G G
Sbjct: 15  IRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGARRITVEYADGGKTMIRVTDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           +  +++ +A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR      GA+I
Sbjct: 75  IAPDDLALALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLTITSRA-AGFEGAEI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            + G ++   RP A+N GTIV +RDLFF  PARL FL++++ E   I DVI+R+A+A P 
Sbjct: 134 TVDGGRMGEARPAALNSGTIVTLRDLFFATPARLKFLRTDRAEAQAIGDVIKRLAMAEPF 193

Query: 182 VSFTFSTIKSN---RYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           V F    +  +   R     ++  G+  E    R++QV+G +F  N++ ++     + L 
Sbjct: 194 VRFVLRDVSGDGKGRDVFRAEAEQGDLFEALHGRLAQVLGREFAENSLPIDAMREGLHLT 253

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           G+  +PT++RG+A   Y+F+NGR V+DK +   +R AY++ +   R+P   L +E  P  
Sbjct: 254 GFAALPTYSRGSAVAQYLFVNGRPVRDKLLTGALRGAYSDFLSRDRHPAAALFVECPPTL 313

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISS---------- 344
           VDVNVHPAKS +RFR+P + R  I+ +++ A+ + G   S+ +++  + +          
Sbjct: 314 VDVNVHPAKSEVRFRDPGLARGLIVSALRHALAEAGHRASTTVAQATLGAMQPEPQGARV 373

Query: 345 FHQDNA------PKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE 398
           +  D A      P      Y        E   +      T   +P+  P   E      E
Sbjct: 374 YQMDRAGMDRPSPAARQAAYEAQAPGFAETAGVWGRVEGTP--MPA-APVVEE----ASE 426

Query: 399 SEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLL 458
           + A  Y LG A  Q+H+NYII+QT +G+VIVDQHAAHERL++EK+++  N   + +Q LL
Sbjct: 427 APAPDYPLGTARGQVHENYIIAQTANGMVIVDQHAAHERLVYEKLKRQMNDNGVAAQALL 486

Query: 459 TPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIID 518
            PEI++L   +CA ++E  +DL +LG+  E FG +AIA+RE PAIL   N   L+ D++D
Sbjct: 487 IPEIVELSANDCARLLELADDLAKLGLGIEAFGGSAIAVRETPAILGTVNARALILDVLD 546

Query: 519 EIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRP 578
           E+ D  ++  +Q +IE IL+ +AC+GSIRSGR M++ EMN LLREME  P+S QCNHGRP
Sbjct: 547 ELADGDSSNIVQAKIEAILSRVACHGSIRSGRWMRAEEMNALLREMEATPHSGQCNHGRP 606

Query: 579 TFIKLKLSDIEKLFGR 594
           T+++LKL+DIE+LFGR
Sbjct: 607 TYVELKLADIERLFGR 622


>gi|89056538|ref|YP_511989.1| DNA mismatch repair protein [Jannaschia sp. CCS1]
 gi|88866087|gb|ABD56964.1| DNA mismatch repair protein MutL [Jannaschia sp. CCS1]
          Length = 610

 Score =  522 bits (1344), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 254/599 (42%), Positives = 385/599 (64%), Gaps = 12/599 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+EN++DA++ R+   +A GGK+  ++TD+G G
Sbjct: 16  IRQLDEAAINRIAAGEVVERPASAVKELVENAIDADARRIVIEVAHGGKTLIRVTDDGCG 75

Query: 63  MTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M + ++P+A+ RH TSKI   D  NIH+FGFRGEALPS+G+V  L++ SR   ++ G  I
Sbjct: 76  MEAADLPLALSRHATSKIDGTDLLNIHSFGFRGEALPSLGSVGRLSITSR--ASDAGHMI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            ++G    +V+P A+N GT+VE+RDLFF  PARL FL++++ E   ITDV++R+A+A P 
Sbjct: 134 RVTGGAHDAVKPAALNRGTLVELRDLFFATPARLKFLRTDRAEMQAITDVVKRLAMAEPA 193

Query: 182 VSFTFSTIKSN-RYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQGY 236
           V FT   +    R         G+  +    R++ ++G DF +NA+ ++ +   + L GY
Sbjct: 194 VGFTLKDVSDGERVTFRVDPEQGDLFDALRGRLTAIMGRDFTDNALAIDAEREGLRLTGY 253

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
             +PT++RG+A   ++F+NGR V+DK ++  +R AY + +   R+P  VL +     +VD
Sbjct: 254 AALPTYSRGSAVAQFLFVNGRPVRDKLLIGALRAAYMDVLSRDRHPAAVLFIGCPSERVD 313

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLP 356
           VNVHPAKS +RFR P + R+ I+  ++ A+ + G   SS ++   +S+     +     P
Sbjct: 314 VNVHPAKSEVRFREPGVARSLIVTGLRHALAEAGHRASSTVADATLSAMQPAYSEPPSEP 373

Query: 357 KYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEA-THYQLGIACAQIHQ 415
             A  +   Q     Q+   +    L    P +S  +  V+E+   +   LG A AQ+H+
Sbjct: 374 LAAPRIY--QMDRLGQQRGFAPVRGLEEAAPQWSAPSARVDEAVIDSDGPLGAARAQVHE 431

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           NYII+QT  G+V+VDQHAAHERL++E+++       +  Q LL PEI+  L  +   +++
Sbjct: 432 NYIIAQTPGGIVLVDQHAAHERLVYERLKTQMAERGVARQALLIPEIL-TLGADADRLLD 490

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           H  +L R G+  E FGP  +A+RE PAIL + N   LLRDI+DE+ D   + TLQ R+E 
Sbjct: 491 HAAELERFGLVIEAFGPGTVAVRETPAILGEINAEALLRDILDELSDLGDSQTLQARVEA 550

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +L+ +AC+GSIRSGR+M++ EMN LLREME  P S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 551 VLSRVACHGSIRSGRQMRADEMNALLREMEATPLSGQCNHGRPTYVELKLADIERLFGR 609


>gi|254486044|ref|ZP_05099249.1| DNA mismatch repair protein MutL [Roseobacter sp. GAI101]
 gi|214042913|gb|EEB83551.1| DNA mismatch repair protein MutL [Roseobacter sp. GAI101]
          Length = 613

 Score =  522 bits (1344), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 257/606 (42%), Positives = 385/606 (63%), Gaps = 22/606 (3%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA + ++    A GGK+  ++TD+G G
Sbjct: 15  IRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGARQITVEYADGGKTLIRVTDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           + + ++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR    + GA+I
Sbjct: 75  IPAVDLPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLTITSRVAGQD-GAEI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            ++G +   VRP A+N GT+V +RDLFF  PARL FL++++ E   I D+I+R+A+A P 
Sbjct: 134 TVNGGQTGPVRPAALNGGTVVTLRDLFFATPARLKFLRTDRAEAQAIADIIKRLAMAEPF 193

Query: 182 VSFTFSTIKSN---RYKMNFQSTNGN----FPERISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT   +  +   R     ++  G+       R++QV+G +F +N++ ++ +   + L 
Sbjct: 194 VRFTLRDVSGDGQGRDVFRAEAEQGDMFAALHGRLAQVLGREFADNSLPIDAEREGLHLT 253

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           G+  +PT++RG A   Y+F+NGR V+DK ++  +R AY + +   R+P   L L+  P  
Sbjct: 254 GFAALPTYSRGTAVAQYLFVNGRPVRDKLLVGALRGAYFDLLSRDRHPAAALFLDCAPTL 313

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH--QDNAPK 352
           VDVNVHPAKS +RFR+P + R  I+  ++ A+   G   S+ ++   + +    Q  A  
Sbjct: 314 VDVNVHPAKSEVRFRDPGLARGLIVSGLRHALADAGHRASTTVADATLGAMRPEQTGARV 373

Query: 353 THLPKYA----TSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGI 408
             + + +    T+    Q   F +   +      P+   T        E  E   Y LG 
Sbjct: 374 YQMDRPSLGARTAAYQAQSPGFAETAGMWGRVETPAAPVTE-------EPQETPDYPLGT 426

Query: 409 ACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEG 468
           A  Q+H+NYII+QT  G+VIVDQHAAHERL++EK+++      + +Q LL PEI+DL   
Sbjct: 427 ARGQVHENYIIAQTATGMVIVDQHAAHERLVYEKLKRQMAENGVAAQALLIPEIVDLSAS 486

Query: 469 ECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYT 528
           +CA +++  ++L RLG+  E FG +AIA+RE PAIL   N   ++ D++DE+ D + + T
Sbjct: 487 DCARLLDVADELTRLGLTIEAFGGSAIAVRETPAILGTVNAKAMILDVLDELADQNESNT 546

Query: 529 LQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDI 588
           +Q RIE IL+ +AC+GSIRSGR M+  EMN LLREME  P+S QCNHGRPT+++LKLSDI
Sbjct: 547 VQARIEAILSRVACHGSIRSGRWMRGEEMNALLREMEATPHSGQCNHGRPTYVELKLSDI 606

Query: 589 EKLFGR 594
           E+LFGR
Sbjct: 607 ERLFGR 612


>gi|163734247|ref|ZP_02141687.1| DNA mismatch repair protein [Roseobacter litoralis Och 149]
 gi|161392255|gb|EDQ16584.1| DNA mismatch repair protein [Roseobacter litoralis Och 149]
          Length = 610

 Score =  521 bits (1342), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 255/611 (41%), Positives = 391/611 (63%), Gaps = 35/611 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  +N+IAAGE++ERP+ AIKEL+EN+LDA + ++      GGK+  ++ D+G G
Sbjct: 15  IRQLDEGAVNRIAAGEVVERPASAIKELVENALDAGARKIAIDYGDGGKTLIRVQDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT+ ++P+A+ RH TSKI   D  NI TFGFRGEALPS+ AV  LT+++R    + G + 
Sbjct: 75  MTANDLPLALSRHATSKIDGSDLLNIQTFGFRGEALPSLAAVGRLTIVTRA-DGDDGVEA 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            ++G     ++P A NPGT V +RDLF+  PARL FL+S++ E   I+DV++R+A+A P 
Sbjct: 134 TVAGGTEKPLKPAACNPGTTVTIRDLFYATPARLKFLRSDRAEAQAISDVVKRLAMAEPF 193

Query: 182 VSFTFSTIKSNR-----YKMNFQSTN--GNFPERISQVIGEDFINNAVELNEKSNEITLQ 234
           V F    +  +      ++ + Q  +  G    R+++V+G +F  N++ ++ +   + L 
Sbjct: 194 VQFVLRDVSGDGPGREVFRADAQQGDLFGALHGRLARVLGREFAENSLAIDAEREGLHLT 253

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           G+  +PT++RG+A   Y+F+NGR V+DK ++  +R AY++ +   R+P   L L+ DP+ 
Sbjct: 254 GFAALPTYSRGSAVAQYLFVNGRPVKDKLLVGALRGAYSDFLSRDRHPAAALFLDCDPKL 313

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISS---------- 344
           VDVNVHPAKS +RFR+P I R  I+ +++ A+ + G   S+ +S   + +          
Sbjct: 314 VDVNVHPAKSEVRFRDPGIARGLIVSALRHALAEAGHRASTTVSTATLGAMQPEPIGARV 373

Query: 345 FHQDNAPKTHLPKYATSL-TNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATH 403
           +  D+A +   P  A  L T   +++     R++  D      P     ++PV+      
Sbjct: 374 YQMDHASR---PMSAPPLQTPAFQEVAAPWGRVAETD------PDGETADEPVD------ 418

Query: 404 YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEII 463
           Y LG A  Q+H+NYII+QT  G+VIVDQHAAHERL++EK+++      + SQ LL PEI+
Sbjct: 419 YPLGAARGQVHENYIIAQTATGMVIVDQHAAHERLVYEKLKRQMAENGVASQALLIPEIV 478

Query: 464 DLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDS 523
           +L   +CA +M   +DL +LG+  E FG +AIA+RE PAIL   +   L+ DI+DE+ D 
Sbjct: 479 ELSAADCASLMHVADDLAQLGLVVEPFGGDAIAVRETPAILGLVDARALILDILDELADQ 538

Query: 524 STTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKL 583
           +T+  ++ RI+ IL+ +AC+GSIRSGR M++ EMN LLR+ME  P+S QCNHGRPT+++L
Sbjct: 539 NTSDNIRQRIDAILSRVACHGSIRSGRWMKTEEMNALLRDMEATPHSGQCNHGRPTYVEL 598

Query: 584 KLSDIEKLFGR 594
           KLSDIE+LFGR
Sbjct: 599 KLSDIERLFGR 609


>gi|110678039|ref|YP_681046.1| DNA mismatch repair protein [Roseobacter denitrificans OCh 114]
 gi|109454155|gb|ABG30360.1| DNA mismatch repair protein, putative [Roseobacter denitrificans
           OCh 114]
          Length = 610

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 255/616 (41%), Positives = 385/616 (62%), Gaps = 45/616 (7%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  +N+IAAGE++ERP+ AIKEL+EN+LDA + ++      GGK+  ++ D+G G
Sbjct: 15  IRQLDEGAVNRIAAGEVVERPASAIKELVENALDASARKIAIDYGDGGKTLIRVQDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT+ ++P+A+ RH TSKI   D  NI TFGFRGEALPS+ AV  LT+++R    + G + 
Sbjct: 75  MTATDLPLALSRHATSKIDGSDLLNIQTFGFRGEALPSLAAVGRLTIVTRA-GGDDGVEA 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           ++SG     ++P A NPGT V +RDLF+  PARL FL+S++ E   I DV++R+A+A P 
Sbjct: 134 SVSGGDEKPLKPAACNPGTTVTIRDLFYATPARLKFLRSDRAEAQAIIDVVKRLAMAEPF 193

Query: 182 VSFTFSTIKSNR-----YKMNFQSTN--GNFPERISQVIGEDFINNAVELNEKSNEITLQ 234
           V F    +  +      ++ + Q  +  G    R+++V+G +F  NA+ ++ +   + L 
Sbjct: 194 VQFVLRDVSGDGPGREVFRADAQQGDLFGALHGRLARVLGREFAENALAIDAEREGLHLT 253

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           G+  +PT++RG+A   Y F+NGR V+DK ++  +R AY++ +   R+P   L L+ DP+ 
Sbjct: 254 GFAALPTYSRGSAVAQYFFVNGRPVKDKLLVGALRGAYSDFLSRDRHPAAALFLDCDPKL 313

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD------ 348
           VDVNVHPAKS +RFR+P I R  I+ +++ A+ + G   S+ +S   + +   +      
Sbjct: 314 VDVNVHPAKSEVRFRDPGIARGLIVSALRHALAEAGHRASTTVSTATLGAMQPEPIGARV 373

Query: 349 ----------NAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE 398
                     +AP    P +        +++     R++  D    D+ T  +  D    
Sbjct: 374 YQMDQASRPVSAPPPQTPAF--------QEVAAPWGRVAETD---PDEQTAGDPGD---- 418

Query: 399 SEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLL 458
                Y LG A  Q+H+NYII+QT  G+VIVDQHAAHERL++EK+++      + SQ LL
Sbjct: 419 -----YPLGAARGQVHENYIIAQTATGMVIVDQHAAHERLVYEKLKRQMAENGVASQALL 473

Query: 459 TPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIID 518
            PEI++L   +CA +M+  +DL RLG   E FG +AIA+RE PAIL   +   L+ DI+D
Sbjct: 474 IPEIVELSAADCASLMQISDDLARLGFVVEPFGGDAIAVRETPAILGVVDARALILDILD 533

Query: 519 EIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRP 578
           E+ D + +  ++ RI+ IL+ +AC+GSIRSGR M++ EMN LLREME  P+S QCNHGRP
Sbjct: 534 ELADQNASENIRMRIDAILSRVACHGSIRSGRWMKTEEMNALLREMEATPHSGQCNHGRP 593

Query: 579 TFIKLKLSDIEKLFGR 594
           T+++LKLSDIE+LFGR
Sbjct: 594 TYVELKLSDIERLFGR 609


>gi|114705763|ref|ZP_01438666.1| DNA mismatch repair protein [Fulvimarina pelagi HTCC2506]
 gi|114538609|gb|EAU41730.1| DNA mismatch repair protein [Fulvimarina pelagi HTCC2506]
          Length = 641

 Score =  517 bits (1332), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 255/643 (39%), Positives = 398/643 (61%), Gaps = 51/643 (7%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I +L E +I+QIAAGE++ERP+  +KEL+EN+LDA + R++   AGGGK+  ++TD+G
Sbjct: 1   MPIVQLDEFLIDQIAAGEVVERPASVVKELLENALDAGARRIQIATAGGGKTLIRVTDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+  +E+ +AV+RHCTSK++     I + GFRGEALPSIG+V+ L+L SR    +   +
Sbjct: 61  RGVPKDELRLAVKRHCTSKLAGGLDKIMSLGFRGEALPSIGSVARLSLASRAEGASEAFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + +   +     P  ++ GT VEVRDLF ++PARL FLKS++ E + ITD++RR AIA+P
Sbjct: 121 VKVEAGRCDGPMPAGLSKGTTVEVRDLFQSVPARLKFLKSDRAEASAITDIVRRSAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFP-ERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            V F  S    +R ++  ++   + P  RIS V+G+DF +NAV +     ++ L G+ G+
Sbjct: 181 GVRFELS--GPDRSRLVLEAAAPDDPLARISDVVGKDFADNAVAIEAVREDVYLSGFAGL 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+F+RGN+   Y ++NGR V+D  ++S ++ AY++ +  GRYPV  L +E+DP  VDVNV
Sbjct: 239 PSFDRGNSLAQYFYVNGRPVRDWMLVSALQGAYSDMMAKGRYPVAALFVELDPALVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD--NAPKTHLPK 357
           HPAK+ +RFR+P ++R  I+ +I++A+  +G+  S+V +  +++ F       P+    +
Sbjct: 299 HPAKADVRFRDPQLVRGLIVGAIREAMATEGVRGSTVAASGLMARFSAGPKREPQEQAGR 358

Query: 358 Y------ATSLTNTQEKLFLQEN----RLSTNDLLPSDDPT------------------- 388
           +      A  +     + F   N      +   + P D  +                   
Sbjct: 359 FDGFSPGAPDIAMKPRQSFGASNLAGYEATKRPMTPFDPASAAYRPFEAGAFTETTDRQV 418

Query: 389 ---YSEDND-PVEESEATH-------------YQLGIACAQIHQNYIISQTTDGLVIVDQ 431
              ++ED   P +   AT              Y LG A AQ+ +N+I+++T DGLV+VD 
Sbjct: 419 SSGFAEDGQTPFDAGLATEVFAGTADAAVVKSYPLGAAKAQLFENFILAETKDGLVLVDG 478

Query: 432 HAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFG 491
           HAAHERL++E+++   + T+I SQ LL PEI+DL EG+   + E  E    LG+  ERFG
Sbjct: 479 HAAHERLVYERLKAALHGTQIASQMLLIPEIVDLSEGDADRLAEASEAFSVLGLHLERFG 538

Query: 492 PNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRK 551
           P AIA+RE PAIL + +  +L++D+ +E+ +  T  +++ RI+++ AT+AC+GS+R+GR+
Sbjct: 539 PGAIAVRETPAILGQCDAKRLVKDLAEELAEFGTGDSVRSRIDSVAATIACHGSVRTGRR 598

Query: 552 MQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ++  EMN LLREME  P S  CNHGRPTFI+LK +D+E LF R
Sbjct: 599 LKPEEMNALLREMEVTPGSGTCNHGRPTFIELKRADLEALFKR 641


>gi|260574506|ref|ZP_05842510.1| DNA mismatch repair protein MutL [Rhodobacter sp. SW2]
 gi|259023402|gb|EEW26694.1| DNA mismatch repair protein MutL [Rhodobacter sp. SW2]
          Length = 605

 Score =  515 bits (1326), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 254/605 (41%), Positives = 397/605 (65%), Gaps = 31/605 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+EN+LDA + R+   +A GGK+  +++D+G G
Sbjct: 18  IRQLDEAAINRIAAGEVVERPASAVKELVENALDAGALRIGIDVADGGKTLIRVSDDGCG 77

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT+ ++P+A+ RH TSKI   D  NIH+FGFRGEALPS+GAV  LTL SR       A +
Sbjct: 78  MTAADLPLALSRHATSKIDGSDLLNIHSFGFRGEALPSLGAVGRLTLTSRA-AGAEAATL 136

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           ++ G ++++VRP A+  GT+VE+RDLFF  PARL F+++++ E   I DV++R+A+A P+
Sbjct: 137 SVEGGRMAAVRPAALTRGTVVELRDLFFATPARLKFMRTDRAEMQAIADVVKRLALAQPQ 196

Query: 182 VSFTFSTIKSNRYKMNFQSTN--GNFPE----RISQVIGEDFINNAVELNEKSNEITLQG 235
           V FT   +     ++ F++    G+F +    R+++V+G DF  NA+ ++   + + L G
Sbjct: 197 VGFTLRDVSGGEGRLLFRADPEPGDFFDALHGRVARVLGADFAENALRIDVAHDGLRLLG 256

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y  +PT++RG++   ++F+N R V D+ +   +R  Y + +   R+P  VL L+ DP+QV
Sbjct: 257 YAALPTYSRGSSVAQFLFVNSRPVLDRQLFGALRAGYMDVLSRDRHPAAVLNLQCDPQQV 316

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF------HQDN 349
           DVNVHPAK+ +RFR P ++R  ++  +++A+   G   S+ ++ + +++F      +Q +
Sbjct: 317 DVNVHPAKAEVRFREPALVRGLVVSGLRQALAAAGHRASTTVAGETLTAFRPEPRIYQMD 376

Query: 350 APKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIA 409
            P    P  A +L + Q   F +  +    +  P+ D    E   P          LG A
Sbjct: 377 RPSQ--PTLAQAL-HWQAPGFAEAPQARFEEQAPASD----EPPRP----------LGAA 419

Query: 410 CAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGE 469
            AQ+H+NYII+QT  G+VIVDQHAAHERL++++++   +S+ I +Q LL PEI+ L   +
Sbjct: 420 KAQLHENYIIAQTASGMVIVDQHAAHERLVYQRLKAQRDSSGIAAQALLIPEIVSLSPAD 479

Query: 470 CALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTL 529
            + +++   DL  LG+  E FG NA+A+RE PAIL + +   LLRDI+D++ D   +  +
Sbjct: 480 ASRLLDAAADLAALGLVIEPFGGNAVAVRETPAILGRVDAQALLRDILDDLADLGDSTRV 539

Query: 530 QDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIE 589
           Q R++ +L+ MAC+GS+RSGR+M++ EMN LLREME  P S QCNHGRPT+++LKL+DIE
Sbjct: 540 QARMDAVLSRMACHGSVRSGRQMRAEEMNALLREMEATPLSGQCNHGRPTYVELKLADIE 599

Query: 590 KLFGR 594
           +LFGR
Sbjct: 600 RLFGR 604


>gi|297184024|gb|ADI20144.1| DNA mismatch repair enzyme (predicted ATPase) [uncultured alpha
           proteobacterium EB080_L06A09]
          Length = 611

 Score =  512 bits (1318), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 266/610 (43%), Positives = 388/610 (63%), Gaps = 32/610 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+LS+   N+IAAGE++ERPS AIKEL+ENS+DA +SR++   + GGK+  ++ D+G G
Sbjct: 15  IRQLSDAAANRIAAGEVVERPSSAIKELVENSIDAGASRIDISYSDGGKTLIRVKDDGHG 74

Query: 63  MTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           +   ++ +A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR      GA I
Sbjct: 75  IAENQLLLALSRHATSKIDGTDLLNIHTFGFRGEALPSMGAVGRLTITSRIQDVAMGATI 134

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            + G  I  VRP     GT+VE+RDLF   PARL FL++++ E   I+DVI+R+A++ P 
Sbjct: 135 TVDGGLIGRVRPAPSTIGTVVELRDLFHATPARLKFLRTDRAEAGAISDVIKRLAMSEPF 194

Query: 182 VSFTFSTIKSN---RYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
            +FT   +      R         G+  +    R+S+V+G DF  N+  ++   + +TL 
Sbjct: 195 KAFTLRDVTGGGDGRIIFRADPETGDLFDAMYGRLSKVLGVDFAKNSFRVDADRDGMTLT 254

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT+++G++   ++F+NGR+V+DK +LS +R AY++ +  GRYPVV L +E D  +
Sbjct: 255 GYASLPTYSKGSSVSQFIFVNGRSVKDKNLLSALRAAYSDFLHSGRYPVVALFIECDFER 314

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAK+ +RFR P   R  +I  ++ A+ ++G   SS ++   + +F         
Sbjct: 315 VDVNVHPAKAEVRFREPGTARGLVISGLRHALAEEGHRASSTIADATLGAF--------- 365

Query: 355 LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSE----------DNDPVEESEATHY 404
             K +  + N+      Q   +      P D   +SE          DN+ + E  +   
Sbjct: 366 --KKSGDINNSSNLRMSQSWSMEVPRHHP-DQVGFSEIQNDFSSRQLDNENIIEQISN-- 420

Query: 405 QLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIID 464
           +LG A AQIH+NYI+SQT DGLVIVDQHAAHERL++EK++       +++QTLL PEII+
Sbjct: 421 KLGAARAQIHENYILSQTFDGLVIVDQHAAHERLVYEKLKNQMAMNGVSAQTLLIPEIIE 480

Query: 465 LLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSS 524
           L E + A +ME   +L+  G+  E FG N+I +RE PAIL + N   L+ DI+DE+ D S
Sbjct: 481 LSEQDAAELMEISGELNGFGLNIENFGGNSIIVRETPAILGEVNAKNLILDILDELKDWS 540

Query: 525 TTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLK 584
            +  ++++++ IL+ +AC+GSIRSGR M+  EMN LLREME  P+S QCNHGRPT+++LK
Sbjct: 541 QSNIVKEKLDAILSRVACHGSIRSGRIMKVEEMNALLREMEATPHSGQCNHGRPTYVELK 600

Query: 585 LSDIEKLFGR 594
           L+DIEKLFGR
Sbjct: 601 LNDIEKLFGR 610


>gi|163794888|ref|ZP_02188857.1| DNA mismatch repair protein [alpha proteobacterium BAL199]
 gi|159179707|gb|EDP64234.1| DNA mismatch repair protein [alpha proteobacterium BAL199]
          Length = 620

 Score =  511 bits (1315), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 243/611 (39%), Positives = 379/611 (62%), Gaps = 24/611 (3%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           +R+L E ++N+IAAGE++ERP+ A+KEL+ENSLDA + RV+ V+  GG++  Q++D+G G
Sbjct: 14  VRRLPETLVNRIAAGEVVERPASALKELVENSLDAGARRVDVVLRDGGRTLIQVSDDGHG 73

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           +  + + +AV+RH TSK+  DD ++I T GFRGEALPSIGAVS L++ SR        +I
Sbjct: 74  LDPDTLSLAVERHATSKLPDDDLTHISTLGFRGEALPSIGAVSRLSITSRAAGAPAAWRI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            + G  + +  P A+  GT VE+RDLF+  PARL FLK  + E +   ++++R+A+A P 
Sbjct: 134 RVEGGAVGAPEPAALTAGTRVEIRDLFYATPARLKFLKIPRTEQSHALEILQRLAMAAPT 193

Query: 182 VSFTFSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQGYT 237
           V FT S     R  +N ++  G+  E    R+  V+G DF  +A+ ++ +     L GY 
Sbjct: 194 VGFTLS--DGTRTLLNLEAAQGDLFEVRLARLGAVLGRDFAADALPIDAERQGYRLTGYA 251

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PT +R  +   Y+F+NGR V+D+ +L  +R AY + +   R+P++ L LE+   +VDV
Sbjct: 252 GLPTLHRRTSAHQYLFVNGRPVRDRLLLGAVRGAYMDFVASDRHPMLALFLELPAEEVDV 311

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDN--APKTHL 355
           NVHPAK+ +RFR+  ++R  I+ +++ A+ + G   S+ +    + +F  D   A   H 
Sbjct: 312 NVHPAKTEVRFRDAGLVRGLIVGALKHALAEAGHRASASVGAATLGAFRPDGLRAHTGHA 371

Query: 356 -PKYATSLTNTQEKLFLQENRLSTNDLLPSDD-----------PTYSEDNDPVEESEATH 403
            P + T+         L E + +     PS D           P    +N P +   A  
Sbjct: 372 APAWNTARWTPPPSEGLAEAQAAWQ--APSTDRVGHTLDFGAAPAARVENAPADPV-AER 428

Query: 404 YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEII 463
           + LG A AQ+H  YI++QT DGLVIVDQHAAHERL++E+M+       + SQ LL PE++
Sbjct: 429 HPLGAARAQVHGTYIVAQTEDGLVIVDQHAAHERLVYERMKDALAVGGVKSQALLLPEVV 488

Query: 464 DLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDS 523
           +L E     +++  ++   LG+  E FG  A+ +RE+PA+L K +   L+RD+ D++ + 
Sbjct: 489 ELEEAAVDRLVQRADEFAELGLVLEAFGQGAVVVREVPALLGKTDTAALIRDLADDLAEV 548

Query: 524 STTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKL 583
              + L+DR+ ++  TMAC+GS+R+GR++   EMN LLR+ME  P+S QCNHGRPT+++L
Sbjct: 549 GDAHALKDRLADVCGTMACHGSVRAGRRLSGDEMNALLRQMEATPHSGQCNHGRPTYVEL 608

Query: 584 KLSDIEKLFGR 594
           KL+DIE+LFGR
Sbjct: 609 KLTDIERLFGR 619


>gi|27382604|ref|NP_774133.1| DNA mismatch repair protein [Bradyrhizobium japonicum USDA 110]
 gi|81841408|sp|Q89DE6|MUTL_BRAJA RecName: Full=DNA mismatch repair protein mutL
 gi|27355776|dbj|BAC52758.1| DNA mismatch repair protein [Bradyrhizobium japonicum USDA 110]
          Length = 603

 Score =  511 bits (1315), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 245/611 (40%), Positives = 381/611 (62%), Gaps = 26/611 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E+++N+IAAGE++ERP+  +KEL+EN++DA +SR++    GGG+    ITD+G
Sbjct: 1   MPVRQLPEQVVNRIAAGEVVERPASVVKELVENAIDAGASRIDVFTDGGGRRRIGITDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT++++ +AV+RH TSK+ D D   I T GFRGEALPSIG+V+ L++ +R        
Sbjct: 61  SGMTAKDLALAVERHATSKLDDEDLLQIRTLGFRGEALPSIGSVARLSITTRHAGEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + + G + S + P A+  GT VEV DLF+  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 ALTVEGGEKSEIMPAALAHGTRVEVNDLFYATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSN--RYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P V+FT +  +     +        G    R+  ++G +F ++A+E++ +   I + GY 
Sbjct: 181 PDVAFTLAGEERAPVTWAAALPGAAGRL-TRLGDILGAEFRSHAIEVHAEREGIVVSGYA 239

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
             P   + NA   Y+F+NGR V+DK IL  +R AY++ +P  R+PV+ L + +DPR+VD 
Sbjct: 240 AAPALTKANALGQYLFVNGRPVRDKLILGAVRAAYSDYLPRDRHPVLALFVTLDPREVDA 299

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH----------- 346
           NVHPAK+ +RFRN  ++R  I+  +++A+ ++G  T++   +  +SSF            
Sbjct: 300 NVHPAKTEVRFRNAGLVRALIVHGLKEALAREGRRTAANSGESALSSFRPAFTPRPASWD 359

Query: 347 ---QDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATH 403
                +AP   +P    S        F +  + + +   PS D  +  +  PV  S+   
Sbjct: 360 WRASPSAPVAPMP----SFDGAAAPAFTERAQAAFDVGAPSADVRF--ETQPV--SDLVD 411

Query: 404 YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEII 463
             LG A  QIH+ YI+SQT DGL+IVDQHAAHER+++E ++    +  +  Q LL PEI+
Sbjct: 412 RPLGAARTQIHETYIVSQTRDGLIIVDQHAAHERIVYEGLKASLAANGVQRQILLIPEIV 471

Query: 464 DLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDS 523
           ++ E     ++E  ++L   G+  E FGP A+A+RE P++L K N   LLRD+ + + + 
Sbjct: 472 EMDEATVERLLERSDELASFGLAIESFGPGAVAVRETPSLLGKTNAGGLLRDLSEHMAEW 531

Query: 524 STTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKL 583
                L+ R+ ++ ATMAC+GS+R+GR+++  EMN LLREME+ PNS QCNHGRPT+++L
Sbjct: 532 DEALPLERRLMHVAATMACHGSVRAGRRLRPEEMNALLREMEETPNSGQCNHGRPTYVEL 591

Query: 584 KLSDIEKLFGR 594
           KLSD+EKLFGR
Sbjct: 592 KLSDVEKLFGR 602


>gi|209966848|ref|YP_002299763.1| DNA mismatch repair protein MutL, putative [Rhodospirillum centenum
           SW]
 gi|209960314|gb|ACJ00951.1| DNA mismatch repair protein MutL, putative [Rhodospirillum centenum
           SW]
          Length = 617

 Score =  510 bits (1313), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 250/615 (40%), Positives = 384/615 (62%), Gaps = 25/615 (4%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           +R+L E+++N+IAAGE++ERP+ A+KEL+EN+LDA +SR+E V+  GGK+   + D+G G
Sbjct: 4   LRRLPERLVNRIAAGEVVERPAAAVKELVENALDAGASRIEVVLRDGGKALIGVADDGCG 63

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M  EE+ +AV+RH TSK+  DD ++I T GFRGEALPSIGAVS L++ SRP   ++   I
Sbjct: 64  MAPEELELAVERHATSKLPDDDLTHIRTLGFRGEALPSIGAVSRLSITSRPRGADSAHAI 123

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            + G     V P A   GT +EVRDLF+  PARL FLK  + E+    D + R+A+A+P 
Sbjct: 124 LVEGGAKGPVMPAAGGIGTRIEVRDLFYATPARLKFLKGNRTESEHARDAVERLAMAHPH 183

Query: 182 VSFTFSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQGYT 237
           V+F  +     R  +   +  G+  E    R+  V+G +F  NA+ ++     + L G+ 
Sbjct: 184 VTFLLT--DEGRTPLRLPAATGDLMEARLVRLGAVLGREFQENALPVDAARGPVRLVGHI 241

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PT NR  A   Y+F+NGR V+D+ ++  +R AYA+ +   R+P++ L LE+ P +VDV
Sbjct: 242 GLPTLNRPTAAGQYLFVNGRPVKDRLLVGAVRGAYADFLARDRHPMLALFLELPPEEVDV 301

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAP-----K 352
           NVHPAK+ +RFR+  ++R  I+ +++ A+ + G   S+ ++   ++SF   +AP     +
Sbjct: 302 NVHPAKTEVRFRDQALVRGLIVGALKHALAQAGHRASTGVAAAALASFAPHDAPLPPPVQ 361

Query: 353 THLP--KYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDND------PVEESEATH- 403
           + LP  + A           L E  ++ N  LP      S   D      PVE +  T  
Sbjct: 362 SALPWQRPAGGFAPAAVPRGLAEMAMAFNAPLPGSPVPASAPPDGLHPAAPVEATTGTEP 421

Query: 404 ---YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTP 460
              + LG A AQ+H  YI++QT DG+VIVDQHAAHERL++E+M+ D  +  +  Q LL P
Sbjct: 422 ARAFPLGAARAQLHTTYIVAQTEDGIVIVDQHAAHERLVYERMKHDLLAGGVKRQGLLIP 481

Query: 461 EIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAIL-SKKNIPQLLRDIIDE 519
           E+++L   +   + E   +L  LG+  E FG   + +RE+PA+L ++ ++  L+RD+ DE
Sbjct: 482 EVVELDPADAERLGERAAELAELGLVLEPFGTGCVVVREVPALLGARADVRGLVRDLADE 541

Query: 520 IIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPT 579
           + +      L++R+E + + MAC+GS+R+GR M + EMN LLR+ME  P+S QCNHGRPT
Sbjct: 542 LAELGDALALKERLEAVCSRMACHGSVRAGRPMNADEMNALLRQMEATPHSGQCNHGRPT 601

Query: 580 FIKLKLSDIEKLFGR 594
           +++LKL+DIE+LFGR
Sbjct: 602 YVELKLADIERLFGR 616


>gi|84501416|ref|ZP_00999621.1| DNA mismatch repair protein [Oceanicola batsensis HTCC2597]
 gi|84390707|gb|EAQ03195.1| DNA mismatch repair protein [Oceanicola batsensis HTCC2597]
          Length = 597

 Score =  509 bits (1312), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 246/598 (41%), Positives = 371/598 (62%), Gaps = 25/598 (4%)

Query: 20  IERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTSEEIPMAVQRHCTSK 79
           +ERP+ A+KEL+EN+LDA + R+E  +A GGKS  ++ D+G G+ +E +P+A+ RH TSK
Sbjct: 1   MERPASAVKELVENALDAGARRIEITLAEGGKSLIRVKDDGCGIPAEALPLALARHATSK 60

Query: 80  I-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAISGEKISSVRPVAMNP 138
           I   D  NIHTFGFRGEALPS+GAV  L + +R     T A+IA+SG ++  VRP A++ 
Sbjct: 61  IDGSDLLNIHTFGFRGEALPSLGAVGRLRITTRV-AGATAAEIAVSGSRMGEVRPAALSG 119

Query: 139 GTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVSFTFSTIKSN---RYK 195
           GT+VE+RDLFF  PARL FL++++ ET  +TD+++R+A+A P V F    +      R  
Sbjct: 120 GTVVELRDLFFATPARLKFLRTDRAETQAVTDIVKRLAMAEPYVGFVLRDVSGGGEGRVT 179

Query: 196 MNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNRGNANQFY 251
                 +G+  +    R++ V+G +F  NA+ ++ +   + + GY  +PT++RG A   +
Sbjct: 180 FRADPESGDMFDALHGRLAAVLGREFAENALRIDAEREGLHMTGYAALPTYSRGAAVAQF 239

Query: 252 VFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSYIRFRNP 311
           +F+NGR V+DK +   +R AY + +   R+P   L ++ DP  VDVNVHPAKS +RFR+P
Sbjct: 240 LFVNGRPVRDKLLTGALRAAYMDVLSRDRHPAAALFIDCDPMLVDVNVHPAKSEVRFRDP 299

Query: 312 TIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL--------PKYATSLT 363
            + R  ++  ++ A+ + G   S+ ++   + +   + AP   +        P  A +  
Sbjct: 300 GLARGLVVSGLRHALAEAGHRASTTVAGATLGAMRPEPAPAGRVYQMDRPSGPARAMAYL 359

Query: 364 NTQEKL-------FLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQN 416
                         +Q+      D   +    Y E   P    E   + LG A AQ+H+N
Sbjct: 360 GQGPACPDPGVGGVVQDREPDGFDGFAAPSARY-EPAAPGPAPELEGHPLGAARAQVHEN 418

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEH 476
           YI++QT  G+VIVDQHAAHERL++EK++    +  + +Q LL PEI++L  G+CA + E 
Sbjct: 419 YIVAQTERGMVIVDQHAAHERLVYEKLKAQTAARGVPAQALLIPEIVELSAGDCARLTEA 478

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
             +L  LG+  E FG +A+A+RE PAIL + +   L+ DI+DE+ D   + TL+ RI+ I
Sbjct: 479 AGELGALGLTVEPFGGSAVAVRETPAILGEVDARALILDILDELTDGDDSTTLRARIDAI 538

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           L+ MAC+GS+RSGR+M+  EMN LLREME  P S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 539 LSRMACHGSVRSGRRMRIEEMNALLREMEATPMSGQCNHGRPTYVELKLADIERLFGR 596


>gi|83859480|ref|ZP_00953001.1| DNA mismatch repair protein MutL [Oceanicaulis alexandrii HTCC2633]
 gi|83852927|gb|EAP90780.1| DNA mismatch repair protein MutL [Oceanicaulis alexandrii HTCC2633]
          Length = 638

 Score =  509 bits (1312), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 253/634 (39%), Positives = 383/634 (60%), Gaps = 42/634 (6%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+LS + +N+IAAGE++ERP+ A+KEL+EN+LDA + R++  I GGG +   I D+G G
Sbjct: 4   IRRLSPETVNRIAAGEVVERPASAVKELVENALDAGAQRIDIRIEGGGLTRIVIEDDGSG 63

Query: 63  MTSEEIPMAVQRHCTSKI------SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNN 116
           M +E +  A++RH TSK+       DD  NIH+ GFRGEALPSIG+V+ L + ++  +  
Sbjct: 64  MDAEGLETAIERHATSKLPVGEDGQDDLLNIHSMGFRGEALPSIGSVARLNITTQDEELG 123

Query: 117 TGAQIAISGEKISSVRPVAM--NPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRR 174
              ++++ G   S  RP       GT VEV DLF+  PARL FLKSE+ E+  ++DVI+R
Sbjct: 124 GAWELSVEGGTKSGPRPAPSLGRRGTRVEVCDLFYATPARLKFLKSERAESTAVSDVIKR 183

Query: 175 MAIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPER---ISQVIGEDFINNAVELNEKSNEI 231
           +A+A P V F  S    +R     +ST      R   +S ++G DF  NA+ ++++   +
Sbjct: 184 LALARPDVGFFLSVDGRSRVSAPAESTEDRDEARRGRLSSILGADFGENALVIDQEREGV 243

Query: 232 TLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEID 291
            L G   +PT+NRG+    ++F+NGR V+DK I+  +R AY + +   R+PVV L +++ 
Sbjct: 244 HLTGLASLPTYNRGSNQHQFLFVNGRPVKDKLIVGAVRGAYQDFLARDRHPVVALYVDLP 303

Query: 292 PRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAP 351
              VDVNVHPAK+ +RFR+  ++R  I+ +++ A+   G   S+ ++   +     + AP
Sbjct: 304 SSHVDVNVHPAKAEVRFRDSGLVRGLIVGALRHALAGAGHRASTTVAGYALGRARPEGAP 363

Query: 352 KTHLP---------KYATSLTNTQEKLFLQENRLST---------------NDLLPS--- 384
              LP          +A   +   E    + +  S                 DL P    
Sbjct: 364 THALPLTRGSSISSGWANRPSPAWESQLSEHHETSGYGYGESQTEASQYGRGDLAPGMSA 423

Query: 385 -DDPTYS---EDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIF 440
             +P+Y     D  P  E+    + LG+A AQ+H  Y+I+QT DGLVIVDQHAAHERL++
Sbjct: 424 RTEPSYGGEPADGAPAAETHTPDFPLGVARAQVHATYVIAQTEDGLVIVDQHAAHERLVY 483

Query: 441 EKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREI 500
           E+M++    T +  Q LL PEI++L E E   +++  E L  LG+  E FGP A+A+RE 
Sbjct: 484 ERMKKQLADTGVARQALLVPEIVELDEAEARRVLDRAEQLAELGLVIEPFGPGALAVRET 543

Query: 501 PAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRL 560
           PA+L + ++  L+RD+ DEI +     +L++++E ++ TMAC+GS+RSGR++   EMN L
Sbjct: 544 PALLKRLDVQGLIRDLADEIAEYDEALSLKEKLEEVVGTMACHGSVRSGRRLTGDEMNAL 603

Query: 561 LREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LREME  P+S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 604 LREMEATPHSGQCNHGRPTYVELKLADIERLFGR 637


>gi|255263413|ref|ZP_05342755.1| mismatch repair protein MutL [Thalassiobium sp. R2A62]
 gi|255105748|gb|EET48422.1| mismatch repair protein MutL [Thalassiobium sp. R2A62]
          Length = 605

 Score =  509 bits (1311), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 250/609 (41%), Positives = 376/609 (61%), Gaps = 36/609 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++D+ + R++   A GGKS  ++ D+G G
Sbjct: 15  IRQLDDAAINRIAAGEVVERPASAVKELVENAVDSGARRIDVSYADGGKSLIRVVDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           + + ++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  L++ SR         I
Sbjct: 75  IEAADLPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLSITSR--ATGDAHVI 132

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            + G  +  VRP A++ GT VE+RDLF+  PARL F++S++ E   I DV++R+A+A P 
Sbjct: 133 KVEGGTMQPVRPAALSAGTTVELRDLFYATPARLKFMRSDRAEAQAIGDVVKRIAMAEPF 192

Query: 182 VSFTFSTIKSN---RYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           V+ T   +      R      +  G+  +    R+++V+G +F  N++ ++ +     L 
Sbjct: 193 VAITLRDVTGGGEGRVVFRADAEQGDLFDALHGRLARVLGREFAENSILVDTEREGFHLT 252

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG++   Y+F+NGR V+DK +   +R AY++ +   R+P   L ++ DP  
Sbjct: 253 GYAALPTYSRGSSVAQYLFVNGRPVRDKMLYGALRGAYSDFLSRDRHPAAALFIDCDPTL 312

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF--------- 345
           VDVNVHPAKS +RFR P I+R  I+  ++ A+   G   S+ ++   + +F         
Sbjct: 313 VDVNVHPAKSEVRFREPGIVRGLIVSGLRHALADAGHRASTTVAGATLGAFTPEPTGARV 372

Query: 346 HQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQ 405
           +Q + P       A       E+      R+        + P   E + P          
Sbjct: 373 YQMDRPTAGFAIAAQMAPQVFEEAAAVFARV-------DETPQVVEQDHP---------- 415

Query: 406 LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDL 465
           LG A  Q+H+NYII+QT DG+VIVDQHAAHERL++E+++       + +Q LL PEI++L
Sbjct: 416 LGAARGQVHENYIIAQTKDGMVIVDQHAAHERLVYERLKNQMAENGVAAQALLIPEIVEL 475

Query: 466 LEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSST 525
            E +C  +ME   DL +LG+  E FG  A+A+RE PAIL + N   +LRD++DE+ D   
Sbjct: 476 SESDCTRLMEVAGDLAKLGLTIEPFGGGAVAVRETPAILGEVNAEAMLRDVLDELDDVGD 535

Query: 526 TYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKL 585
           +  +Q +IE IL+ +AC+GSIRSGR M++ EMN LLREME  P+S QCNHGRPT+++LKL
Sbjct: 536 SQLVQAKIEAILSRVACHGSIRSGRWMRAEEMNALLREMEATPHSGQCNHGRPTYVELKL 595

Query: 586 SDIEKLFGR 594
           +DIE+LFGR
Sbjct: 596 ADIERLFGR 604


>gi|197106626|ref|YP_002132003.1| DNA mismatch repair protein MutL [Phenylobacterium zucineum HLK1]
 gi|238690138|sp|B4RA70|MUTL_PHEZH RecName: Full=DNA mismatch repair protein mutL
 gi|196480046|gb|ACG79574.1| DNA mismatch repair protein MutL [Phenylobacterium zucineum HLK1]
          Length = 622

 Score =  508 bits (1307), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 247/625 (39%), Positives = 385/625 (61%), Gaps = 35/625 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L  ++IN+IAAGE++ERP+ A+KEL+EN+LDA ++++E    GGG +   + D+G
Sbjct: 1   MPIRRLPPELINRIAAGEVVERPASAVKELVENALDAGATKIEVQADGGGLTRILVADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD------DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQ 114
            G+++EE+P+AV+RH TSK++       D   I T GFRGEALPSIG+V+ L++ SR  +
Sbjct: 61  CGLSAEELPVAVERHATSKLNPGEDGEYDLLRIGTLGFRGEALPSIGSVARLSIASRA-R 119

Query: 115 NNTGAQ-----IAISGEKISSVRPVAM-NP-GTIVEVRDLFFTIPARLNFLKSEQVETNL 167
              G+Q     I + G  + +V P A   P G  VEVRDLF+  PARL F+KSE+ E   
Sbjct: 120 KADGSQAEAHAIFVEGGAVGAVSPAAFPGPHGARVEVRDLFYATPARLKFMKSERAEALA 179

Query: 168 ITDVIRRMAIAYPKVSFTFST--IKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELN 225
           IT+ ++R A+A+  VSF       ++ R        +G    R+S ++G +F +NA+ ++
Sbjct: 180 ITEELKRQAMAHEAVSFALDVDGRRTLRLPAEAAGPDGRL-ARLSAIMGREFSDNALAID 238

Query: 226 EKSNEITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVV 285
            +   + L G+ G+PTFNRGNA   Y+F+NGR V+D+ +   +R AYA+ +   R+P+  
Sbjct: 239 HEREGVRLSGFAGLPTFNRGNAAHQYLFVNGRPVRDRLLQGALRAAYADFLARDRHPLAA 298

Query: 286 LLLEIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF 345
           L +E+DP QVDVNVHPAK+ +RFR+P ++R  I+  ++ A+   G   S+ +S   +  F
Sbjct: 299 LYVELDPSQVDVNVHPAKAEVRFRDPGLVRGLIVGGLRHALAAAGHRASTTVSMAALGGF 358

Query: 346 HQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPS-------DDP---------TY 389
              + P       A   +  ++  +      +   +LP         +P           
Sbjct: 359 RPQSMPPPQ--PSAAGFSAWRQGGWTPSPAAAAAQILPGLSEVSARAEPEALDAYAAGGM 416

Query: 390 SEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
           +E   P    +   Y LG A AQ+H+ YI++QT DG+VIVDQHAAHERL++E+M+ +   
Sbjct: 417 AEAASPAPVFDPVDYPLGAARAQVHETYIVAQTRDGVVIVDQHAAHERLVYERMKAEMAE 476

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             +  Q LL PE+++L   E   ++   ++L  LG+  E FGP A+ +RE+PA+L + + 
Sbjct: 477 GGVARQALLLPEVVELDPAEAERVVARADELAALGLVVEAFGPGAVLVREVPALLGETDA 536

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
             L+RDI D++ ++     L++R+E +  TMAC+GS+R+GR++ + EMN LLR+ME  P+
Sbjct: 537 AGLVRDIADDLSENGQALALKERLEEVCGTMACHGSVRAGRRLTAPEMNALLRQMEATPH 596

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 597 SGQCNHGRPTYVELKLADIERLFGR 621


>gi|299134224|ref|ZP_07027417.1| DNA mismatch repair protein MutL [Afipia sp. 1NLS2]
 gi|298590971|gb|EFI51173.1| DNA mismatch repair protein MutL [Afipia sp. 1NLS2]
          Length = 598

 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 239/602 (39%), Positives = 380/602 (63%), Gaps = 13/602 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E+I+N+IAAGE++ERP+ A+KEL+EN++DA  +R++    GGG+    ITD+G
Sbjct: 1   MPVRQLPEQIVNRIAAGEVVERPASAVKELVENAIDAGGTRIDIFTEGGGRRRIAITDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT  ++ +AV+RH TSK+ D D   I T GFRGEALPSIG+V+ L + +R        
Sbjct: 61  SGMTRGDLALAVERHATSKLDDEDLLRIRTLGFRGEALPSIGSVAKLAITTRHANEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + +     S + P A+  GT VEV DLF+  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 ALQVDAGTKSGIAPAALAHGTRVEVNDLFYATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSN--RYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P ++FT +  +     +        G    R+  ++G DF  +A+E++ +   ++++G+ 
Sbjct: 181 PDIAFTLAGEERAPVTWAAALPGAAGRL-TRLGDILGSDFRTHAIEVSAEREGVSVEGFA 239

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
             P+  R NA   Y+F+NGR V+DK IL  +R AYA+ +P  R+P+V L + +DP++VD 
Sbjct: 240 AAPSLTRANALGQYLFVNGRPVRDKLILGAVRAAYADYLPRDRHPIVALFVTLDPQEVDA 299

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMIS-SFHQDNAPKTHLP 356
           NVHPAK+ +RFRN  ++R  I+ ++++ + ++G  T++  +   I+ +FH+++ P++   
Sbjct: 300 NVHPAKTEVRFRNAGLVRALIVHALKEGLAREGRRTAANTNGAAITTAFHREDLPRSGYD 359

Query: 357 KYATSLT----NTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQ 412
             ++             F +  + + +   PS D      + P+  SEA +  LG A  Q
Sbjct: 360 WRSSPAAPFAPRASAMAFAEAPQAAFDAYTPSAD--ARGHDAPL--SEAVNQPLGAARTQ 415

Query: 413 IHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECAL 472
           +H+NYI++QT DGL++VDQHAAHER+++E+++       +  Q LL PEI+++ E     
Sbjct: 416 LHENYIVAQTNDGLILVDQHAAHERIVYERLKASLEKNGVQRQMLLIPEIVEMDEAVVEK 475

Query: 473 IMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDR 532
           ++    +L + G+  E FGP A+A+RE P++L K N   LLRD+ + + +      L+ R
Sbjct: 476 LLARTGELEKYGLAIESFGPGAVAVRETPSLLGKTNAASLLRDLAEHMAEWDEALPLERR 535

Query: 533 IENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLF 592
           + ++ ATMAC+GS+RSGR ++  EMN LLREME  PNS QCNHGRPT+++LKL+DIEKLF
Sbjct: 536 LMHVAATMACHGSVRSGRILKVEEMNALLREMEATPNSGQCNHGRPTYVELKLADIEKLF 595

Query: 593 GR 594
           GR
Sbjct: 596 GR 597


>gi|91978493|ref|YP_571152.1| DNA mismatch repair protein [Rhodopseudomonas palustris BisB5]
 gi|123166645|sp|Q131I8|MUTL_RHOPS RecName: Full=DNA mismatch repair protein mutL
 gi|91684949|gb|ABE41251.1| DNA mismatch repair protein MutL [Rhodopseudomonas palustris BisB5]
          Length = 597

 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 244/603 (40%), Positives = 375/603 (62%), Gaps = 16/603 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E I+N+IAAGE++ERP+  +KEL+EN++DA + RV+    GGG+    I D+G
Sbjct: 1   MPVRQLPETIVNRIAAGEVVERPASVVKELVENAIDAGACRVDVFSDGGGRRKIVIADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT  ++ +AV RH TSK+ D D   I T GFRGEALPSIGAV+ L+L +R        
Sbjct: 61  GGMTQADLALAVDRHATSKLDDEDLLAIRTLGFRGEALPSIGAVARLSLTTRHAAEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            +++ G   S + P A++ GT VEV DLFF  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 TLSVEGGAKSPISPAALSQGTRVEVADLFFATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQ---VIGEDFINNAVELNEKSNEITLQGY 236
           P ++FT +     R  + + +     P R+++   ++G DF  NA+E+  +   + ++G+
Sbjct: 181 PDIAFTLA--GEERAPVTWAAALPGAPGRLTRLGDILGADFRANAIEVGSEREGVAVEGF 238

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
              P+  R NA   Y+F+NGR V+DK IL  +R AYA+ +P  R+PVV L + +D R+VD
Sbjct: 239 AASPSLTRANALGQYLFVNGRPVRDKLILGAVRAAYADYLPRDRHPVVALFVTLDSREVD 298

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL- 355
            NVHPAK+ +RFRN  ++R  I+ ++++ + ++G  T++  +   IS+F   + P  +  
Sbjct: 299 ANVHPAKTEVRFRNAGLVRALIVHALKEGLAREGRRTAANSAGAAISNFRPASMPPGNWD 358

Query: 356 ----PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACA 411
               P Y     ++    F +  + + +   PS D    E        E     LG A  
Sbjct: 359 WRSSPSYPVGGGSSAAPSFGERPQAAFDVGGPSADIRPHE-----AAPELLDRPLGAART 413

Query: 412 QIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECA 471
           QIH+ YI+SQT DGL++VDQHAAHER+++E+++   ++  +  Q LL P+I+++ E    
Sbjct: 414 QIHETYIVSQTRDGLIVVDQHAAHERIVYERLKASLDANGVQRQILLIPDIVEMDEATVE 473

Query: 472 LIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQD 531
            ++   E+L + G+  E FGP A+A+RE P++L K N   LLRD+ + + +      L+ 
Sbjct: 474 RLVARAEELSKFGLVVESFGPGAVAVRETPSLLGKVNAASLLRDLAEHMAEWDEALPLER 533

Query: 532 RIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKL 591
           R+ ++ ATMAC+GS+R+GR ++  EMN LLREME  PNS QCNHGRPT+++L L+DIEKL
Sbjct: 534 RLMHVAATMACHGSVRAGRVLKPEEMNALLREMEATPNSGQCNHGRPTYVELTLADIEKL 593

Query: 592 FGR 594
           FGR
Sbjct: 594 FGR 596


>gi|16124948|ref|NP_419512.1| DNA mismatch repair protein [Caulobacter crescentus CB15]
 gi|221233668|ref|YP_002516104.1| DNA mismatch repair protein [Caulobacter crescentus NA1000]
 gi|239977506|sp|B8H173|MUTL_CAUCN RecName: Full=DNA mismatch repair protein mutL
 gi|239977507|sp|P0CAV5|MUTL_CAUCR RecName: Full=DNA mismatch repair protein mutL
 gi|13421916|gb|AAK22680.1| DNA mismatch repair protein MutL [Caulobacter crescentus CB15]
 gi|220962840|gb|ACL94196.1| DNA mismatch repair protein mutL [Caulobacter crescentus NA1000]
          Length = 637

 Score =  507 bits (1305), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 252/638 (39%), Positives = 383/638 (60%), Gaps = 46/638 (7%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L  + +N+IAAGE++ERP+ AIKEL++N++DA ++R+E    GGG +   + D+G
Sbjct: 1   MPIRRLPPETVNRIAAGEVVERPASAIKELVDNAIDAGATRIEVEAHGGGLTRILVADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSN------IHTFGFRGEALPSIGAVSHLTLMSRPPQ 114
            G++ EE+P+A++RH TSK++ D         IHT GFRGEALPSIG+V+ L + SR   
Sbjct: 61  CGLSPEELPVAIERHATSKLAPDADGLWDLLRIHTMGFRGEALPSIGSVARLQISSRAKG 120

Query: 115 NNTGAQIAISGEKISSVRPVAM-NP-GTIVEVRDLFFTIPARLNFLKSEQVETNLITDVI 172
                 I + G ++  V P A   P G  +EVRDLF+  PARL F+KSE+ E   IT+ I
Sbjct: 121 AKDAFSILVEGGQVGEVAPAAFPGPHGARIEVRDLFYATPARLKFMKSERAEALAITEEI 180

Query: 173 RRMAIAYPKVSFTFSTIKSN--RYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNE 230
           +R A+A   V F+         R         G    R++ V+G +F  NA+E+++  + 
Sbjct: 181 KRQAMANESVGFSLDIDGRRVLRLPPEHPGPQGRL-ARLAAVLGREFQENALEIDQTRDG 239

Query: 231 ITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEI 290
           + L G+ G+PT+NRGNA   Y+F+NGR V+D+ +   +R AYA+ +   R+P   L + +
Sbjct: 240 VRLSGFAGLPTYNRGNAAHQYLFVNGRPVRDRLLQGALRAAYADFLARDRHPTAALYVTL 299

Query: 291 DPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA 350
           +  +VDVNVHPAK+ +RFR+P ++R  I+ +++ A+   G   S+ ++ + + S     +
Sbjct: 300 ETTEVDVNVHPAKAEVRFRDPALVRGLIVGALRHALAGAGHRASTTVAAQALDSIRAQQS 359

Query: 351 P-KTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSD-----------DPTYS-------- 390
           P   + P+Y    +      + +E   +     P D           +P+Y         
Sbjct: 360 PFPGYQPQYQPGPSPAGFSAW-REGGWTPPTQRPMDLPGLNEVSARVEPSYGGDLAGVVR 418

Query: 391 --------EDNDPVEESEAT------HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHE 436
                   ED  P +   AT       Y LG A AQ+H+ YI++QT DG+VIVDQHAAHE
Sbjct: 419 EAYAAAAFEDRPPTDYPGATAPFDPVDYPLGAARAQVHETYIVAQTRDGMVIVDQHAAHE 478

Query: 437 RLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIA 496
           RL++E+M+ +  S  +T QTLL PE++DL   E   ++   E+L  LG+  E FGP A+ 
Sbjct: 479 RLVYERMKGEMASGGVTRQTLLLPEVVDLDPAEAERVVARAEELAGLGLVLESFGPGAVL 538

Query: 497 IREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIE 556
           +RE PA+L K +   L+RDI D++ ++     L++R+E + +TMAC+GS+R+GR++   E
Sbjct: 539 VRETPALLGKTDAAALVRDIADDLAENGQALALKERLEEVCSTMACHGSVRAGRRLNGAE 598

Query: 557 MNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           MN LLREME  P+S QCNHGRPT+++LKL+DIEKLFGR
Sbjct: 599 MNALLREMEATPHSGQCNHGRPTYVELKLADIEKLFGR 636


>gi|115523441|ref|YP_780352.1| DNA mismatch repair protein [Rhodopseudomonas palustris BisA53]
 gi|122297082|sp|Q07RR2|MUTL_RHOP5 RecName: Full=DNA mismatch repair protein mutL
 gi|115517388|gb|ABJ05372.1| DNA mismatch repair protein MutL [Rhodopseudomonas palustris
           BisA53]
          Length = 603

 Score =  506 bits (1304), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 248/607 (40%), Positives = 377/607 (62%), Gaps = 18/607 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E I+N+IAAGE++ERP+  +KEL+EN+LDA ++R+E    GGG+    ITD+G
Sbjct: 1   MPVRQLPETIVNRIAAGEVVERPASVVKELVENALDAGANRIEVFSDGGGRRRIAITDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT  ++ +AV RH TSK+ D D   I T GFRGEALPSIG+V+ L++ +R  +     
Sbjct: 61  GGMTRADLELAVDRHATSKLDDEDLLAIRTLGFRGEALPSIGSVAKLSITTRHTEEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            +A+ G   S + P A++ GT VEV DLF+  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 ALAVEGGTKSPLVPAALSQGTRVEVSDLFYATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSN--RYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P V+FT S  +     +        G    R+S ++G +F  +A+E+  + + + ++G+ 
Sbjct: 181 PDVAFTLSGEERAPVSWAAVLPGAAGRL-TRLSDILGAEFRKSAIEVRSERDGVVVEGFA 239

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G P+  R NA   Y+F+NGR V+D+ I+  +R AYA+ +P  R+PV+ L +  DP +VD 
Sbjct: 240 GAPSLTRANALGQYLFVNGRPVRDRLIIGAVRAAYADYLPRDRHPVLALFVTCDPHEVDA 299

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKG-ISTSSVLSKKMISSFHQDNAPKTHL- 355
           NVHPAK+ +RFR+  ++R  I+ +++  ++++G  S ++ +    +++F    AP     
Sbjct: 300 NVHPAKTEVRFRDAGLVRALIVHALKDGLSREGQRSAAASVDGATLAAFRPGFAPPPRAN 359

Query: 356 ------PKYATSLTNTQEKL--FLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLG 407
                 P Y  + +N  +    F +  +   +  LPS D      N     +E     LG
Sbjct: 360 WDWRRSPSYPIAGSNAMDMAPGFAEREQAGFDVGLPSADVR----NYAAPAAELIDRPLG 415

Query: 408 IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLE 467
            A  QIH+ YI++QT  GLVIVDQHAAHERL++EK++    S  +  Q LL PEI++L E
Sbjct: 416 AARTQIHETYIVAQTRTGLVIVDQHAAHERLVYEKLKASMASNGVQRQLLLIPEIVELDE 475

Query: 468 GECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTY 527
                +++  E+L   G+  + FGP A+A+RE+PA+L K N   LLRD+ + + +     
Sbjct: 476 ATVEQLLDRAEELCSFGLAIDSFGPGAVAVREVPALLGKANAASLLRDLAEHMAEWDEAL 535

Query: 528 TLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSD 587
            L+ R+ ++ ATMAC+GS+R+GR ++  EMN LLREME  PNS QCNHGRPT+++L LSD
Sbjct: 536 PLERRLLHVAATMACHGSVRAGRILKPEEMNALLREMEATPNSGQCNHGRPTYVELTLSD 595

Query: 588 IEKLFGR 594
           IEKLFGR
Sbjct: 596 IEKLFGR 602


>gi|295691031|ref|YP_003594724.1| DNA mismatch repair protein MutL [Caulobacter segnis ATCC 21756]
 gi|295432934|gb|ADG12106.1| DNA mismatch repair protein MutL [Caulobacter segnis ATCC 21756]
          Length = 638

 Score =  505 bits (1300), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 253/641 (39%), Positives = 385/641 (60%), Gaps = 51/641 (7%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L  + +N+IAAGE++ERP+ AIKEL++N++DA ++R+E    GGG +   + D+G
Sbjct: 1   MPIRRLPPETVNRIAAGEVVERPASAIKELVDNAIDAGATRIEVEAHGGGLTRILVADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSN------IHTFGFRGEALPSIGAVSHLTLMSRPPQ 114
            G+++EE+P+A++RH TSK++ D         IHT GFRGEALPSIG+V+ L + SR   
Sbjct: 61  CGLSAEELPVAIERHATSKLAPDADGLWDLLRIHTMGFRGEALPSIGSVARLQISSRAKG 120

Query: 115 NNTGAQIAISGEKISSVRPVAM-NP-GTIVEVRDLFFTIPARLNFLKSEQVETNLITDVI 172
                 I + G ++  V P A   P G  +EVRDLF+  PARL F+KSE+ E   IT+ I
Sbjct: 121 EKDAFSILVEGGQVGDVAPAAFPGPHGARIEVRDLFYATPARLKFMKSERAEALAITEEI 180

Query: 173 RRMAIAYPKVSFTFSTIKSN--RYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNE 230
           +R A+A   V F+         R         G    R++ V+G +F  NA+E+++  + 
Sbjct: 181 KRQAMANESVGFSLDIDGRRVLRLPPEHPGPQGRL-ARLAAVLGREFQENALEIDQVRDG 239

Query: 231 ITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEI 290
           + L G+ G+PT+NRGNA   Y+F+NGR V+D+ +   +R AYA+ +   R+P   L + +
Sbjct: 240 VRLSGFAGLPTYNRGNAAHQYLFVNGRPVRDRLLQGALRAAYADFLARDRHPTAALYVTL 299

Query: 291 DPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA 350
           D  +VDVNVHPAK+ +RFR+P ++R  I+ +++ A+   G   S+ ++ + + S     +
Sbjct: 300 DTAEVDVNVHPAKAEVRFRDPALVRGLIVGALRHALAGAGHRASTTVAAQALDSIRAQQS 359

Query: 351 PKTHLPKYATSLTN--------------TQEKLFLQENRL-STNDLLPSDDPTY-SEDND 394
           P    P Y    +               TQ  L +Q   L   N++    +P+Y  E  +
Sbjct: 360 P---FPGYQPGPSAAGFSAWREGGWAPPTQRPLNMQSMDLPGLNEVSARVEPSYGGELAE 416

Query: 395 PVEESEAT---------------------HYQLGIACAQIHQNYIISQTTDGLVIVDQHA 433
            V E+ A+                      Y LG A AQ+H+ YI++QT DG+VIVDQHA
Sbjct: 417 VVREAYASVAFEDRPITDHPSAAAPFDPVDYPLGAARAQVHETYIVAQTRDGMVIVDQHA 476

Query: 434 AHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPN 493
           AHERL++E+M+ +  +  +  QTLL PE++DL   E   ++   E+L  LG+  E FGP 
Sbjct: 477 AHERLVYERMKGEMAAGGVARQTLLLPEVVDLDPAEAERVIARAEELANLGLVIESFGPG 536

Query: 494 AIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQ 553
           A+ +RE PA+L K +   L+RDI D++ ++     L++R+E + +TMAC+GS+R+GR++ 
Sbjct: 537 AVLVRETPALLGKTDAAGLIRDIADDLAENGAALALKERLEEVCSTMACHGSVRAGRRLN 596

Query: 554 SIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
             EMN LLREME  P+S QCNHGRPT+++LKL+DIEKLFGR
Sbjct: 597 GAEMNALLREMEATPHSGQCNHGRPTYVELKLADIEKLFGR 637


>gi|90422900|ref|YP_531270.1| DNA mismatch repair protein [Rhodopseudomonas palustris BisB18]
 gi|123275477|sp|Q219I5|MUTL_RHOPB RecName: Full=DNA mismatch repair protein mutL
 gi|90104914|gb|ABD86951.1| DNA mismatch repair protein MutL [Rhodopseudomonas palustris
           BisB18]
          Length = 599

 Score =  505 bits (1300), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 247/605 (40%), Positives = 377/605 (62%), Gaps = 18/605 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E ++N+IAAGE++ERP+  +KEL+EN++DA +SR++    GGG+    ITD+G
Sbjct: 1   MPVRQLPETVVNRIAAGEVVERPASVVKELVENAIDAGASRIDIFTDGGGRRRIGITDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT  ++ +AV RH TSK+ D D   I T GFRGEALPSIG+V+ L++ +R        
Sbjct: 61  AGMTHADLTLAVDRHATSKLDDEDLLAIRTLGFRGEALPSIGSVAKLSITTRHAAEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            +A+ G   S + P A++ GT VEV DLF+  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 ALAVEGGAKSPIVPAALSHGTRVEVSDLFYATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSN--RYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P ++F+ +  +     +        G    R+  ++G DF +NA+E+  + + + ++G+ 
Sbjct: 181 PDIAFSMAGEERAPVTWAAALPGAAGRL-TRLGDILGGDFRSNAIEVRSERDGVVVEGFA 239

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
             P+  R NA   Y+F+NGR V+DK I+  +R AY++ +P  R+PVV L + +D R+VD 
Sbjct: 240 AAPSLTRANALGQYLFVNGRPVRDKLIIGAVRAAYSDYLPRDRHPVVALFVSLDSREVDA 299

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL-- 355
           NVHPAK+ +RFR+  ++R  I+ ++++ + ++G  T++  +   ISSF    AP+ +   
Sbjct: 300 NVHPAKTEVRFRDAGLVRALIVHALKEGLAREGKRTAANDAGATISSFRPSFAPRANWDW 359

Query: 356 ---PKYATSLTNTQEKLFLQENRLSTN-DL-LPSDD-PTYSEDNDPVEESEATHYQLGIA 409
              P Y  + +   +       R  +  D+  PS D  +Y    D       T   LG A
Sbjct: 360 RSSPSYPVAGSAAFDAAAGFAEREQSGFDVGAPSADVRSYQPSAD------FTDRPLGAA 413

Query: 410 CAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGE 469
             QIHQ YI++QT DGLV+VDQHAAHERL++EK++    +  +  Q LL PEI++L E  
Sbjct: 414 RTQIHQTYIVAQTRDGLVVVDQHAAHERLVYEKLKASLATNGVQRQILLIPEIVELDEAT 473

Query: 470 CALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTL 529
              ++   E+L   G+  E FGP A+A+RE P++L K +   LLRD+ + + +      L
Sbjct: 474 VERLVARGEELATFGLVVESFGPGAVAVRETPSLLGKTDAGALLRDLAEHMAEWDEALPL 533

Query: 530 QDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIE 589
           + R+ ++ ATMAC+GS+R+GR ++  EMN LLREME  PNS QCNHGRPT+++LKLSDIE
Sbjct: 534 ERRLLHVAATMACHGSVRAGRVLKPEEMNALLREMEDTPNSGQCNHGRPTYVELKLSDIE 593

Query: 590 KLFGR 594
           KLFGR
Sbjct: 594 KLFGR 598


>gi|86751283|ref|YP_487779.1| DNA mismatch repair protein [Rhodopseudomonas palustris HaA2]
 gi|123292100|sp|Q2ISE2|MUTL_RHOP2 RecName: Full=DNA mismatch repair protein mutL
 gi|86574311|gb|ABD08868.1| DNA mismatch repair protein MutL [Rhodopseudomonas palustris HaA2]
          Length = 597

 Score =  501 bits (1291), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 241/604 (39%), Positives = 374/604 (61%), Gaps = 18/604 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E I+N+IAAGE++ERP+  +KEL+EN++DA +SR++    GGG+    I D+G
Sbjct: 1   MPVRQLPETIVNRIAAGEVVERPASVVKELVENAIDAGASRIDIFSDGGGRRKIVIADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT  ++ +AV RH TSK+ D D   I T GFRGEALPSIGAV+ LT+ +R        
Sbjct: 61  SGMTRADLALAVDRHATSKLDDEDLLQIRTLGFRGEALPSIGAVARLTITTRHAGEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + + G   S + P A++ GT VEV DLFF  PARL FLK+++ E   I DV+RR+A+A 
Sbjct: 121 TLGVEGGDKSPIAPAALSQGTRVEVADLFFATPARLKFLKTDRTEAEAIRDVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPE---RISQVIGEDFINNAVELNEKSNEITLQGY 236
           P ++FT +     R  + + +     P    R+  ++G DF  NA+E+  +   + ++G+
Sbjct: 181 PDIAFTLA--GEERAPVTWAAALPGAPGQLIRLGDILGADFRANAIEVRSEREGVAVEGF 238

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
              P   R NA   Y+F+NGR V+DK IL  +R AY++ +P  R+PVV L + ++ R+VD
Sbjct: 239 AASPALTRANALGQYLFVNGRPVRDKLILGAVRAAYSDYLPRDRHPVVALFVTLESREVD 298

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL- 355
            NVHPAK+ +RFRN  ++R  I+ ++++ + ++G  T++  +  +IS+F   + P  +  
Sbjct: 299 ANVHPAKTEVRFRNAGLVRALIVHALKEGLAREGRRTAANSAGSVISTFRPASMPAANWD 358

Query: 356 ----PKYATSLTNTQEKLFLQENRLSTNDLLPSDD-PTYSEDNDPVEESEATHYQLGIAC 410
               P Y    +      F +  + + +   PS D  T+    D ++        LG A 
Sbjct: 359 WRASPSYPVGGSAIDAPSFAERPQAAFDVGGPSADIRTHEVAPDLLDRP------LGAAR 412

Query: 411 AQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGEC 470
            QIH+ YI+SQT DGL++VDQHAAHER+++E+++    +  +  Q LL P+I+++ E   
Sbjct: 413 TQIHETYIVSQTRDGLIVVDQHAAHERIVYERLKASLAANGVQRQILLIPDIVEMDEATV 472

Query: 471 ALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQ 530
             ++   ++L + G+  E FGP A+A+RE P++L K +   LLRD+ + + +      L+
Sbjct: 473 ERLVARADELAQFGLVVESFGPGAVAVRETPSLLGKTDAASLLRDLAEHMAEWDEALPLE 532

Query: 531 DRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEK 590
            R+ ++ ATMAC+GS+R+GR ++  EMN LLREME  PNS QCNHGRPT+++L L+DIEK
Sbjct: 533 RRLMHVAATMACHGSVRAGRVLKPEEMNALLREMEATPNSGQCNHGRPTYVELTLTDIEK 592

Query: 591 LFGR 594
           LFGR
Sbjct: 593 LFGR 596


>gi|209886353|ref|YP_002290210.1| DNA mismatch repair protein [Oligotropha carboxidovorans OM5]
 gi|229486325|sp|B6JIV1|MUTL_OLICO RecName: Full=DNA mismatch repair protein mutL
 gi|209874549|gb|ACI94345.1| DNA mismatch repair protein [Oligotropha carboxidovorans OM5]
          Length = 612

 Score =  501 bits (1289), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 240/617 (38%), Positives = 380/617 (61%), Gaps = 29/617 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E+I+N+IAAGE++ERP+ A+KEL+EN++DA  +R++    GGG+    ITD+G
Sbjct: 1   MPVRQLPEQIVNRIAAGEVVERPASAVKELVENAIDAGGTRIDIFTEGGGRRRIVITDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT  ++ +AV+RH TSK+ D D   I T GFRGEALPSI +V+ L + +R        
Sbjct: 61  SGMTQGDLALAVERHATSKLDDEDLLRIRTLGFRGEALPSISSVAKLAITTRHAAEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + +     S++ P A+  GT VEV DLF+  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 AVEVDAGAKSAIAPAALQRGTRVEVSDLFYATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQ---VIGEDFINNAVELNEKSNEITLQGY 236
           P ++FT +     R  + + +     P R+++   ++G DF  +A+E+  +   ++++G+
Sbjct: 181 PDIAFTLA--GEERAPVTWAAALPGAPGRLTRLGDILGSDFRTHAIEVGSEREGVSVEGF 238

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
              P+  R NA   Y+F+NGR V+DK IL  +R AYA+ +P  R+P+V L + +DP++VD
Sbjct: 239 AAAPSLTRANALGQYLFVNGRPVRDKLILGAVRAAYADYLPRDRHPIVALFVTLDPQEVD 298

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISS------FHQDNA 350
            NVHPAK+ +RFRN  ++R  I+ +++  + ++G  T++  +   I++      F ++  
Sbjct: 299 ANVHPAKTEVRFRNAGLVRALIVHALKDGLAREGRRTAANTNGAAITTAFRTEGFSREGF 358

Query: 351 PKTHLPKYATSLTNTQEKL-------------FLQENRLSTNDLLPSDDPTYSEDNDPVE 397
            +  LP+      ++                 F +  + + +   PS D   +E   P+ 
Sbjct: 359 ARESLPRGGYDWRSSPAAPWPPQAAAQAPAMGFDESAQAAFDAGAPSADTRGNEA--PL- 415

Query: 398 ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTL 457
             +A    LG A  QIH+NYI++QT DGL++VDQHAAHER+++E+++       +  Q L
Sbjct: 416 -GDALGRPLGAARTQIHENYIVAQTNDGLILVDQHAAHERIVYERLKASLTKNGVARQML 474

Query: 458 LTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDII 517
           L PEI+++ E     ++    +L + G+  E FGP A+A+RE PA+L K N   LLRD+ 
Sbjct: 475 LIPEIVEMDEASVEKLLARASELEKYGLSIESFGPGAVAVRETPALLGKANAASLLRDLA 534

Query: 518 DEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGR 577
           + + +      L+ R+ ++ ATMAC+GS+RSGR ++  EMN LLREME  PNS QCNHGR
Sbjct: 535 EHMAEWDEALPLERRLMHVAATMACHGSVRSGRILKVEEMNALLREMEATPNSGQCNHGR 594

Query: 578 PTFIKLKLSDIEKLFGR 594
           PT+++LKL+DIEKLFGR
Sbjct: 595 PTYVELKLADIEKLFGR 611


>gi|167648022|ref|YP_001685685.1| DNA mismatch repair protein [Caulobacter sp. K31]
 gi|189030394|sp|B0SWX9|MUTL_CAUSK RecName: Full=DNA mismatch repair protein mutL
 gi|167350452|gb|ABZ73187.1| DNA mismatch repair protein MutL [Caulobacter sp. K31]
          Length = 643

 Score =  500 bits (1287), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 250/645 (38%), Positives = 386/645 (59%), Gaps = 54/645 (8%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L  + +N+IAAGE++ERP+ AIKEL++N++DA ++R+E    GGG +   + D+G
Sbjct: 1   MPIRRLPPETVNRIAAGEVVERPASAIKELVDNAIDAGATRIEVEAHGGGLTRILVADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSN------IHTFGFRGEALPSIGAVSHLTLMSRPPQ 114
            G+++EE+P+A++RH TSK++ D         IHT GFRGEALPSIG+V+ L++ SR   
Sbjct: 61  CGLSAEELPVALERHATSKLAPDAQGLWDLLAIHTMGFRGEALPSIGSVARLSISSRAKG 120

Query: 115 NNTGAQIAISGEKISSVRPVAM--NPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVI 172
           ++    I + G  +  V P A   + G  +EVRDLF+  PARL F+KSE+ E   IT+ I
Sbjct: 121 SSDAWSILVEGGSVGDVAPAAFAGDHGARIEVRDLFYATPARLKFMKSERAEALAITEEI 180

Query: 173 RRMAIAYPKVSFTFSTIKSN--RYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNE 230
           +R A+A   V F+         R         G    R+S V+G DF +NA+E+++  + 
Sbjct: 181 KRQAMANESVGFSLDIDGRRIIRLPPEHPGPQGRL-ARLSAVLGRDFQDNAIEIDQTRDG 239

Query: 231 ITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEI 290
           + L G+ G+PT+NRGNA   Y+F+NGR V+D+ +   +R AYA+ +   R+P   L + +
Sbjct: 240 VRLTGFAGLPTYNRGNAAHQYLFVNGRPVRDRLLQGALRAAYADFLARDRHPTAALYISL 299

Query: 291 DPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTS---------SVLSKKM 341
           D  +VDVNVHPAK+ +RFR+P ++R  I+ +++ A+   G   S         ++ ++ M
Sbjct: 300 DTSEVDVNVHPAKAEVRFRDPALVRGLIVGALRHALAGAGHRASTTTAASALDAIRAQSM 359

Query: 342 IS----SFHQDNA------PKTHLPKYATSLTNTQEKLF--------------------L 371
           +     S +Q NA      P       A   T    ++                     +
Sbjct: 360 VPPGAYSGYQPNAYQGGPSPAGFSAWQAGGWTRPSPQVLPGLSDVSARVEPGGYGVAEAV 419

Query: 372 QENRLSTNDLLP--SDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIV 429
           +E      D  P  +    +SED  PV   +   + LG A AQ+H+ YI++QT DG+VIV
Sbjct: 420 REAAFGEYDAPPNVAYPGGFSEDPAPV--FDPVDFPLGAARAQVHETYIVAQTRDGVVIV 477

Query: 430 DQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAER 489
           DQHAAHERL++E+M+ +  + ++  Q LL PE+++L   E   ++   E+L  LG+  E 
Sbjct: 478 DQHAAHERLVYERMKGEMAAGRVARQALLLPEVVELDPAEAERVVARAEELAALGLVIES 537

Query: 490 FGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSG 549
           FGP A+ +RE PA+L K +   L+RDI D++ ++     L++R+E + +TMAC+GS+R+G
Sbjct: 538 FGPGAVLVRETPALLGKTDAAGLVRDIADDLAENGQALALKERLEEVCSTMACHGSVRAG 597

Query: 550 RKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           R++   EMN LLREME  P+S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 598 RRLTGAEMNALLREMEATPHSGQCNHGRPTYVELKLADIERLFGR 642


>gi|316935889|ref|YP_004110871.1| DNA mismatch repair protein MutL [Rhodopseudomonas palustris DX-1]
 gi|315603603|gb|ADU46138.1| DNA mismatch repair protein MutL [Rhodopseudomonas palustris DX-1]
          Length = 595

 Score =  499 bits (1285), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 239/603 (39%), Positives = 375/603 (62%), Gaps = 18/603 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E I+N+IAAGE++ERP+  +KEL+EN++DA +SR++    GGG+    I D+G
Sbjct: 1   MPVRQLPETIVNRIAAGEVVERPASVVKELVENAIDAGASRIDIFSDGGGRRKIVIADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT+ ++ +AV RH TSK+ D D   I T GFRGEALPSIGAV+ L++ +R        
Sbjct: 61  SGMTAVDLALAVDRHATSKLDDEDLLAIRTLGFRGEALPSIGAVARLSITTRHASEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + + G   + + P A++ GT VEV DLFF  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 AMRVEGGDKTPIAPAALSQGTRVEVADLFFATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPE---RISQVIGEDFINNAVELNEKSNEITLQGY 236
           P V+FT +     R  + + +     P    R+  ++G DF  NA+E+  +   + ++G+
Sbjct: 181 PDVAFTLA--GEERAPVTWAAALPGAPGQLIRLGDILGADFRANAIEVRAEREGVVVEGF 238

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
              P+  R NA   Y+F+NGR V+DK IL  +R AY++ +P  R+PVV L + +D R+VD
Sbjct: 239 AAAPSLTRANALGQYLFVNGRPVRDKLILGAVRAAYSDYLPRDRHPVVALFVTLDSREVD 298

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL- 355
            NVHPAK+ +RFRN  ++R  I+ ++++ + ++G  T++  +  +IS+F   + P  +  
Sbjct: 299 ANVHPAKTEVRFRNAGLVRALIVHALKEGLAREGRRTAANSASSVISTFRPASMPPANWD 358

Query: 356 ----PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACA 411
               P Y   +  +    F +  + + +   PS D   +E        +     LG A  
Sbjct: 359 WRASPSY--PVGGSAAPSFAERAQAAFDVGAPSADIRLTEVT-----PDLLDRPLGAART 411

Query: 412 QIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECA 471
           QIH+ YI+SQT DGL+++DQHAAHER+++E+++    +  +  Q LL P+I+++ E    
Sbjct: 412 QIHETYIVSQTRDGLIVIDQHAAHERIVYERLKASLEANGVQRQILLIPDIVEMDEATVE 471

Query: 472 LIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQD 531
            ++   E+L + G+  E FGP A+A+RE P++L K +   LLRD+ + + +      L+ 
Sbjct: 472 RLVARAEELAKFGLVIESFGPGAVAVRETPSLLGKTDAGGLLRDLAEHMAEWDEALPLER 531

Query: 532 RIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKL 591
           R+ ++ ATMAC+GS+R+GR ++  EMN LLREME  PNS QCNHGRPT+++L L+DIEKL
Sbjct: 532 RLMHVAATMACHGSVRAGRVLKPEEMNALLREMEATPNSGQCNHGRPTYVELTLADIEKL 591

Query: 592 FGR 594
           FGR
Sbjct: 592 FGR 594


>gi|312114924|ref|YP_004012520.1| DNA mismatch repair protein MutL [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220053|gb|ADP71421.1| DNA mismatch repair protein MutL [Rhodomicrobium vannielii ATCC
           17100]
          Length = 605

 Score =  497 bits (1280), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 247/611 (40%), Positives = 386/611 (63%), Gaps = 24/611 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+LS+  IN+IAAGE+IERP+ A+KEL+EN++DA ++ +E +   GG S  +++D+G
Sbjct: 1   MTIRELSQVEINRIAAGEVIERPASAVKELVENAIDAGATAIEVIAESGGLSLIRVSDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM   ++ + V+RH TSK+ S D   I T GFRGEALPS+G+V  L++++RP     G 
Sbjct: 61  IGMDEADLALCVRRHATSKLPSGDLMAIRTLGFRGEALPSLGSVGTLSIVTRPRALTRGH 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +I + G + S VRP A  PGT VEVRDLF   PARL F+KSE+ E   I+DV++R+A+A 
Sbjct: 121 EIEVRGGETSPVRPAAARPGTCVEVRDLFAATPARLKFMKSERAENAAISDVVKRLALAC 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGN---FPERISQVIGEDFINNAVELNEKSNEITLQGY 236
           P V F  +  +    ++  ++ +G+      R+++++G +F  +A  ++ + + + L GY
Sbjct: 181 PHVGFALTVGERASLQLA-RAADGDENAVRARLARIMGREFGEDAEPVHLERDGLALTGY 239

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
            G PT NR +A+  YVF+NGR V+D+ + S IR AY + +P GR+P+ VL L +    VD
Sbjct: 240 AGRPTLNRPDASLQYVFVNGRPVKDRLLFSAIRGAYVDVVPRGRFPLAVLFLTVRVEDVD 299

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH-----QDNAP 351
           VNVHPAK+ +RFR  +++R  ++ ++  A+   G   +        +S       Q  AP
Sbjct: 300 VNVHPAKAEVRFREASLVRALVVSALHDALRCAGAMAARPTGALTPASAAAPEPLQYRAP 359

Query: 352 KTHLPK--YATSLTN--TQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEES----EATH 403
               P+  Y ++     T+     +E  L+ +    ++D + S  N    E+    +A +
Sbjct: 360 LRTWPQSPYRSTYPQPMTEPGAGFEETALAFD----TEDASQSSANGATHEARDSEDANY 415

Query: 404 YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEII 463
            +LG+A AQ+H  YI+S+T DG++++DQHAAHER+++EK++      +I  Q LL PEI+
Sbjct: 416 ERLGMARAQVHNTYILSETPDGVILIDQHAAHERIVYEKLKAALLGGRIARQLLLIPEIV 475

Query: 464 DLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDS 523
           ++ E + AL+ EH E +   G+  E FGP AI +RE+PA+L   ++  L+RD+  E+ DS
Sbjct: 476 EMPEDDAALVAEHAETVAGSGLALESFGPGAIIVREVPALLGHCDLQTLVRDLAHELKDS 535

Query: 524 STTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKL 583
           +   T++ R+  I ATMAC+GS+R+GR M+  EMN LLREME  PN++QCNHGRPT+++L
Sbjct: 536 AN--TVEARLHAICATMACHGSVRAGRPMRLDEMNALLREMETTPNAAQCNHGRPTYVEL 593

Query: 584 KLSDIEKLFGR 594
              D+E+LF R
Sbjct: 594 SRGDLERLFER 604


>gi|192293214|ref|YP_001993819.1| DNA mismatch repair protein [Rhodopseudomonas palustris TIE-1]
 gi|238692573|sp|B3Q7Y9|MUTL_RHOPT RecName: Full=DNA mismatch repair protein mutL
 gi|192286963|gb|ACF03344.1| DNA mismatch repair protein MutL [Rhodopseudomonas palustris TIE-1]
          Length = 595

 Score =  496 bits (1276), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 240/607 (39%), Positives = 374/607 (61%), Gaps = 26/607 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E I+N+IAAGE++ERP+  +KEL+EN++DA SSR++    GGG+    I D+G
Sbjct: 1   MPVRQLPEIIVNRIAAGEVVERPASVVKELVENAIDAGSSRIDIFSDGGGRRKIVIADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT+ ++ +AV RH TSK+ D D   I T GFRGEALPSIGAV+ L++ +R        
Sbjct: 61  SGMTAADLALAVDRHATSKLDDEDLLQIRTLGFRGEALPSIGAVAKLSITTRHASEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + + G   + + P A++ GT VEV DLFF  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 TLRVEGGDKTPIAPAALSQGTRVEVADLFFATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPE---RISQVIGEDFINNAVELNEKSNEITLQGY 236
           P ++FT +     R  + + +     P    R+  ++G DF  NA+E+  +   + ++G+
Sbjct: 181 PDIAFTLA--GEERAPVTWAAALPGAPGQLIRLGDILGADFRANAIEVRAEREGVVVEGF 238

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
              P   + NA   Y+F+NGR V+DK IL  +R AY++ +P  R+PVV L + +D R+VD
Sbjct: 239 AASPALTKANALGQYLFVNGRPVRDKLILGAVRAAYSDYLPRDRHPVVALFVTLDSREVD 298

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL- 355
            NVHPAK+ +RFRN  ++R  I+ +++  + ++G  T++  +  +IS+F   + P  +  
Sbjct: 299 ANVHPAKTEVRFRNAGLVRALIVHALKDGLAREGRRTAANSAGSVISTFRPASMPPANWD 358

Query: 356 ----PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEAT----HYQLG 407
               P Y   +  +    F +  + + +   PS D         +  +E T       LG
Sbjct: 359 WRASPSY--PVGGSAAPSFAERAQAAFDVGAPSAD---------IRPTEVTPDLLDRPLG 407

Query: 408 IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLE 467
            A  QIH+ YI+SQT DGL++VDQHAAHER+++E+++    +  +  Q LL P+I+++ E
Sbjct: 408 AARTQIHETYIVSQTRDGLIVVDQHAAHERIVYERLKASLEANGVQRQILLIPDIVEMDE 467

Query: 468 GECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTY 527
                ++   E+L + G+  E FGP A+A+RE P++L K +   LLRD+ + + +     
Sbjct: 468 ATVERLVARGEELAKFGLVIESFGPGAVAVRETPSLLGKTDAGGLLRDLAEHMAEWDEAL 527

Query: 528 TLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSD 587
            L+ R+ ++ ATMAC+GS+R+GR ++  EMN LLREME  PNS QCNHGRPT+++L L+D
Sbjct: 528 PLERRLMHVAATMACHGSVRAGRVLKPEEMNALLREMEATPNSGQCNHGRPTYVELTLTD 587

Query: 588 IEKLFGR 594
           IEKLFGR
Sbjct: 588 IEKLFGR 594


>gi|39937431|ref|NP_949707.1| DNA mismatch repair protein [Rhodopseudomonas palustris CGA009]
 gi|81829456|sp|Q6N1N4|MUTL_RHOPA RecName: Full=DNA mismatch repair protein mutL
 gi|39651290|emb|CAE29812.1| DNA mismatch repair protein MutL [Rhodopseudomonas palustris
           CGA009]
          Length = 595

 Score =  495 bits (1274), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 239/607 (39%), Positives = 372/607 (61%), Gaps = 26/607 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E I+N+IAAGE++ERP+  +KEL+EN++DA +SR++    GGG+    I D+G
Sbjct: 1   MPVRQLPETIVNRIAAGEVVERPASVVKELVENAIDAGASRIDIFSDGGGRRKIVIADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT  ++ +AV RH TSK+ D D   I T GFRGEALPSIGAV+ L++ +R        
Sbjct: 61  SGMTQADLALAVDRHATSKLDDEDLLQIRTLGFRGEALPSIGAVARLSITTRHAAEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + + G   + + P A+  GT VEV DLFF  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 ALRVEGGDKTPIAPAALTQGTRVEVADLFFATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPE---RISQVIGEDFINNAVELNEKSNEITLQGY 236
           P V+FT +     R  + + +     P    R+  ++G DF  NA+E+  +   + ++G+
Sbjct: 181 PDVAFTLA--GEERAPVTWAAALPGAPGQLIRLGDILGADFRANAIEVRAEREGVVVEGF 238

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
              P+  + NA   Y+F+NGR V+DK IL  +R AY++ +P  R+PVV L + +D R+VD
Sbjct: 239 AAAPSLTKANALGQYLFVNGRPVRDKLILGAVRAAYSDYLPRDRHPVVALFVTLDAREVD 298

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL- 355
            NVHPAK+ +RFRN  ++R  I+ +++  + ++G  T++  +  +IS+F   + P  +  
Sbjct: 299 ANVHPAKTEVRFRNSGLVRALIVHALKDGLAREGRRTAANSASSVISTFRPASMPPANWD 358

Query: 356 ----PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEAT----HYQLG 407
               P Y   +  +    F +  + + +   PS D         +   E T       LG
Sbjct: 359 WRSSPSY--PVGGSAAPSFAERAQAAFDVGAPSAD---------IRPQEVTPDLLDRPLG 407

Query: 408 IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLE 467
            A  QIH+ YI+SQT DGL+++DQHAAHER+++E+++    +  +  Q LL P+I+++ E
Sbjct: 408 AARTQIHETYIVSQTRDGLIVIDQHAAHERIVYERLKASLEANGVQRQILLIPDIVEMDE 467

Query: 468 GECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTY 527
                ++   E+L + G+  E FGP A+A+RE P++L K +   LLRD+ + + +     
Sbjct: 468 ATVERLVARAEELAQFGLVIESFGPGAVAVRETPSLLGKTDASGLLRDLAEHMAEWDEAL 527

Query: 528 TLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSD 587
            L+ R+ ++ ATMAC+GS+R+GR ++  EMN LLREME  PNS QCNHGRPT+++L L+D
Sbjct: 528 PLERRLMHVAATMACHGSVRAGRVLKPEEMNALLREMEATPNSGQCNHGRPTYVELTLAD 587

Query: 588 IEKLFGR 594
           IEKLFGR
Sbjct: 588 IEKLFGR 594


>gi|85717173|ref|ZP_01048131.1| DNA mismatch repair protein [Nitrobacter sp. Nb-311A]
 gi|85696006|gb|EAQ33906.1| DNA mismatch repair protein [Nitrobacter sp. Nb-311A]
          Length = 603

 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 239/609 (39%), Positives = 369/609 (60%), Gaps = 22/609 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E ++N+IAAGE++ERP+  +KEL+EN++DA ++R++    GGG+    +TD+G
Sbjct: 1   MPVRQLPETVVNRIAAGEVVERPASVVKELVENAIDAGATRIDVFTDGGGRRRIGVTDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM   ++ +AV RH TSK+ D D   I T GFRGEALPSIGAV+ L + +R  +     
Sbjct: 61  AGMAKGDLALAVDRHATSKLDDEDLLGIRTLGFRGEALPSIGAVARLCITTRDAREPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + + G + S++ P A+  GT VEV DLF+  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 SLTVEGGRKSAIVPAALTQGTRVEVGDLFYATPARLKFLKTDRAEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQST----NGNFPERISQVIGEDFINNAVELNEKSNEITLQG 235
           P + FT +     R  + + S      G    R+  ++G DF   A+ +  +   +T+ G
Sbjct: 181 PDIGFTLA--GEGRAPVTWTSALPGAAGRL-TRLGDILGGDFRAAAIPVCAERERVTVDG 237

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           +   P+  R NA   Y+F+NGR V+DK IL  +R AY++ +P  R+PV  L +  DP++V
Sbjct: 238 FAAAPSLTRANALGQYLFVNGRPVRDKLILGAVRAAYSDYLPRDRHPVAALFVTTDPQEV 297

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH- 354
           D NVHPAK+ +RFRN  ++R  I+ ++++ + ++G  T++     ++++F    +P+   
Sbjct: 298 DANVHPAKTEVRFRNAGLVRALIVHALKEGLAREGRRTAANSDGAVLTAFRPATSPRPAG 357

Query: 355 --------LPKYATSLTNTQEKLFLQENRLSTNDL-LPSDDPTYSEDNDPVEESEATHYQ 405
                    P  A             E   +T D+  PS D  +  D  P    +     
Sbjct: 358 WDWRQSPAAPADARPWAGGLPATAFAETGQTTLDVGAPSADVRF--DAGP--PLDLVDRP 413

Query: 406 LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDL 465
           LG A  QIH+ YI+SQT DGL++VDQHAAHER+++E+++       +  Q LL P+I++L
Sbjct: 414 LGAARTQIHETYIVSQTRDGLIVVDQHAAHERIVYERLKASLARDGVQRQILLIPDIVEL 473

Query: 466 LEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSST 525
            E     +++   +L + G+  E FGP A+A+RE P++L K N   LLRD+ + + +   
Sbjct: 474 DESTVEKLIDRARELEKFGLAIESFGPGAVAVRETPSLLGKINAAALLRDLAEHMAEWDE 533

Query: 526 TYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKL 585
           T  L+ R+ ++ ATMAC+GS+R+GR ++  EMN LLREME  PNS QCNHGRPT+++LKL
Sbjct: 534 TLPLERRLMHVAATMACHGSVRAGRILKPEEMNALLREMEATPNSGQCNHGRPTYVELKL 593

Query: 586 SDIEKLFGR 594
            DIEKLFGR
Sbjct: 594 DDIEKLFGR 602


>gi|220927109|ref|YP_002502411.1| DNA mismatch repair protein MutL [Methylobacterium nodulans ORS
           2060]
 gi|219951716|gb|ACL62108.1| DNA mismatch repair protein MutL [Methylobacterium nodulans ORS
           2060]
          Length = 621

 Score =  493 bits (1269), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 234/611 (38%), Positives = 370/611 (60%), Gaps = 20/611 (3%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           +R+L   ++++IAAGE++ERP+ A+KEL+EN++DA ++ +E  I  GG+   ++ D+G G
Sbjct: 11  VRRLDPVLVDRIAAGEVVERPAAAVKELVENAIDAGATSIEVTIQAGGRRLIRVLDDGIG 70

Query: 63  MTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M  E++ +AV+RH TSK+ + D   I T GFRGEALPSIGAV+ L+L+SR  +  +G  +
Sbjct: 71  MGPEDLALAVERHATSKLPEGDLDRIDTLGFRGEALPSIGAVARLSLVSRTAEAESGHGL 130

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +       VRPVA   GT VEV DLF   PARL FLKS++ E   + +++RR+A+A+P+
Sbjct: 131 VVDAGIKGPVRPVAAERGTRVEVTDLFAATPARLKFLKSDRAEAGAVAEILRRLAVAHPQ 190

Query: 182 VSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPT 241
           + FT             ++  G++  R++ V+G DF  N+V ++ +     L G+ G+PT
Sbjct: 191 IRFTLRGEGGAGLTFPAETGQGSWLRRLAAVLGADFAANSVPVSLEREGFALDGHIGLPT 250

Query: 242 FNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHP 301
           F+R  A   +  +NGR V+D+ +L  +R AYA+ +   R+PV+ L L  DP +VDVNVHP
Sbjct: 251 FHRAAATHMHFVVNGRPVRDRLLLGAVRGAYADVMASDRHPVLALALTCDPTEVDVNVHP 310

Query: 302 AKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA--------PKT 353
           AK+ +RFR P ++R  I+ +I +A+ ++G   S  ++ K + S                 
Sbjct: 311 AKTEVRFREPGLVRGLIVSAIHEALRREGGRASGSVAAKTLESLRPAQGPLLPLRRPDPP 370

Query: 354 HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDD----------PTYSEDNDPVEESEATH 403
                 +    +  + FL     +      +D+          P  ++  +P  E  +  
Sbjct: 371 PAAPRGSGRVESFAQDFLGAPEAAEQPAGFADEAQAAFAGAAMPPGADWREPAPEPASPT 430

Query: 404 YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEII 463
           + LG A AQ+H+ YI++QT DG+VIVDQHAAHERL++E+++++  +  I  Q LL P+++
Sbjct: 431 HPLGAARAQLHETYIVAQTQDGIVIVDQHAAHERLVYERLKRERAAGGIARQLLLIPDVV 490

Query: 464 DLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDS 523
           +L   E   + E   DL  LG+  E FG  A+ +RE+PA L+  ++  LL D++D ++  
Sbjct: 491 ELDPAEADRLAEAAGDLEALGLVLEAFGHGAVLVREVPAALAGGSVRALLADVVD-VLQE 549

Query: 524 STTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKL 583
                L  R++ +L+ M+C+GSIR+GR+++  EMN LLREME  P S QCNHGRPT+++L
Sbjct: 550 GGADPLARRLDAVLSRMSCHGSIRAGRRLRPEEMNALLREMEATPLSGQCNHGRPTYVEL 609

Query: 584 KLSDIEKLFGR 594
           KL DIE+LFGR
Sbjct: 610 KLHDIERLFGR 620


>gi|302383491|ref|YP_003819314.1| DNA mismatch repair protein MutL [Brevundimonas subvibrioides ATCC
           15264]
 gi|302194119|gb|ADL01691.1| DNA mismatch repair protein MutL [Brevundimonas subvibrioides ATCC
           15264]
          Length = 617

 Score =  492 bits (1267), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 250/619 (40%), Positives = 372/619 (60%), Gaps = 28/619 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L  + +N+IAAGE++ERP+ AIKEL+EN+LDA ++R+E    GGG S   I D+G
Sbjct: 1   MPIRRLPPETVNRIAAGEVVERPASAIKELVENALDAGATRIEVQADGGGLSRILIADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSN------IHTFGFRGEALPSIGAVSHLTLMSRPPQ 114
            GM  +++ +AV+RH TSK+  D +       I T GFRGEALPSIG+V+ LT+ SR P 
Sbjct: 61  HGMAPDQLALAVERHATSKLEPDDAGDVDLLRISTLGFRGEALPSIGSVARLTITSRSPG 120

Query: 115 NNTGAQIAISGEKISSVRPVAM-NP-GTIVEVRDLFFTIPARLNFLKSEQVETNLITDVI 172
            +   QI + G     V P     P G  VEVRDLF+  PARL F+KSE+ E   I++ I
Sbjct: 121 GDA-HQITVEGGDQRPVAPAGFPGPHGARVEVRDLFYATPARLKFMKSERSEAMAISEEI 179

Query: 173 RRMAIAYPKVSFTFSTIKSN--RYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNE 230
           +R A+A+  V+FT         R         G   +R++ ++G DF  NA+ +++    
Sbjct: 180 KRQAMAHEGVAFTLDLDGRTTLRLPAEHPGDEGRL-KRLAALLGRDFEANALLIDQSREG 238

Query: 231 ITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEI 290
           I L GY G+PT++RGN    Y+F+NGR V+D+ +   +R AYA+ +   R+P  VL LEI
Sbjct: 239 IRLSGYAGLPTYSRGNGGHQYLFVNGRPVRDRLLQGALRGAYADFLARDRHPAAVLFLEI 298

Query: 291 DPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF--HQD 348
           DP  VDVNVHPAK+ +RFR+P ++R  I+ +++ A++  G   S+ ++  +++ F  H  
Sbjct: 299 DPLFVDVNVHPAKAEVRFRDPALVRGLIVGALRHALHAAGHRASTTVADSVLAGFTAHTG 358

Query: 349 NA--PKTHLPK-----------YATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDP 395
            A  P +   +           +   +   Q+   L E R +  +  P     + E +  
Sbjct: 359 AAFSPSSQTSQGFAGGFSGWTGWDRPVAANQDIPGLSE-RSARVEAPPPGFTGWPEQSGA 417

Query: 396 VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQ 455
              S+     LG A AQ+H  YI++QT DGLV+VDQHAAHERL++E+M+       +T Q
Sbjct: 418 ANTSDPIDQPLGAARAQVHGTYIVAQTRDGLVVVDQHAAHERLVYERMKVQMAQGSVTRQ 477

Query: 456 TLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRD 515
            LLTPE+++L   E   ++   ++L  LG+  E FG  A+ +RE PA+L   ++  L+RD
Sbjct: 478 ALLTPEVVELDPAEADRVLARADELAELGLIVEPFGGGAVLVRETPALLGDTDVQGLIRD 537

Query: 516 IIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNH 575
           I D++ +      L +R+  +  TMAC+GS+R+GR + + EMN LLR+ME  P+S QCNH
Sbjct: 538 IADDLAEHGAALALSERLGEVCGTMACHGSVRAGRVLSAPEMNALLRQMEATPHSGQCNH 597

Query: 576 GRPTFIKLKLSDIEKLFGR 594
           GRPT+++LKL D+EKLFGR
Sbjct: 598 GRPTYVELKLHDLEKLFGR 616


>gi|92118635|ref|YP_578364.1| DNA mismatch repair protein [Nitrobacter hamburgensis X14]
 gi|123083577|sp|Q1QIP3|MUTL_NITHX RecName: Full=DNA mismatch repair protein mutL
 gi|91801529|gb|ABE63904.1| DNA mismatch repair protein MutL [Nitrobacter hamburgensis X14]
          Length = 603

 Score =  492 bits (1267), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 232/603 (38%), Positives = 367/603 (60%), Gaps = 10/603 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E ++N+IAAGE++ERP+  +KEL+EN++DA + R++    GGG+    ITD+G
Sbjct: 1   MPVRQLPETVVNRIAAGEVVERPASVVKELVENAIDAGAGRIDIFTDGGGRRRIGITDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT  ++ +AV RH TSK+ D D   I T GFRGEALPSIGAV+ L + +R        
Sbjct: 61  GGMTKADLALAVDRHATSKLDDEDLLRIRTLGFRGEALPSIGAVAKLGITTRHGSEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + + G + S++ P A+  GT VEV DLF+  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 SLTVEGGRKSAIVPAALTQGTRVEVSDLFYATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSN--RYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P ++FT +  +     +        G    R+  ++G DF  +A+ +  + + +T++G+ 
Sbjct: 181 PDIAFTLAGEERAPVTWTAALPGAAGQL-TRLGDILGADFRCSAIAVRAERDGVTVEGFA 239

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
             P+  R NA   Y+F+NGR V+DK I+  +R AY++ +P  R+PVV L +   P++VD 
Sbjct: 240 AAPSLTRANALGQYLFVNGRPVRDKLIIGAVRAAYSDYLPRDRHPVVALFVTTAPQEVDA 299

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPK 357
           NVHPAK+ +RFRN  ++R  I+ ++++ + ++G  T++     ++++F     P+     
Sbjct: 300 NVHPAKTEVRFRNAGLVRALIVHALKEGLAREGRRTAANSDGAVLTAFRPAAVPRPANWD 359

Query: 358 YATSLTNTQEKLFLQENRLSTNDLLPSDD------PTYSEDNDPVEESEATHYQLGIACA 411
           +  S  +            +     P         P+    +DP   ++     LG A  
Sbjct: 360 WRQSPASPVGAGPWSGGATAAAFAAPGQTAFDVGAPSADVRSDPNPVADLIDRPLGAART 419

Query: 412 QIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECA 471
           QIH+ YI++QT DGL++VDQHAAHER+++EK++       +  Q LL P+I++L E    
Sbjct: 420 QIHETYIVTQTRDGLIVVDQHAAHERIVYEKLKAALERDGVQRQILLIPDIVELDEATVE 479

Query: 472 LIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQD 531
            +++   +L + G+  E FGP A+A+RE P++L K N   LLRD+ + + +      L+ 
Sbjct: 480 KLIDRAPELEKFGLAIESFGPGAVAVRETPSLLGKTNAAALLRDLAEHMAEWDEALPLER 539

Query: 532 RIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKL 591
           R+ ++ ATMAC+GS+R+GR ++  EMN LLREME  PNS QCNHGRPT+++LKL+DIEKL
Sbjct: 540 RLMHVAATMACHGSVRAGRILKPEEMNALLREMEDTPNSGQCNHGRPTYVELKLADIEKL 599

Query: 592 FGR 594
           FGR
Sbjct: 600 FGR 602


>gi|91206202|ref|YP_538557.1| DNA mismatch repair protein [Rickettsia bellii RML369-C]
 gi|122990884|sp|Q1RGP6|MUTL_RICBR RecName: Full=DNA mismatch repair protein mutL
 gi|91069746|gb|ABE05468.1| DNA mismatch repair protein MutL [Rickettsia bellii RML369-C]
          Length = 611

 Score =  492 bits (1266), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 258/615 (41%), Positives = 384/615 (62%), Gaps = 26/615 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LSE  IN+IAAGE+IERP+  +KEL+EN++DA S++++ ++   GK+   I+D+G
Sbjct: 1   MTIKLLSESTINRIAAGEVIERPASVVKELVENAVDAGSTKIDIILERAGKNLIIISDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +E+ +AV+RH TSK+ + DF NIHTFGFRGEALPSI A+S + + S+   N    
Sbjct: 61  VGMTDKELEIAVERHTTSKLDETDFLNIHTFGFRGEALPSIAAISKMLITSKKRDNQKAF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G     + P   N GT +E+RDLFF  PARL FL++++ E     DV++++A+A+
Sbjct: 121 QIKLIGGDEKQIAPAIHNEGTKIEIRDLFFATPARLKFLRTDKTELAATVDVVKKIALAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P++SF+ +       K+  Q+ +   N  +RI  VIGEDFI NA  ++ KS + ++ GYT
Sbjct: 181 PEISFSLTHDGKTLLKLKGQNKDAENNLKQRIIDVIGEDFIKNASYIDFKSPDFSIYGYT 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
            IPT+NR ++   ++FIN R V+DK +   +R AY + +P  RYP+  + L+IDP+ VDV
Sbjct: 241 SIPTYNRASSEDQFLFINNRPVKDKLLQVALRVAYQDYMPRDRYPLCAIFLQIDPQLVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPK 357
           NVHPAK+ +RF +P  +RN +I SI+ A++ K    S+ ++   I  F      K   P 
Sbjct: 301 NVHPAKAEVRFHDPNYVRNLLIDSIKNALSNKSHIASTTIASSAIELFKNPFVNKE--PA 358

Query: 358 YATSLTNTQEKLFLQENRLSTNDLLPSDDPTYS-----------------EDNDPVEESE 400
            +  L N   K    E R +T+  +P   P  S                 E     E  +
Sbjct: 359 ISKPL-NVNSK--PSEYRPATSPTVPKYTPNNSCQKLIDTLPHARIEQEVEQRIQNEPQK 415

Query: 401 ATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTP 460
           ++ Y+LG A AQ+H  Y+ISQT D +VI DQHAAHERL +EK++    + ++  Q LL P
Sbjct: 416 SSQYRLGAAKAQLHTTYVISQTEDSIVITDQHAAHERLGYEKIKNYIKNEELIKQRLLIP 475

Query: 461 EIIDLLEGECALIMEHDED-LHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDE 519
           EI++L + + A I+  ++D L +LG+  E+FG  +I + EIP IL   N+ +L++D+ D 
Sbjct: 476 EIVELPDEKRADILYENKDKLSKLGLSLEKFGEKSIIVTEIPNILGDINVQKLIQDLADH 535

Query: 520 IIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPT 579
           + +      L + IE++  T AC+ SIR+GRK+ + EMN LLR+ME  P S QCNHGRPT
Sbjct: 536 LAECGENIALTELIEHVTETYACHYSIRAGRKLSADEMNALLRQMENTPFSGQCNHGRPT 595

Query: 580 FIKLKLSDIEKLFGR 594
           +I+LKL DIE+LFGR
Sbjct: 596 YIELKLKDIERLFGR 610


>gi|154246983|ref|YP_001417941.1| DNA mismatch repair protein [Xanthobacter autotrophicus Py2]
 gi|154161068|gb|ABS68284.1| DNA mismatch repair protein MutL [Xanthobacter autotrophicus Py2]
          Length = 643

 Score =  491 bits (1265), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 243/623 (39%), Positives = 377/623 (60%), Gaps = 34/623 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L   +I++IAAGE++ERP+  +KEL+EN+LDA +  +E VI GGG+   +++D+G
Sbjct: 25  MLIRRLPPVLIDRIAAGEVVERPAAVVKELVENALDAGARAIEVVIQGGGRRLVRVSDDG 84

Query: 61  FGMTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM  +++ + V+RH TSK++ +D  +I T GFRGEALPSIG+V+HL + SRP       
Sbjct: 85  SGMGPDDLALCVERHATSKLAGEDLLSISTLGFRGEALPSIGSVAHLAIASRPRDAAHAF 144

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           ++ + G  ++  RP A+  GT VEVRDLF+  PARL FLKS++ E     DV+RR+A+A 
Sbjct: 145 EVRVDGGVVTPPRPAALGGGTRVEVRDLFYATPARLKFLKSDRAEGAAAADVVRRLALAR 204

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNF---PERISQVIGEDFINNAVELNEKSNEITLQGY 236
           P V+FT  T    R  + F +   +      R++ V+G +   N V +N   +++ L+G 
Sbjct: 205 PDVAFTLVT--DERAAVTFPARADDADGRAARLADVLGAEAGRNVVAVNGIRDDVVLEGL 262

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
            G+PTF++ N+   Y+F+NGR V+DK ++  +R AYA+ +P  RYPV+ L + +DPR VD
Sbjct: 263 AGLPTFSKANSLSQYLFVNGRPVRDKLLMGAVRAAYADLLPSDRYPVLALFISLDPRDVD 322

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMIS-SFHQDNAPKTHL 355
           VNVHPAK+ +RFR+   +R  I++++  A+  +  ST+  ++ ++++ +   +  P+   
Sbjct: 323 VNVHPAKTEVRFRDGGNVRALIVRTLSDALGARIPSTAGTMADRLVALARTPELGPRAAF 382

Query: 356 ------------------PKYATSLTNTQEKL-----FLQENRLSTNDLL-PSDDPTYSE 391
                             P  A      Q         L E   +  D+  PS D     
Sbjct: 383 APAAPFATPGGGAFAGFRPAPALDYDWRQSPARPMPSGLGEEEQARLDIAEPSAD--ARA 440

Query: 392 DNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK 451
           D  PV   +     LG A AQ+H+ YI++QT +GLV+VDQHAAHERL++EK++       
Sbjct: 441 DAAPVSAVD-LDRPLGAARAQLHETYIVAQTREGLVLVDQHAAHERLVYEKLKAALARDG 499

Query: 452 ITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQ 511
           +  Q LL P ++DL   +   + E   DL  LG+  E FGP A+ +RE+PA+L   ++ +
Sbjct: 500 VGRQGLLIPAVVDLDPADADRLTERAGDLAALGLVLESFGPGAVLVREVPALLKDADVTR 559

Query: 512 LLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSS 571
           L+ D+ +   +      L+ R+ ++ ATMAC+GS+R+GR+++  EMN LLREME+ PN+ 
Sbjct: 560 LVTDLAEHAAEWDDALPLERRLLHVAATMACHGSVRAGRRLKVEEMNALLREMEETPNAG 619

Query: 572 QCNHGRPTFIKLKLSDIEKLFGR 594
           +CNHGRPTF+ L L D+EKLF R
Sbjct: 620 ECNHGRPTFVTLSLKDVEKLFAR 642


>gi|146342898|ref|YP_001207946.1| DNA mismatch repair protein [Bradyrhizobium sp. ORS278]
 gi|166232077|sp|A4Z0Q5|MUTL_BRASO RecName: Full=DNA mismatch repair protein mutL
 gi|146195704|emb|CAL79731.1| DNA mismatch repair protein MutL [Bradyrhizobium sp. ORS278]
          Length = 613

 Score =  491 bits (1264), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 242/617 (39%), Positives = 373/617 (60%), Gaps = 28/617 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E++IN+IAAGE++ERP+  +KEL+EN++DA +SR++    GGG+    ITD+G
Sbjct: 1   MPVRQLPEQVINRIAAGEVVERPASVVKELVENAIDAGASRIDIFTDGGGRRKIAITDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT+ ++ +AV+RH TSK+ D D   I T GFRGEALPSIG+V+ L++ +R        
Sbjct: 61  GGMTAADLALAVERHATSKLDDEDLLQIRTLGFRGEALPSIGSVARLSITTRHKSEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            I +     S + P A+N GT VEV DLF   PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 GITVDCGDKSQIVPAALNQGTRVEVADLFHATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFP---ERISQVIGEDFINNAVELNEKSNEITLQGY 236
           P ++FT +     R  + + +     P    R+  ++G DF ++A+ +  + + + ++G+
Sbjct: 181 PDIAFTVA--GEERAPVTWAAALPGAPGQLTRLGDILGTDFRSHAIAVRSERDHVAVEGF 238

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
              P   R NA   Y+F+NGR V+DK IL  +R AYA+ +P  R+PVV L + +DPR+VD
Sbjct: 239 AAAPALTRANALGQYLFVNGRPVRDKLILGAVRAAYADYLPRDRHPVVALFVTLDPREVD 298

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH---------- 346
            NVHPAK+ +RFRN  ++R  II ++++ + ++G  T++      I++F           
Sbjct: 299 ANVHPAKTEVRFRNAGLVRALIIHALKEGLAREGRRTAANDGGATIAAFRPAFTPPRPSA 358

Query: 347 ------QDNAPKTHLPKY--ATSLTNTQEKLFLQENRLSTNDL-LPSDDPTYSEDNDPVE 397
                    +P   +P++    S+          E   +  D+  P  D    E      
Sbjct: 359 GPMNWDWQRSPSAPIPRHDDVDSMPPAVSSAAFAEPMQAAFDVGGPRADLRLHEQP---A 415

Query: 398 ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTL 457
             +     LG A  QIH  YI+SQT DGLVIVDQHAAHER+++E+++    +  +  Q L
Sbjct: 416 APDMLDRPLGAARTQIHDTYIVSQTRDGLVIVDQHAAHERIVYERLKTSLAAHGVQRQIL 475

Query: 458 LTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDII 517
           L P+I++L E     ++   ++L   G+  E FGP A+A+RE P++L K N   LLRD+ 
Sbjct: 476 LIPDIVELDEATVEALLARTDELAAFGLAVESFGPGAVAVRETPSLLGKINAAGLLRDLA 535

Query: 518 DEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGR 577
           + + +      L+ R+ ++ ATMAC+GS+R+GR+++  EMN LLR ME+ PNS QCNHGR
Sbjct: 536 EHMEEWGEALPLERRLMHVAATMACHGSVRAGRRLKPEEMNALLRVMEETPNSGQCNHGR 595

Query: 578 PTFIKLKLSDIEKLFGR 594
           PT+++LKL+D+EKLFGR
Sbjct: 596 PTYVELKLADVEKLFGR 612


>gi|229587254|ref|YP_002845755.1| DNA mismatch repair protein [Rickettsia africae ESF-5]
 gi|259511149|sp|C3PM22|MUTL_RICAE RecName: Full=DNA mismatch repair protein mutL
 gi|228022304|gb|ACP54012.1| DNA mismatch repair protein MutL [Rickettsia africae ESF-5]
          Length = 610

 Score =  491 bits (1264), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 256/620 (41%), Positives = 382/620 (61%), Gaps = 36/620 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LSE  IN+IAAGE+IERP+  +KEL+EN++DA S++++ V+   GK+   I+D+G
Sbjct: 1   MTIKFLSESTINRIAAGEVIERPASVVKELVENAVDASSTKIDIVLERAGKNLIIISDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +E+ +AV+RH TSK  + DF NI+TFGFRGEALPSI A+S + + S+    +   
Sbjct: 61  IGMTDKELEIAVERHTTSKFDESDFLNINTFGFRGEALPSIAAISKMLITSKKRDADKAF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G     V     N GT +E+RDLFF  PARL FL++++ E     DV++++A+A+
Sbjct: 121 QIKLIGGNEKQVTISVHNEGTKIEIRDLFFATPARLKFLRADKTELAATVDVVKKIALAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           PK+SF+ +    N  K+  Q+ +   N  +RI  VIG+DFI NA  ++ K+ + ++ GYT
Sbjct: 181 PKISFSLTHDGKNLLKLKGQNKDAETNLKQRIIDVIGDDFIKNAAYIDFKTPDFSICGYT 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
             PT+NR ++   ++FIN R+V+DK +   +R AY + +   RYP+  + L+IDP+ VDV
Sbjct: 241 SSPTYNRASSEDQFLFINNRSVKDKLLQVALRVAYQDYLARDRYPICAIFLQIDPQLVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ---------- 347
           NVHPAK+ +RF +P  +RN +I++I+ A+  K   TS+ ++   +  F            
Sbjct: 301 NVHPAKAEVRFHDPNYVRNLLIEAIKNALTNKSHVTSTTIASDALELFKNPLVNKQSPVS 360

Query: 348 ----------DNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVE 397
                     D  P TH      S  NT  +  + +  + T     S      E  + +E
Sbjct: 361 KVINVNSKSADYRPTTH------STLNTVPQNHVCQKLIDT----LSHAKIEQEVENRIE 410

Query: 398 ESEAT--HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQ 455
             + T   Y+LG A AQ+H  YIISQT D +VI DQHAAHERL +EK++    + ++  Q
Sbjct: 411 HEQQTRKQYKLGAAKAQLHTTYIISQTEDSIVITDQHAAHERLGYEKIKDYLKTEELIKQ 470

Query: 456 TLLTPEIIDLL-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLR 514
            LL PEI++LL E +   + +H E L++LG+  E+FG  +I + EIP IL   N+ +L++
Sbjct: 471 RLLIPEIVELLNEKKADCLYDHREKLYKLGLTLEKFGEKSIIVTEIPNILGDVNVQKLIQ 530

Query: 515 DIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCN 574
           D+ D + D      L + IE++  T AC+ SIR+GRK+ + EMN LLR+ME  P S QCN
Sbjct: 531 DLADHLSDFGKNIALTELIEHVTETYACHYSIRAGRKLSADEMNALLRQMENTPLSGQCN 590

Query: 575 HGRPTFIKLKLSDIEKLFGR 594
           HGRPT+I+LKL DIE+LFGR
Sbjct: 591 HGRPTYIELKLKDIERLFGR 610


>gi|300024107|ref|YP_003756718.1| DNA mismatch repair protein MutL [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525928|gb|ADJ24397.1| DNA mismatch repair protein MutL [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 593

 Score =  491 bits (1263), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 245/602 (40%), Positives = 380/602 (63%), Gaps = 18/602 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+LS + +N+IAAGE+IERP+  +KEL+EN++D+ ++ +E V+  GG S  ++TD+G
Sbjct: 1   MAIRQLSPETVNRIAAGEVIERPASVVKELVENAIDSGATHIEIVVTDGGLSLIRVTDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM ++++ +AV+RH TSK+ + D  +I + GFRGEALPSIG+++ L + SR   +  G 
Sbjct: 61  SGMNADDLALAVERHATSKLDEEDLFDIRSLGFRGEALPSIGSIAELEIRSRRRDSEQGF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            I +      S++P A N GTIVEVRDLF   PARL FLKSE+ ET  +TDV+RR+A+A+
Sbjct: 121 SIRVMRGAKESIKPAAANSGTIVEVRDLFSATPARLKFLKSERAETMAVTDVVRRLAMAH 180

Query: 180 PKVSFTFSTIKSNR--YKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSN----EITL 233
           P++ FT  T +     Y    +S++  + ER+  ++G +F+ +A+E++   +     + +
Sbjct: 181 PEIGFTLQTGEKRPVVYPRGERSSSA-WLERLGAIMGHEFMADALEISGGGSGALGPMRV 239

Query: 234 QGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPR 293
            G+ G+PT +R ++ Q ++F+NGR+V+DK ++  IR AY + IP GR P++ + L++ P 
Sbjct: 240 FGFIGLPTLHRADSMQQFLFVNGRSVKDKLLIGAIRAAYGDLIPRGRSPLLAIFLDVAPP 299

Query: 294 QVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKT 353
            VDVNVHPAK+ +RFR+   +R+ +I ++++A+   G   S+      I +F        
Sbjct: 300 DVDVNVHPAKAEVRFRDAGRVRSLMIGAMRQALEAAGHRASAQGGVLTIETF------SA 353

Query: 354 HLPKYATSLTNTQEKLFLQENRLSTNDL-LPSDDPTYSEDNDPVEESEATHYQLGIACAQ 412
            +   A      Q   F +   ++  ++  PS D    E   P    +     LG   AQ
Sbjct: 354 GVLPSAPPALPPQTAAFAEPAPVAFAEIDTPSADMRAPE---PERHEQTIDKPLGAVRAQ 410

Query: 413 IHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECAL 472
           +H+NYI++QT DGLVIVDQHAAHERL++EK +    +  + +Q LL P I+ L   +  L
Sbjct: 411 VHENYIVAQTRDGLVIVDQHAAHERLVYEKFKVALTNGGVATQGLLIPAIVTLDPDDAEL 470

Query: 473 IMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDR 532
           +    ++L  LG+  E FG  A+A+RE PA+L   +I  L++D+  E+    T   L+DR
Sbjct: 471 LCTRADELAELGLVLESFGEGAVAVRETPALLGDTDIDGLVKDLAAELRADGTARALKDR 530

Query: 533 IENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLF 592
           +E + + MAC+GS+RSGR++   EMN LLR+ME  P S QCNHGRPT++ LKLSDIE+LF
Sbjct: 531 LEAVASRMACHGSVRSGRRLTVEEMNALLRQMEATPYSGQCNHGRPTYVALKLSDIERLF 590

Query: 593 GR 594
           GR
Sbjct: 591 GR 592


>gi|157827812|ref|YP_001496876.1| DNA mismatch repair protein [Rickettsia bellii OSU 85-389]
 gi|166232103|sp|A8GY89|MUTL_RICB8 RecName: Full=DNA mismatch repair protein mutL
 gi|157803116|gb|ABV79839.1| DNA mismatch repair protein [Rickettsia bellii OSU 85-389]
          Length = 611

 Score =  488 bits (1257), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 256/613 (41%), Positives = 383/613 (62%), Gaps = 22/613 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LSE  IN+IAAGE+IERP+  +KEL+EN++DA S++++ ++   GK+   I+D+G
Sbjct: 1   MTIKLLSESTINRIAAGEVIERPASVVKELVENAVDAGSTKIDIILERAGKNLIIISDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +E+ +AV+RH TSK+ + DF NIHTFGFRGEALPSI A+S + + S+   N    
Sbjct: 61  VGMTDKELEIAVERHTTSKLDETDFLNIHTFGFRGEALPSIAAISKMLITSKKRDNQKAF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G     + P   N GT +E+RDLFF  PARL FL++++ E     DV++++A+A+
Sbjct: 121 QIKLIGGDEKQIAPAIHNEGTKIEIRDLFFATPARLKFLRTDKTELAATVDVVKKIALAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P++SF+ +       K+  Q+ +   N  +RI  VIGEDFI NA  ++ KS + ++ GYT
Sbjct: 181 PEISFSLTHDGKTLLKLKGQNKDAENNLKQRIIDVIGEDFIKNASYIDFKSPDFSIYGYT 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
            IPT+NR ++   ++FIN R V+DK +   +R AY + +   RYP+  + L+IDP+ VDV
Sbjct: 241 SIPTYNRASSEDQFLFINNRPVKDKLLQVALRVAYQDYMLRDRYPLCAIFLQIDPQLVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ---DNAPKTH 354
           NVHPAK+ +RF +P  +RN +I SI+ A++ K    S+ ++   I  F     +  P   
Sbjct: 301 NVHPAKAEVRFHDPNYVRNLLIDSIKNALSNKSHIASTTIASSAIELFKNPFVNKEPAIS 360

Query: 355 LP--------KYATSLTNTQEKLFLQENRLSTNDLLP----SDDPTYSEDNDPVEESEAT 402
            P        KY  + + T  K     +     D LP      +      N+P + S+  
Sbjct: 361 KPLNVNSKPSKYRPATSPTVPKYTPNNSCQKLIDTLPHARIEQEVEQRIQNEPQKSSQ-- 418

Query: 403 HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEI 462
            Y+LG A AQ+H  Y+ISQT D +VI DQHAAHERL +EK++    + ++  Q LL PEI
Sbjct: 419 -YRLGAAKAQLHTTYVISQTEDSIVITDQHAAHERLGYEKIKNYIKNEELIKQRLLIPEI 477

Query: 463 IDLLEGECALIMEHDED-LHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEII 521
           ++L + + A I+  ++D L +LG+  E+FG  +I + EIP IL   N+ +L++D+ D + 
Sbjct: 478 VELPDEKRADILYENKDKLSKLGLSLEKFGEKSIIVTEIPNILGDINVQKLIQDLADHLA 537

Query: 522 DSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFI 581
           +      L + IE++  T AC+ SIR+GRK+ + EMN LLR+ME  P S QCNHGRPT+I
Sbjct: 538 ECGENIALTELIEHVTETYACHYSIRAGRKLSADEMNALLRQMENTPFSGQCNHGRPTYI 597

Query: 582 KLKLSDIEKLFGR 594
           +LKL DIE+LFGR
Sbjct: 598 ELKLKDIERLFGR 610


>gi|170744658|ref|YP_001773313.1| DNA mismatch repair protein MutL [Methylobacterium sp. 4-46]
 gi|168198932|gb|ACA20879.1| DNA mismatch repair protein MutL [Methylobacterium sp. 4-46]
          Length = 641

 Score =  487 bits (1254), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 242/631 (38%), Positives = 379/631 (60%), Gaps = 40/631 (6%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           +R+L   ++++IAAGE++ERP+ A+KEL+EN++DA ++ +E  I  GG+   ++ D+G G
Sbjct: 11  VRRLDPVLVDRIAAGEVVERPAAAVKELVENAIDAGATSIEVTIQAGGRRLIRVVDDGIG 70

Query: 63  MTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M++E++ +AV+RH TSK+ D D   I T GFRGEALPSIGAV+ L+L+SR  +  +G  +
Sbjct: 71  MSAEDLALAVERHATSKLPDGDLDRIDTLGFRGEALPSIGAVARLSLVSRTAEAASGHGL 130

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +       VRPVA   GT VEV DLF   PARL FLKS++ E   + +++RR+A+A+P+
Sbjct: 131 VVDAGIRGPVRPVAAERGTRVEVTDLFAATPARLKFLKSDRAEAGAVAEILRRLAVAHPQ 190

Query: 182 VSFTF-STIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
           + FT         + +  ++  G++  R++ V+G DF  N+  L+ +     L G+ G+P
Sbjct: 191 IRFTLRGESGGGGFVLPAETGPGSWLRRLAAVLGPDFAENSAPLSLEREGFALDGHVGLP 250

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TF+R  A   +  +NGR V+D+ +L  +R AYA+ +   R+PV+ L L  DP QVDVNVH
Sbjct: 251 TFHRAAATHMHFVVNGRPVRDRLLLGAVRGAYADVMASDRHPVLALALTCDPTQVDVNVH 310

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAP-KTHLPKYA 359
           PAK+ +RFR P ++R  I+ +I +A+ ++G  +++ ++ + + S      P     P  A
Sbjct: 311 PAKTEVRFREPGLVRGLIVNAIHEALRREGGRSAASVAARTLESLRPAQTPLPMQAPLAA 370

Query: 360 TSLT----------NTQEKLFLQENRLSTNDLLPSDD---PTYSEDNDP----------- 395
            S +            + + F Q+   + +   PS D   P  ++   P           
Sbjct: 371 RSASPDARRSDPPRGGRAEPFAQDGPFAQDGPGPSPDGREPFGAQAGPPPGFAEAAQASF 430

Query: 396 ------------VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKM 443
                           E   + LG A AQ+H+ YI++QT DG+VIVDQHAAHERL++E++
Sbjct: 431 AAEALPPAAEARPPAPETPAHPLGAARAQLHETYIVAQTRDGIVIVDQHAAHERLVYERL 490

Query: 444 RQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAI 503
           +++  +  I  Q LL PE+++L   E   + E  EDL  LG+  E FG  A+ +RE+PA 
Sbjct: 491 KREREAGGIARQLLLIPEVVELDPAEADRLAEAAEDLAALGLVLEGFGHGAVLVREVPAA 550

Query: 504 LSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLRE 563
           L+   +  LL D++D ++       L  R++ +L+ M+C+GSIR+GR+++  EMN LLRE
Sbjct: 551 LAGGGVRALLTDVVD-VLQEGGADPLARRLDAVLSRMSCHGSIRAGRRLRPEEMNALLRE 609

Query: 564 MEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ME  P S QCNHGRPT+++LKL DIE+LFGR
Sbjct: 610 MEATPLSGQCNHGRPTYVELKLHDIERLFGR 640


>gi|158424017|ref|YP_001525309.1| DNA mismatch repair protein [Azorhizobium caulinodans ORS 571]
 gi|172047960|sp|A8I6D2|MUTL_AZOC5 RecName: Full=DNA mismatch repair protein mutL
 gi|158330906|dbj|BAF88391.1| DNA mismatch repair protein [Azorhizobium caulinodans ORS 571]
          Length = 625

 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 238/626 (38%), Positives = 384/626 (61%), Gaps = 34/626 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L   +I++IAAGE++ERP+ A+KEL+EN++DA ++ +E ++ GGG+   +I+DNG
Sbjct: 1   MTIRRLPPVLIDRIAAGEVVERPAAAVKELVENAIDAGATEIEVLVVGGGREMIRISDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM+++E+ +AV+RH TSK+ ++D   I T GFRGEALPSIGAV+ L++ SRP       
Sbjct: 61  SGMSADELSLAVERHATSKLPTEDLLAISTLGFRGEALPSIGAVARLSIASRPKSAPHAF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +I + G  ++  RP A+N GT VEVRDLFF  PARL FLKS++ E     DV+RR+A+A 
Sbjct: 121 EIRVEGGVVTPPRPAALNGGTRVEVRDLFFATPARLKFLKSDRAEAAAAADVVRRLALAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTN---GNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
           P V+FT  T   +R  + + + +        R++ V+G +   N + +  +   + L G 
Sbjct: 181 PDVAFTLMT--DDRQPLTWVARSMDEAGRAARVADVLGAEAGRNLIPVVGERGGVRLVGL 238

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
            G+PT+++ N+   ++F+NGR V+DK ++  +R AY++ +P  RYPV+ L L +DPR+VD
Sbjct: 239 AGLPTYSKANSLSQFLFVNGRPVRDKLLMGALRAAYSDLLPSDRYPVLALFLSLDPREVD 298

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH----QDNAPK 352
           VNVHPAK+ +RFR+   +R  +++++  A+  +  ST+  ++ +++        +   P 
Sbjct: 299 VNVHPAKTEVRFRDGGNVRALLVRTLTDALAARVPSTAGTIADRLVELARTPELEPARPA 358

Query: 353 THLPKY--------ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSE------------- 391
             +P++             + +       N    +  L ++  +++E             
Sbjct: 359 AAIPEFRPYRAEPMPAGGYDWRASPARPLNVAEPDGALEAEMESFAEAVQASFDVGMPAA 418

Query: 392 ---DNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFN 448
               +  V E+      LG A AQ+H+ YI++QT +G+V+VDQHAAHERL++EK++    
Sbjct: 419 DARADAAVPETGDLDRPLGAARAQLHETYIVAQTREGMVLVDQHAAHERLVYEKLKAALE 478

Query: 449 STKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKN 508
              +  Q LL P ++DL   E   + E   DL  LG+  E FG  A+ +RE+PA+L+K +
Sbjct: 479 RDGVARQGLLVPAVVDLDPAEADRLAERAGDLAALGLVIEPFGIGAVLVREVPALLAKAD 538

Query: 509 IPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNP 568
           + +L+RD+ +   +      L+ R+ ++ ATMAC+GS+R+GR+++  EMN LLREME+ P
Sbjct: 539 VTKLVRDVAEHSAEWDDALPLERRLLHVAATMACHGSVRAGRRLRVEEMNALLREMEETP 598

Query: 569 NSSQCNHGRPTFIKLKLSDIEKLFGR 594
           N+ +CNHGRPTFI L L D+EKLF R
Sbjct: 599 NAGECNHGRPTFITLSLKDVEKLFAR 624


>gi|34581050|ref|ZP_00142530.1| DNA mismatch repair protein MutL [Rickettsia sibirica 246]
 gi|28262435|gb|EAA25939.1| DNA mismatch repair protein MutL [Rickettsia sibirica 246]
          Length = 610

 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 253/613 (41%), Positives = 382/613 (62%), Gaps = 22/613 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LSE  IN+IAAGE+IERP+  +KEL+EN++DA S++++ ++   GK+   I+D+G
Sbjct: 1   MTIKFLSESTINRIAAGEVIERPASVVKELVENAVDASSTKIDIILERAGKNLIIISDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +E+ +AV+RH TSK  + DF NI+TFGFRGEALPSI A+S + + S+    +   
Sbjct: 61  IGMTDKELEIAVERHTTSKFDESDFLNINTFGFRGEALPSIAAISKMLITSKKRDADKAF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G     V     N GT +E+RDLFF  PARL FL++++ E     DV++++A+A+
Sbjct: 121 QIKLIGGNEKQVTISVHNEGTKIEIRDLFFATPARLKFLRADKTELAATVDVVKKIALAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           PK+SF+ +    N  K+  Q+ +   N  +RI  VIG+DFI NA  ++ K+ + ++ GYT
Sbjct: 181 PKISFSLTHDGKNLLKLKGQNKDAETNLKQRIIDVIGDDFIKNAAYIDFKTPDFSICGYT 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
             PT+NR ++   ++FIN R V+DK +   +R AY + +   RYP+  + L+IDP+ VDV
Sbjct: 241 SSPTYNRASSEDQFLFINNRPVKDKLLQVALRVAYQDYLARDRYPICAIFLQIDPQLVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPK 357
           NVHPAK+ +RF +P  +RN +I++I+ A+  K   TS+ ++   +  F     P  +   
Sbjct: 301 NVHPAKAEVRFHDPNYVRNLLIEAIKNALTNKSHVTSTTIASDALELFKN---PLVNKQS 357

Query: 358 YATSLTNTQEK-LFLQENRLSTNDLLP------------SDDPTYSEDNDPVEESEAT-- 402
             + + N   K    +    ST +++P            S      E  + +E  + T  
Sbjct: 358 PVSKVINVNSKSADYRPTTHSTLNIVPQNHVCQKLIDTLSHAKIEQEVENRIEHEQQTRK 417

Query: 403 HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEI 462
            Y+LG A AQ+H NYIISQT D +VI DQHAAHERL +EK++    + ++  Q LL PEI
Sbjct: 418 QYKLGAAKAQLHTNYIISQTEDSIVITDQHAAHERLGYEKIKDYLKTEELIKQRLLIPEI 477

Query: 463 IDLL-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEII 521
           ++L  E +   + +H E L++LG+  E+FG  +I + EIP IL   N+ +L++D+ D + 
Sbjct: 478 VELPNEKKADCLYDHREKLYKLGLTLEKFGEKSIIVTEIPNILGDVNVQKLIQDLADHLS 537

Query: 522 DSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFI 581
           D      L + IE++  T AC+ SIR+GRK+ + EMN LLR+ME  P S QCNHGRPT+I
Sbjct: 538 DFGKNIALTELIEHVTETYACHYSIRAGRKLSADEMNALLRQMENTPLSGQCNHGRPTYI 597

Query: 582 KLKLSDIEKLFGR 594
           +LKL DIE+LFGR
Sbjct: 598 ELKLKDIERLFGR 610


>gi|157965005|ref|YP_001499829.1| DNA mismatch repair protein [Rickettsia massiliae MTU5]
 gi|157844781|gb|ABV85282.1| DNA mismatch repair protein MutL [Rickettsia massiliae MTU5]
          Length = 615

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 252/611 (41%), Positives = 381/611 (62%), Gaps = 17/611 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LSE  INQIAAGE+IERP+  +KEL+EN++DA S++++ ++   GK+   I+D+G
Sbjct: 5   MTIKFLSESTINQIAAGEVIERPASVVKELVENAVDASSTKIDIILERAGKNLIIISDDG 64

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +E+ +AV+RH TSK  + DF NIHTFGFRGEALPSI A+S + + S+    +   
Sbjct: 65  IGMTDKELEIAVERHTTSKFDESDFLNIHTFGFRGEALPSIAAISKMLITSKKRDADKAF 124

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G     V     N GT +E+RDLFF  PARL FL++++ E     DV++++A+A+
Sbjct: 125 QIKLIGGNEKQVTISVHNEGTKIEIRDLFFATPARLKFLRADKTELAATVDVVKKIALAH 184

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P+ SF+ +    N  K+  Q+ +   N  +RI  VIG+DFI NA  ++ K+   ++ GYT
Sbjct: 185 PETSFSLTHDGKNLLKLKGQNKDAKTNLKQRIIDVIGDDFIKNAAYIDFKTPNFSICGYT 244

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
             PT+NR ++   ++FIN R V+DK +   +R AY + +   RYP+  + L+IDP+ VDV
Sbjct: 245 SSPTYNRASSEDQFLFINNRPVKDKLLQVALRVAYQDYLARDRYPLCAIFLQIDPQLVDV 304

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAI-NKKGISTSSVLSKKMISSFHQ----DNAPK 352
           NVHPAK+ +RF +P  +RN +I++I+ A+ NK  +++S+ ++   +  F        +P 
Sbjct: 305 NVHPAKAEVRFHDPNYVRNLLIEAIKNALTNKSHVTSSTTIASDALELFKNPLVNKQSPV 364

Query: 353 THLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYS------EDNDPVEESEAT--HY 404
           + + K  +   + +       N +  N +      T S      E  + +E  + T   Y
Sbjct: 365 SKVIKVNSKSADYRPTTHSTLNTVPQNHVCQKLIDTLSHAKIEQEVENRIEHEQQTRKQY 424

Query: 405 QLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIID 464
           +LG A AQ H  YIISQT D +VI DQHAAHERL +EK++    + ++  Q LL PEI++
Sbjct: 425 KLGAAKAQFHTTYIISQTEDSIVITDQHAAHERLGYEKIKDYLKTEELIKQRLLIPEIVE 484

Query: 465 LL-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDS 523
           L  E +   + +H E L++LG+  E+FG  +I + EIP IL   N+ +L++D+ D + D 
Sbjct: 485 LPNEKKADCLYDHREKLYKLGLTLEKFGEKSIIVTEIPNILGDVNVQKLIQDLADHLSDF 544

Query: 524 STTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKL 583
                L + IE++  T AC+ SIR+GRK+ + EMN LLR+ME  P S QCNHGRPT+I+L
Sbjct: 545 GKNIALTELIEHVTKTYACHYSIRAGRKLSADEMNALLRQMENTPLSGQCNHGRPTYIEL 604

Query: 584 KLSDIEKLFGR 594
           KL DIE+LFGR
Sbjct: 605 KLKDIERLFGR 615


>gi|323135584|ref|ZP_08070667.1| DNA mismatch repair protein MutL [Methylocystis sp. ATCC 49242]
 gi|322398675|gb|EFY01194.1| DNA mismatch repair protein MutL [Methylocystis sp. ATCC 49242]
          Length = 602

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 244/605 (40%), Positives = 375/605 (61%), Gaps = 19/605 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L   ++++IAAGE++ERP+ A+KEL+EN+LDA ++R++  I  GG+   ++ D+G
Sbjct: 5   MPVRRLDPILVDRIAAGEVVERPASAVKELVENALDAGATRIDVAIEEGGRKLIRVIDDG 64

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM   ++ +AV+RH TSKI D D ++I T GFRGEALPSI AV+ LT+ +R      G 
Sbjct: 65  CGMDENDLALAVERHATSKIPDGDLTHIATLGFRGEALPSIAAVADLTIDTRAQNAPHGF 124

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            I +       +   +   GT +E R LF   PARL FLK+E+ ET  + DV++R+A+A+
Sbjct: 125 SIRVEAGDRRGLTASSWPRGTRIEARALFAATPARLKFLKTERTETAAVVDVVKRLAMAH 184

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFP---ERISQVIGEDFINNAVELNEKSNEITLQGY 236
           P V F FS    N    ++ +   +      RI+QV+GE+F  NA+E++ +   + L G 
Sbjct: 185 PDVRFGFSA--DNGALFDYPACGDDAAGRARRIAQVLGEEFRANAIEIDAERAGVRLTGL 242

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
             +PT+NRGNA   YV++NGR V+DK     IR AY + +   R+PVV L +  DPR VD
Sbjct: 243 ASLPTYNRGNAQLQYVYVNGRPVRDKLFAGAIRAAYLDFLSPDRHPVVALFIGCDPRIVD 302

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLP 356
           VNVHPAK+ +RF +P ++R  ++ ++++A+ +K    S+  ++  + +F + NA +   P
Sbjct: 303 VNVHPAKAEVRFADPGLVRGLVVGALKQALAEKS-HRSADTARAAVETFARANAARHDAP 361

Query: 357 KYATSLTNTQEKL-------FLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIA 409
             A    N   +        F +  + + +   P+ D    E   P ++++A    LG A
Sbjct: 362 WRAPPPANWDIRHSPHAPSGFAESPQAAFDVGAPAADARVHEA--PAQDTDAP---LGAA 416

Query: 410 CAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGE 469
            AQ+H+ YII+QT DGLVIVDQHAAHERL++EK+++    T +  Q LL P ++DL E  
Sbjct: 417 RAQLHETYIIAQTRDGLVIVDQHAAHERLVYEKLKRQREETGVARQMLLIPVVVDLDESR 476

Query: 470 CALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTL 529
              +    ++L  LG+  E FGP A+ +RE P+IL + +  +L+ DI D + +      L
Sbjct: 477 MNALAGAFDELAALGLALEPFGPGAVLVREAPSILGEVDHRRLVEDIADLLAEDGDARGL 536

Query: 530 QDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIE 589
             R++++LAT AC+ S+R+GR++ + EMN LLREME  P + QCNHGRPT+++LKL+DIE
Sbjct: 537 SRRLDHVLATCACHHSVRAGRRLGAAEMNALLREMETTPGAGQCNHGRPTYVELKLADIE 596

Query: 590 KLFGR 594
           KLFGR
Sbjct: 597 KLFGR 601


>gi|15893284|ref|NP_360998.1| DNA mismatch repair protein [Rickettsia conorii str. Malish 7]
 gi|20455107|sp|Q92FW6|MUTL_RICCN RecName: Full=DNA mismatch repair protein mutL
 gi|15620505|gb|AAL03899.1| DNA mismatch repair protein MutL [Rickettsia conorii str. Malish 7]
          Length = 610

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 254/620 (40%), Positives = 381/620 (61%), Gaps = 36/620 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LSE  IN+IAAGE+IERP+  +KEL+EN++DA S++++ ++   GK+   I+D+G
Sbjct: 1   MTIKFLSESTINRIAAGEVIERPASVVKELVENAVDASSTKIDIILERAGKNLIIISDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +E+ +AV+RH TSK  + DF NI+TFGFRGEALPSI A+S + + S+    +   
Sbjct: 61  IGMTDKELEIAVERHTTSKFDESDFLNINTFGFRGEALPSIAAISKMLITSKKRDADKAF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G     V     N GT +E+RDLFF  PARL FL++++ E     DV++++A+A+
Sbjct: 121 QIKLIGGNEKQVTISVHNEGTKIEIRDLFFATPARLKFLRADKTELTATVDVVKKIALAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           PK+SF+ +    N  K+  Q+ +   N  +RI  VIG+DFI NA  ++ K+ + ++ GYT
Sbjct: 181 PKISFSLTHDGKNLLKLKGQNKDAETNLKQRIIDVIGDDFIKNAAYIDFKTPDFSICGYT 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
             PT+NR ++   ++FIN R V+DK +   +R AY + +   RYP+  + L+IDP+ VDV
Sbjct: 241 SSPTYNRASSEDQFLFINNRPVKDKLLQVALRVAYQDYLARDRYPICAIFLQIDPQLVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ---------- 347
           NVHPAK+ +RF +P  +RN +I++I+ A+  K   TS+ ++  ++  F            
Sbjct: 301 NVHPAKAEVRFHDPNYVRNLLIEAIKNALTNKSHVTSTTIASDVLELFKNPLVNKQSPVS 360

Query: 348 ----------DNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVE 397
                     D  P TH      S  NT  +  + +  + T     S      E  + +E
Sbjct: 361 KVINVNSKSADYRPTTH------STLNTVPQNHVCQKLIDT----LSHAKIEQEVENRIE 410

Query: 398 ESEAT--HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQ 455
             + T   Y+LG A AQ+H  YIISQT D +VI DQHAAHERL +EK++    + ++  Q
Sbjct: 411 HEQQTRKQYKLGAAKAQLHTTYIISQTEDSIVITDQHAAHERLGYEKIKDYLKTEELIKQ 470

Query: 456 TLLTPEIIDLL-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLR 514
            LL PEI++L  E +   + +H E L++LG+  E+FG  +I + EIP IL   N+ +L++
Sbjct: 471 RLLIPEIVELPNEKKADCLYDHREKLYKLGLTLEKFGEKSIIVTEIPNILGDVNVQKLIQ 530

Query: 515 DIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCN 574
           D+ D + D      L + IE++  T AC+ SIR+GRK+ + EMN LLR+ME  P S QCN
Sbjct: 531 DLADHLSDFGKNIALTELIEHVTETYACHYSIRAGRKLSADEMNALLRQMENTPLSGQCN 590

Query: 575 HGRPTFIKLKLSDIEKLFGR 594
           HGRPT+I+LKL DIE+LFGR
Sbjct: 591 HGRPTYIELKLKDIERLFGR 610


>gi|67459779|ref|YP_247403.1| DNA mismatch repair protein [Rickettsia felis URRWXCal2]
 gi|75535831|sp|Q4UJQ1|MUTL_RICFE RecName: Full=DNA mismatch repair protein mutL
 gi|67005312|gb|AAY62238.1| DNA mismatch repair protein MutL [Rickettsia felis URRWXCal2]
          Length = 609

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 255/619 (41%), Positives = 381/619 (61%), Gaps = 35/619 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LSE  IN+IAAGE+IERP+  +KEL+EN++DA S++++ ++   GK+   I+D+G
Sbjct: 1   MTIKFLSESTINRIAAGEVIERPASVVKELVENAVDAGSTKIDIILERAGKNLIIISDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +E+ +AV+RH TSK+ + DF NIHTFGFRGEALPSI A+S + + S+    +   
Sbjct: 61  IGMTDKELEIAVERHTTSKLDESDFLNIHTFGFRGEALPSIAAISKMLITSKKQGADKAF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G     V     N GT +E+RDLFF  PARL FL++++ E     DV++++A+A+
Sbjct: 121 QIKLIGGNEKQVTVSVHNEGTKIEIRDLFFATPARLKFLRADKTELAATVDVVKKIALAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P++SF+ +    N  K   Q+ +   N  +RI  VIG+DFI NA  ++ K+ + ++ GYT
Sbjct: 181 PEISFSLTHDDRNLLKFKGQNKDAETNLKQRIIDVIGDDFIKNAAYIDFKTPDFSICGYT 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
            IPT+NR ++   ++FIN R V+DK +   +R AY + +   RYP+  + L+IDP+ VDV
Sbjct: 241 SIPTYNRASSEDQFLFINNRPVKDKLLQVALRVAYQDYLARDRYPLCAIFLQIDPQLVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ---------- 347
           NVHPAK+ +RF +P  +RN +I++I+ A+  K   TS+ ++   +  F            
Sbjct: 301 NVHPAKAEVRFHDPNYVRNLLIEAIKNALTNKSHVTSTTIASDALQLFKNPLVNKQPSVS 360

Query: 348 -----DNAPKTHLPKYATSLTNTQ----EKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE 398
                ++ P  + P  + S   T     +KL          D LP       E    +E 
Sbjct: 361 KAVSVNSKPADYRPAMSPSFKPTPNTACQKLI---------DTLPH-AKIEQEVERRIEH 410

Query: 399 SEATH--YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQT 456
            +  H  Y+LG A AQ+H  YIISQT D +VI DQHAAHERL +EK++    + ++  Q 
Sbjct: 411 EQQVHKQYKLGAAKAQLHTTYIISQTEDSIVITDQHAAHERLGYEKIKDYLKTEELIKQR 470

Query: 457 LLTPEIIDLL-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRD 515
           LL PEI++L  E +   + E+ E L++LG+  E+FG  +I + EIP IL   N+ +L++D
Sbjct: 471 LLIPEIVELPNERKADCLYENREKLYKLGLTLEKFGEKSIIVTEIPNILEDVNVQKLIQD 530

Query: 516 IIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNH 575
           + D + D      L + IE++  T AC+ SIR+GRK+ + EMN LLR+ME  P S QCNH
Sbjct: 531 LADHLSDFGENIALTELIEHVTETYACHYSIRAGRKLSADEMNALLRQMENTPFSGQCNH 590

Query: 576 GRPTFIKLKLSDIEKLFGR 594
           GRPT+I+LKL DIE+LFGR
Sbjct: 591 GRPTYIELKLKDIERLFGR 609


>gi|75676732|ref|YP_319153.1| DNA mismatch repair protein [Nitrobacter winogradskyi Nb-255]
 gi|123745646|sp|Q3SPJ0|MUTL_NITWN RecName: Full=DNA mismatch repair protein mutL
 gi|74421602|gb|ABA05801.1| DNA mismatch repair protein MutL [Nitrobacter winogradskyi Nb-255]
          Length = 603

 Score =  486 bits (1250), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 235/607 (38%), Positives = 367/607 (60%), Gaps = 18/607 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E ++N+IAAGE++ERP+  +KEL+EN++DA ++R++    GGG+    +TD+G
Sbjct: 1   MPVRQLPETVVNRIAAGEVVERPASVVKELVENAIDAGATRIDVFTDGGGRRRIGVTDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM   ++ +AV RH TSK+ D D   I T GFRGEALPSIGAV+ L + +R  +     
Sbjct: 61  AGMAKGDLALAVDRHATSKLDDEDLLGIRTLGFRGEALPSIGAVARLCITTREAREPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + + G + S + P A+  GT VEV DLF+  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 SLTVEGGRKSEIIPAALTNGTRVEVGDLFYATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSN--RYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P + FT +  +     +        G    R+  ++G DF   A+ +  +   + ++G+ 
Sbjct: 181 PDIGFTLAGEERAPVTWTAALPGAAGRL-TRLGDILGGDFRAAAIPVRAEREGVIVEGFA 239

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
             P+  R NA   Y+F+NGR V+DK IL  +R AY++ +P  R+PV  L +  DPR+VD 
Sbjct: 240 AAPSLTRANALGQYLFVNGRPVRDKLILGAVRAAYSDYLPRDRHPVAALFVTADPREVDA 299

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPK----- 352
           NVHPAK+ +RFRN  ++R  I+ ++++ + ++G  T++     ++++F    +P+     
Sbjct: 300 NVHPAKTEVRFRNAGLVRALIVHALKEGLAREGRRTAANRDGAVLTAFRPAPSPRPANWD 359

Query: 353 ----THLPKYATSLTNTQEKLFLQENRLSTNDL-LPSDDPTYSEDNDPVEESEATHYQLG 407
                  P  A             E   +  D+  PS D  + + + P+   +     LG
Sbjct: 360 WRESPAAPADARPWIGGPPAAAFAEAGQAALDVGAPSADVRF-DAHPPL---DLVDRPLG 415

Query: 408 IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLE 467
            A  QIH+ YI+SQT DGL++VDQHAAHER+++E+++       +  Q LL P+I++L E
Sbjct: 416 AARTQIHETYIVSQTRDGLIVVDQHAAHERIVYERLKTALARDGVQRQILLIPDIVELDE 475

Query: 468 GECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTY 527
                +++   +L + G+  E FGP A+A+RE P++L K N   LLRD+ + + +   T 
Sbjct: 476 ATVEKLIDRATELEKFGLAIESFGPGAVAVRETPSLLGKINAAALLRDLAEHMTEWEETL 535

Query: 528 TLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSD 587
            L+ R+ ++ ATMAC+GS+R+GR ++  EMN LLREME  PNS QCNHGRPT+++LKL D
Sbjct: 536 PLERRLMHVAATMACHGSVRAGRILKPEEMNALLREMEATPNSGQCNHGRPTYVELKLDD 595

Query: 588 IEKLFGR 594
           IEKLFGR
Sbjct: 596 IEKLFGR 602


>gi|329889971|ref|ZP_08268314.1| DNA mismatch repair protein MutL family protein [Brevundimonas
           diminuta ATCC 11568]
 gi|328845272|gb|EGF94836.1| DNA mismatch repair protein MutL family protein [Brevundimonas
           diminuta ATCC 11568]
          Length = 640

 Score =  485 bits (1248), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 254/642 (39%), Positives = 385/642 (59%), Gaps = 51/642 (7%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L  + +N+IAAGE++ERP+ AIKEL+EN++DA++  +E    GGG +   I D+G
Sbjct: 1   MTIRRLPPETVNRIAAGEVVERPASAIKELVENAIDADARSIEIQADGGGLTRILIADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSN------IHTFGFRGEALPSIGAVSHLTLMSRP-- 112
            G+  +E+P+A++RH TSK+  D +       I T GFRGEALPSIG+V+ L + +R   
Sbjct: 61  KGIPRDELPVAIERHATSKLEPDDAGDVDLLRIFTLGFRGEALPSIGSVARLNITTRARA 120

Query: 113 ----PQNNTGAQIAISGEKISSVRPVAM-NP-GTIVEVRDLFFTIPARLNFLKSEQVETN 166
               PQN+  A I++ G     + P A   P G  VEVRDLF+  PARL F+KSE+ E  
Sbjct: 121 ETGQPQNDAWA-ISVEGGAQRPLSPAAFPGPHGARVEVRDLFYATPARLKFMKSERAEAM 179

Query: 167 LITDVIRRMAIAYPKVSFTFSTIKSN--RYKMNFQSTNGNFPERISQVIGEDFINNAVEL 224
            I++ I+R A+A+  V+FT +       R         G   +R+  ++G DF  NA+ +
Sbjct: 180 AISEEIKRQAMAHEAVAFTLTLDGKTTLRLPAEHPGDEGRL-KRLGALLGRDFEANALLI 238

Query: 225 NEKSNEITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVV 284
           +++ + + L GY G+PT++RGNA   ++F+NGR V+D+ +   +R AYA+ +   R+P  
Sbjct: 239 DQERDGVRLSGYAGLPTYSRGNAAHQFLFVNGRPVRDRLLQGALRGAYADFLARDRHPAA 298

Query: 285 VLLLEIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISS 344
            L ++IDP  VDVNVHPAK+ +RFR+P ++R  I+ +++ A++  G   S+ ++   +S 
Sbjct: 299 ALFIDIDPLYVDVNVHPAKAEVRFRDPALVRGLIVGALRHALHAAGHRASTTVAADALSG 358

Query: 345 F--HQDN------APKT---HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYS-ED 392
           F  H  +      AP+T     P ++     +Q     Q N    N+     + T+S E 
Sbjct: 359 FRPHTGDALYNPVAPQTFSNAAPGWSGWQGWSQPAAAAQ-NLPGLNERSARVEHTWSGEA 417

Query: 393 NDP----VEESEATH----------------YQLGIACAQIHQNYIISQTTDGLVIVDQH 432
             P    + E +A H                Y LG A AQ+H NYI++QT DGLVIVDQH
Sbjct: 418 AVPSFRTLSEIQAEHAGQIAPGASAPVDLIDYPLGAARAQLHANYIVAQTRDGLVIVDQH 477

Query: 433 AAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGP 492
           AAHERL++E+M+       +T Q LLTPE+++L   E   +    E+L  +G+  E FG 
Sbjct: 478 AAHERLVYERMKAQMADGAVTRQALLTPEVVELDPAEAERVAAKAEELAEMGLIVEAFGA 537

Query: 493 NAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKM 552
            A+ +RE PA+L   ++  L+RDI D++ +     +L++R+  +  TMAC+GS+RSGR +
Sbjct: 538 GAVLVRETPALLGDTDVQGLIRDIADDLSEHGAALSLKERMAEVCGTMACHGSVRSGRVL 597

Query: 553 QSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            + EMN LLR+ME  P+S QCNHGRPT+++LKL D+EKLFGR
Sbjct: 598 SAPEMNALLRQMEATPHSGQCNHGRPTYVELKLHDLEKLFGR 639


>gi|157804273|ref|YP_001492822.1| DNA mismatch repair protein [Rickettsia canadensis str. McKiel]
 gi|166232104|sp|A8F0A4|MUTL_RICCK RecName: Full=DNA mismatch repair protein mutL
 gi|157785536|gb|ABV74037.1| DNA mismatch repair protein [Rickettsia canadensis str. McKiel]
          Length = 610

 Score =  484 bits (1246), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 253/614 (41%), Positives = 380/614 (61%), Gaps = 24/614 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LSE  IN+IAAGE+IERP+  +KEL+EN++DA S+++  ++   GK+   I+D+G
Sbjct: 1   MTIKFLSESTINRIAAGEVIERPASVVKELVENAVDASSTKINIILERAGKNLIIISDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +E+ +AV+RH TSK+ + DF  IHTFGFRGEALPSI A+S + + S+    +   
Sbjct: 61  IGMTDKELEIAVERHTTSKLDESDFLKIHTFGFRGEALPSIAAISKMLITSKKRGTDKAF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G     +     N GT +E+RDLFF  PARL FL++++ E  +  D+++++A+A+
Sbjct: 121 QIKLIGGNEKQITISVHNEGTKIEIRDLFFATPARLKFLRADKTELAVTVDIVKKIALAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P++SF+ +    N  K+  Q+ +   N  +RI  VIG+DFI NA  ++ K  + ++ GYT
Sbjct: 181 PEISFSLTNDSKNLLKLKGQNKDAETNLKQRIIDVIGDDFIKNAAYIDFKILDFSICGYT 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
            IPT+NR ++   ++FIN R V+DK +   +R AY + +   RYP+  + L+IDP+ VDV
Sbjct: 241 SIPTYNRASSEDQFLFINNRPVKDKLLQVALRVAYQDYLARDRYPLCAIFLQIDPQFVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH----------- 346
           NVHPAK+ +RF +P  +RN +I++I+ A+  K   TS+ ++   +  F            
Sbjct: 301 NVHPAKAEVRFHDPNYVRNLLIEAIKNALANKSHVTSTTIASDTLKLFKNPLINKQPTIN 360

Query: 347 -QDNAPKTHLPKYATSLTNTQEKLFLQENRLSTN--DLLPSDDPTYSEDNDPVEESEATH 403
            + N     +   + S  NT + L   +N +     D LP       E  + +E  +  H
Sbjct: 361 KEVNVNSKSVDYRSYSSANTPKIL---QNHICQKLIDTLPHA-KVEQEVENRIEHKQQIH 416

Query: 404 --YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPE 461
             Y+LG A AQ+H  YIISQT D +VI DQHAAHERL +EK++      ++  Q LL PE
Sbjct: 417 KQYKLGAAKAQLHTTYIISQTEDSIVITDQHAAHERLGYEKIKSYIKMDELIKQRLLIPE 476

Query: 462 IIDLL-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEI 520
           I++L  E     + +H E L +LG+  E+FG  +I + EIP IL   N+ +L++D+ D +
Sbjct: 477 IVELPNEKRADCLYDHREKLSKLGLTLEKFGEKSIIVTEIPNILGDVNVQKLIQDLADHL 536

Query: 521 IDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTF 580
            D S    L + IE++  T AC+ SIR+GRK+ + EMN LLR+ME  P S QCNHGRPT+
Sbjct: 537 SDFSENVALMELIEHVTETYACHYSIRAGRKLSADEMNALLRQMENTPFSGQCNHGRPTY 596

Query: 581 IKLKLSDIEKLFGR 594
           I+LKL DIE+LFGR
Sbjct: 597 IELKLKDIERLFGR 610


>gi|157826372|ref|YP_001494092.1| DNA mismatch repair protein [Rickettsia akari str. Hartford]
 gi|166232102|sp|A8GQA9|MUTL_RICAH RecName: Full=DNA mismatch repair protein mutL
 gi|157800330|gb|ABV75584.1| DNA mismatch repair protein [Rickettsia akari str. Hartford]
          Length = 609

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 255/619 (41%), Positives = 380/619 (61%), Gaps = 35/619 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LSE  IN+IAAGE+IERP+  +KEL+EN++DA S++++ ++   GK+   I+D+G
Sbjct: 1   MTIKFLSENTINRIAAGEVIERPASVVKELVENAVDAGSTKIDIILERAGKNLIIISDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +E+ +AV+RH TSK+ + DF NIHTFGFRGEALPSI A+S + + S+    +   
Sbjct: 61  IGMTDKELEIAVERHTTSKLDESDFLNIHTFGFRGEALPSIAAISKMLITSKKQGYDKAF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G     V     N GT +E+RDLFF  PARL FL+S++ E     DV++++A+A+
Sbjct: 121 QIKLIGGNEKQVTISVHNEGTKIEIRDLFFATPARLKFLRSDKTELVATVDVVKKIALAH 180

Query: 180 PKVSFTFSTIKSN--RYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           PK+SF+ +    N  ++K + +    N  +RI  VIG+DFI NA  ++ K+ + ++ GYT
Sbjct: 181 PKISFSLTHDDRNLLKFKGHNKDVETNLKQRIIDVIGDDFIKNAAYIDFKTPDFSICGYT 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
            IPT+NR ++   ++FIN R V+DK +   +R AY + +   RYP+  + L+IDP+ VDV
Sbjct: 241 SIPTYNRASSEDQFLFINNRPVKDKLLQVALRVAYQDYLARDRYPLCAIFLQIDPQLVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ---------- 347
           NVHPAK+ +RF +P  +RN +I++I+ A+      TS+ ++   +  F            
Sbjct: 301 NVHPAKAEVRFHDPNYVRNLLIEAIKNALTNTSHVTSTTIASDALQLFKNHLVNKQPSVS 360

Query: 348 -----DNAPKTHLPKYATSLTNTQ----EKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE 398
                ++ P  + P  + S  +T     +KL          D LP       E    +E 
Sbjct: 361 KAVSVNSKPTDYRPAMSPSFKSTPNTDCQKLI---------DTLPH-AKIEQEVERRIER 410

Query: 399 SEATH--YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQT 456
            +  H  Y+LG A AQ+H  YIISQT D +VI DQHAAHERL +EK++    + ++  Q 
Sbjct: 411 EQQAHKQYKLGAAKAQLHTTYIISQTEDSIVITDQHAAHERLGYEKIKDYLKTEELIRQR 470

Query: 457 LLTPEIIDLL-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRD 515
           LL PEI++L  E     + E+ E L++LG+  E+FG  +I + EIP IL   N+ +L+ D
Sbjct: 471 LLIPEIVELPNERNADSLYENREKLYKLGLTLEKFGEKSIIVTEIPNILGDVNVQKLIHD 530

Query: 516 IIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNH 575
           + D + D      L + IE++  T AC+ SIR+GRK+ + EMN LLR+ME  P S QCNH
Sbjct: 531 LADHLSDFGENIALTELIEHVTETYACHYSIRAGRKLSADEMNALLRQMENTPFSGQCNH 590

Query: 576 GRPTFIKLKLSDIEKLFGR 594
           GRPT+I+LKL DIE+LFGR
Sbjct: 591 GRPTYIELKLKDIERLFGR 609


>gi|218532518|ref|YP_002423334.1| DNA mismatch repair protein MutL [Methylobacterium chloromethanicum
           CM4]
 gi|218524821|gb|ACK85406.1| DNA mismatch repair protein MutL [Methylobacterium chloromethanicum
           CM4]
          Length = 661

 Score =  481 bits (1237), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 243/647 (37%), Positives = 380/647 (58%), Gaps = 56/647 (8%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           +R+L   ++++IAAGE++ERP+ A+KEL+EN++DA +  +E  I GGG+   ++ D+G G
Sbjct: 15  VRRLDPILVDRIAAGEVVERPASAVKELVENAIDAGARSIEVAIEGGGRRLIRVIDDGIG 74

Query: 63  MTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M  +++ +AV+RH TSK+ D D + I + GFRGEALPSIGAVS LT+ SR   +  G  +
Sbjct: 75  MGPDDLALAVERHATSKLPDGDLTRIGSLGFRGEALPSIGAVSRLTITSRT-ADGEGVSL 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +       VRP     GT +EV +LF   PARL FLK+++ ET  +++++RR+A+A P+
Sbjct: 134 TLDSGVKGPVRPAPAARGTRIEVTELFAATPARLKFLKTDRAETAAVSEILRRLAVAQPQ 193

Query: 182 VSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           + FT  T   +      +S  G      R+  V+G DF  NAV ++       L G+ G+
Sbjct: 194 IRFTLRTESGSPTVFPAESEPGPAALLRRLGAVLGPDFPGNAVPVDMAREGFALAGHVGL 253

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF+RG A+  Y  +NGR V+D+ +L  +R AYA+T+   R+PV+ L L  DP  VDVNV
Sbjct: 254 PTFHRGAASHIYFVVNGRPVRDRLLLGAVRGAYADTMSSDRHPVLALHLTCDPALVDVNV 313

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA-----PKTH 354
           HPAK+ +RFR P ++R  I+ +I +A+ + G  +SS  ++  + +           P   
Sbjct: 314 HPAKTELRFREPGLVRALIVSAIHEALRRAGARSSSTGTQAALDALRAGAGMGGAPPMAG 373

Query: 355 LPKYA-------TSLTNTQ--EKLFLQENRLSTNDLLPSDDPTYSEDN------------ 393
           + ++A        S  N +   +LF   +  +     P+  P ++ED+            
Sbjct: 374 VGRFAVHSGASTASALNPRPASRLFSGPSVAAPAGYRPALRPAFTEDHPGFAETPQALFS 433

Query: 394 ------------DPVEESEA-TH---YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHER 437
                       DP   SEA TH   + LG A AQIH+ YI++QT DG+V+VDQHAAHER
Sbjct: 434 ADLAPPGADLRPDPEAGSEAETHPETHPLGAARAQIHETYIVAQTRDGIVLVDQHAAHER 493

Query: 438 LIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAI 497
           L++E+++++     + +Q LL P+++++   E   ++E   +L RLG+  E FGP A+ +
Sbjct: 494 LVYERLKRERAGGGVLAQGLLIPDVVEMAPEEADRLVEAAPELERLGLTLEAFGPGAVLV 553

Query: 498 REIPAILSKKNIPQLLRDIIDEIIDSSTTY----------TLQDRIENILATMACYGSIR 547
           R +P+ L+  ++  L+ D++D +  S               +  R++ IL+ M+C+GSIR
Sbjct: 554 RSVPSALAGGSVKGLVLDVLDALAASGVEEGGPAGAGDPDPVSRRLDAILSRMSCHGSIR 613

Query: 548 SGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +GR+++  EMN LLREME  P S  CNHGRPTF+ L L+DIE+LFGR
Sbjct: 614 AGRRLKPEEMNALLREMEATPLSGSCNHGRPTFVSLGLADIERLFGR 660


>gi|239946682|ref|ZP_04698435.1| DNA mismatch repair protein MutL [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239920958|gb|EER20982.1| DNA mismatch repair protein MutL [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 610

 Score =  480 bits (1236), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 251/620 (40%), Positives = 374/620 (60%), Gaps = 36/620 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LSE  IN+IAAGE+IERP+  +KEL+EN++DA S++++ ++   GK+   I+D+G
Sbjct: 1   MTIKFLSESTINRIAAGEVIERPASVVKELVENAVDAGSTKIDIILERAGKNLIIISDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +E+ +AV+RH TSK+ + DF NIHTFGFRGEALPSI  +S + + S+    +   
Sbjct: 61  IGMTDKELEIAVERHTTSKLDESDFLNIHTFGFRGEALPSIATISKMLITSKKQGADKAF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G     V     N GT +E+RDLFF  PARL FL++++ E     DV++++ +A+
Sbjct: 121 QIKLIGGNEKQVTISVHNEGTKIEIRDLFFATPARLKFLRADKTELAATVDVVKKITLAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           PK+SF+ +    N  K+  Q+ +   N  +RI  VIG+DFI NA  ++ K+ + ++ GYT
Sbjct: 181 PKISFSLTHDGKNLLKLKRQNKDAETNLKQRIIDVIGDDFIKNAAYIDFKTPDFSICGYT 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
            IPT+NR ++   ++FIN R V+DK +   +R AY + +   RYP+  + L++DP+ VDV
Sbjct: 241 SIPTYNRASSEDQFLFINNRPVKDKLLQVALRVAYQDYLARDRYPLCAIFLQVDPQLVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ---------- 347
           NVHPAK  +RF +P  +RN +I++I+ A+  K   TS+ ++   +  F            
Sbjct: 301 NVHPAKVEVRFHDPNYVRNLLIEAIKNALTNKSHVTSTTIATDALELFKNPLVNKQPQIS 360

Query: 348 ----------DNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVE 397
                     D  P TH         +  +KL          D LP       E  + +E
Sbjct: 361 KAINVNSKSADYRPTTHSTLNKVPQNHVCQKLI---------DTLPHA-KIEQEVENRIE 410

Query: 398 ESEAT--HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQ 455
             + T   Y+LG A  Q+H  YIISQT D +VI DQH AHERL +EK++    + ++  Q
Sbjct: 411 HEQQTRKQYKLGAAKTQLHTTYIISQTEDSIVITDQHVAHERLGYEKIKDYLKTEELIKQ 470

Query: 456 TLLTPEIIDLL-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLR 514
            LL PEI++L  E +   + EH E L++LG+  E+FG  +I + EIP IL   N+ +L++
Sbjct: 471 RLLIPEIVELPNEKKADCLYEHREKLYKLGLTLEKFGEKSIIVTEIPNILGDVNVQKLIQ 530

Query: 515 DIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCN 574
           D+ D + D      L + IE++  T AC+ SIR+G+K+   EMN LLR+ME  P S QCN
Sbjct: 531 DLADHLSDFGENIALTELIEHVTETYACHYSIRAGQKLSVDEMNALLRQMENTPFSGQCN 590

Query: 575 HGRPTFIKLKLSDIEKLFGR 594
           HGRPT+I+LKL DIE+LFGR
Sbjct: 591 HGRPTYIELKLKDIERLFGR 610


>gi|240141086|ref|YP_002965566.1| DNA mismatch repair protein mutL [Methylobacterium extorquens AM1]
 gi|240011063|gb|ACS42289.1| DNA mismatch repair protein mutL [Methylobacterium extorquens AM1]
          Length = 662

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 243/648 (37%), Positives = 380/648 (58%), Gaps = 57/648 (8%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           +R+L   ++++IAAGE++ERP+ A+KEL+EN++DA +  +E  I GGG+   ++ D+G G
Sbjct: 15  VRRLDPILVDRIAAGEVVERPASAVKELVENAIDAGARSIEVAIEGGGRRLIRVIDDGIG 74

Query: 63  MTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M ++++ +AV+RH TSK+ D D + I + GFRGEALPSIGAVS LT+ SR   +  G  +
Sbjct: 75  MGADDLALAVERHATSKLPDGDLTRIGSLGFRGEALPSIGAVSRLTITSRT-ADGEGVSL 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +       VRP   + GT +EV +LF   PARL FLK+++ ET  +++++RR+A+A P+
Sbjct: 134 TLDSGVKGPVRPAPASRGTRIEVTELFAATPARLKFLKTDRAETAAVSEILRRLAVAQPQ 193

Query: 182 VSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           + FT  T   +      +S  G      R+  V+G DF  NAV ++       L G+ G+
Sbjct: 194 IRFTLRTESGSPTVFPAESEPGPAALLRRLGAVLGPDFPGNAVPVDMAREGFALAGHVGL 253

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF+RG A+  +  +NGR V+D+ +L  +R AYA+T+   R+PV+ L L  DP  VDVNV
Sbjct: 254 PTFHRGAASHIHFVVNGRPVRDRLLLGAVRGAYADTMSSDRHPVLALHLICDPALVDVNV 313

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ----DNAP---- 351
           HPAK+ +RFR P ++R  I+ +I +A+ + G  +SS  ++  + +         AP    
Sbjct: 314 HPAKTELRFREPGLVRALIVSAIHEALRRAGARSSSTGTQAALDALRAGTGMGGAPPMAA 373

Query: 352 -----KTHLPKYATSLTNTQ--EKLFLQENRLSTNDLLPSDDPTYSEDN----------- 393
                  H      S  N +   +LF   +  +     P+  P ++ED+           
Sbjct: 374 GVGRFAVHSGASTASALNPRPASRLFSGPSVAAPAGYRPAPRPAFTEDHPGFAETPQALF 433

Query: 394 -------------DPVEESEA-TH---YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHE 436
                        DP   SEA TH   + LG A AQIH+ YI++QT DG+V+VDQHAAHE
Sbjct: 434 SADLAPPGADLRPDPEAGSEAETHPETHPLGAARAQIHETYIVAQTRDGIVLVDQHAAHE 493

Query: 437 RLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIA 496
           RL++E+++++     + +Q LL P+++++   E   ++E   +L RLG+  E FGP A+ 
Sbjct: 494 RLVYERLKRERAGGGVLAQGLLIPDVVEMAPEEADRLVEAAPELERLGLTLEAFGPGAVL 553

Query: 497 IREIPAILSKKNIPQLLRDIIDEIIDSSTTY----------TLQDRIENILATMACYGSI 546
           +R +P+ L+  ++  L+ D++D +  S               +  R++ IL+ M+C+GSI
Sbjct: 554 VRSVPSALAGGSVKGLVLDVLDALAASGVEEGGPAGAGDPDPVSRRLDAILSRMSCHGSI 613

Query: 547 RSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           R+GR+++  EMN LLREME  P S  CNHGRPTF+ L L+DIE+LFGR
Sbjct: 614 RAGRRLKPEEMNALLREMEATPLSGSCNHGRPTFVSLGLADIERLFGR 661


>gi|238651126|ref|YP_002916984.1| DNA mismatch repair protein [Rickettsia peacockii str. Rustic]
 gi|259511150|sp|C4K2Y5|MUTL_RICPU RecName: Full=DNA mismatch repair protein mutL
 gi|238625224|gb|ACR47930.1| DNA mismatch repair protein [Rickettsia peacockii str. Rustic]
          Length = 610

 Score =  478 bits (1231), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 251/620 (40%), Positives = 378/620 (60%), Gaps = 36/620 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LSE  IN+IAAGE+IERP+  +KEL+EN++DA S++++ ++   GK+   I+D+G
Sbjct: 1   MTIKFLSESTINRIAAGEVIERPASVVKELVENAVDASSTKIDIILERAGKNLIIISDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +E+ +AV+RH TSK  + DF NI+TFGFRGEALPSI A+S + + S+    +   
Sbjct: 61  IGMTDKELEIAVERHTTSKFDESDFLNINTFGFRGEALPSIAAISKMLITSKKRDADKAF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G     V     N GT +E+RDLFF  PARL FL++++ E      V++++A+A+
Sbjct: 121 QIKLIGGNEKQVTISVHNEGTKIEIRDLFFATPARLKFLRADKTELAATVGVVKKIALAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           PK+S + +    N  K+  Q+ +   N  +RI  VIG+DFI NA  ++ K+ + ++ GYT
Sbjct: 181 PKISLSLTHDGKNLLKLKGQNKDAETNLKQRIIDVIGDDFIKNAAYIDFKTPDFSICGYT 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
             PT+NR ++   ++FIN R V+DK +   +R AY + +   RYP+  + L+I+P+ VDV
Sbjct: 241 SSPTYNRASSEDQFLFINNRPVKDKLLQVALRVAYQDYLARDRYPICAIFLQINPQLVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ---------- 347
           NVHPAK+ +RF +P  +RN +I++I+ A+  K   TS+ ++   +  F            
Sbjct: 301 NVHPAKAEVRFHDPNYVRNLLIEAIKNALTNKSHVTSTTIASDALELFKNPLVNKQSPVS 360

Query: 348 ----------DNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVE 397
                     D  P TH      S  NT  +  + +  + T     S      E  + +E
Sbjct: 361 KVINVNSKSADYRPTTH------STLNTVPQNHVCQKLIDT----LSHAKIEQEVENHIE 410

Query: 398 ESEAT--HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQ 455
             + T   Y+LG A AQ+H  YIISQT D +VI DQHAAHERL +EK++    + ++  Q
Sbjct: 411 HEQQTRKQYKLGAAKAQLHTTYIISQTEDSIVITDQHAAHERLGYEKIKDYLKTEELIKQ 470

Query: 456 TLLTPEIIDLL-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLR 514
            LL PEI++L  E +   + +H E L++LG+  E+FG  +I + EIP IL   N+ +L++
Sbjct: 471 RLLIPEIVELPNEKKADCLYDHREKLYKLGLTLEKFGEKSIIVTEIPNILGDVNVQKLIQ 530

Query: 515 DIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCN 574
           D+ D + D      L + IE++  T AC+ SIR+GRK+ + EMN LLR+ME  P S QCN
Sbjct: 531 DLADHLSDFGKNIALTELIEHVTETYACHYSIRAGRKLSADEMNALLRQMENTPLSGQCN 590

Query: 575 HGRPTFIKLKLSDIEKLFGR 594
           HGRPT+I+LKL DIE+LFGR
Sbjct: 591 HGRPTYIELKLKDIERLFGR 610


>gi|163853662|ref|YP_001641705.1| DNA mismatch repair protein MutL [Methylobacterium extorquens PA1]
 gi|163665267|gb|ABY32634.1| DNA mismatch repair protein MutL [Methylobacterium extorquens PA1]
          Length = 687

 Score =  478 bits (1230), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 242/648 (37%), Positives = 380/648 (58%), Gaps = 57/648 (8%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           +R+L   ++++IAAGE++ERP+ A+KEL+EN++DA +  +E  I GGG+   ++ D+G G
Sbjct: 40  VRRLDPILVDRIAAGEVVERPASAVKELVENAIDAGARSIEVAIEGGGRRLIRVVDDGIG 99

Query: 63  MTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M  +++ +AV+RH TSK+ D D + I + GFRGEALPSIGAVS LT+ SR   +  G  +
Sbjct: 100 MGPDDLALAVERHATSKLPDGDLTRIGSLGFRGEALPSIGAVSRLTITSRT-ADGEGVSL 158

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +       VRP   + GT +EV +LF   PARL FLK+++ ET  +++++RR+A+A P+
Sbjct: 159 TLDSGVKGPVRPAPASRGTRIEVTELFAATPARLKFLKTDRAETAAVSEILRRLAVAQPR 218

Query: 182 VSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           + FT  T   +      +S  G      R+  V+G DF  NAV ++       L G+ G+
Sbjct: 219 IRFTLRTESGSPTVFPAESEPGPAALLRRLGAVLGPDFPGNAVPVDMAREGFALAGHVGL 278

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF+RG A+  +  +NGR V+D+ +L  +R AYA+T+   R+PV+ L L  DP  VDVNV
Sbjct: 279 PTFHRGAASHIHFVVNGRPVRDRLLLGAVRGAYADTMSSDRHPVLALHLTCDPALVDVNV 338

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ----DNAP---- 351
           HPAK+ +RFR P ++R  I+ +I +A+ + G  +SS  ++ ++ +        +AP    
Sbjct: 339 HPAKTELRFREPGLVRALIVSAIHEALRRAGARSSSTGTQAVLDALRAGAGMGSAPPMAA 398

Query: 352 -----KTHLPKYATSLTNTQ--EKLFLQENRLSTNDLLPSDDPTYSEDN----------- 393
                  H      S  N +   +LF   +  +     P+  P ++ED+           
Sbjct: 399 GVGRFAVHSGASTASALNPRPASRLFSGPSVAAPAGYRPAPRPAFTEDHPGFAETPQALF 458

Query: 394 -------------DPVEESEA-TH---YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHE 436
                        +P   SEA TH   + LG A AQIH+ YI++QT DG+V+VDQHAAHE
Sbjct: 459 SADLAPPGADLRPEPEAVSEAETHPEAHPLGAARAQIHETYIVAQTRDGIVLVDQHAAHE 518

Query: 437 RLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIA 496
           RL++E+++ +     + +Q LL P+++++   E   ++E   +L RLG+  E FGP A+ 
Sbjct: 519 RLVYERLKSERAGGGVLAQGLLIPDVVEMAPEEADRLVEAAPELERLGLTLEAFGPGAVL 578

Query: 497 IREIPAILSKKNIPQLLRDIIDEIIDSSTTY----------TLQDRIENILATMACYGSI 546
           +R +P+ L+  ++  L+ D++D +  S               +  R++ IL+ M+C+GSI
Sbjct: 579 VRSVPSALAGGSVKGLVLDVLDALAASGVEEGGPAGAGDPDPVSRRLDAILSRMSCHGSI 638

Query: 547 RSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           R+GR+++  EMN LLREME  P S  CNHGRPTF+ L L+DIE+LFGR
Sbjct: 639 RAGRRLKPEEMNALLREMEATPLSGSCNHGRPTFVSLGLADIERLFGR 686


>gi|170746511|ref|YP_001752771.1| DNA mismatch repair protein MutL [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653033|gb|ACB22088.1| DNA mismatch repair protein MutL [Methylobacterium radiotolerans
           JCM 2831]
          Length = 648

 Score =  478 bits (1229), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 239/639 (37%), Positives = 368/639 (57%), Gaps = 47/639 (7%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           +R+L   ++++IAAGE++ERP+ A+KEL+EN++DA +  +E  +  GG+   ++ D+G G
Sbjct: 9   VRRLDPVLVDRIAAGEVVERPASAVKELVENAIDAGARAIEVTVEAGGRRLIRVVDDGRG 68

Query: 63  MTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT +++ +AV+RH TSK+   D + I T GFRGEALPSIGAVS L +++R P+   GA +
Sbjct: 69  MTPDDLDLAVERHATSKLPGGDLTAIDTLGFRGEALPSIGAVSRLAIVTRTPEAEAGASL 128

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +       VRP     GT +EV +LF   PARL FLKS++ E   I + +RR+A   P 
Sbjct: 129 MVEAGLKGQVRPAPAQRGTRIEVTELFAATPARLKFLKSDRAENAAIAETLRRLAATQPG 188

Query: 182 VSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPT 241
           + FT          +  ++       R++ V+G+DF+ NA+ ++       + G+ G+PT
Sbjct: 189 IRFTLRADAGQPLVLPAETGAEAELRRLAAVLGQDFLANALPVSLAREGFAVTGHVGLPT 248

Query: 242 FNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHP 301
           ++RG A   ++ +NGR V+D+ +L  IR AYA+T+   R+PV+ L +  DP  VDVNVHP
Sbjct: 249 YHRGAATHIHLAVNGRPVRDRLLLGAIRGAYADTLASDRHPVLGLAVACDPGLVDVNVHP 308

Query: 302 AKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAP-KTHLPKYAT 360
           AK+ +RFR P ++R  I+ +I  A+ + G  +++  + + + +      P  TH    A 
Sbjct: 309 AKTEVRFREPGLVRALIVSAIHDALRRGGARSATTGAARTLDALRPAGPPLATHSGATAP 368

Query: 361 SL---------TNTQEKLFLQENRLSTNDLLPSDDPT------YSEDNDPV--------- 396
           SL          +    +        +    P+  P       + E    V         
Sbjct: 369 SLFRPTRPGPFPSGAPSVAAPSGYRPSTAWRPAPQPARVEPAGFGESAQAVWTGPESVAV 428

Query: 397 ------------EESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMR 444
                       E +EA  + LG A AQIH+ YI++QT DGLVIVDQHAAHERL++E+M+
Sbjct: 429 AAPPQADTRVADEAAEALDHPLGAARAQIHETYILAQTRDGLVIVDQHAAHERLVYERMK 488

Query: 445 QDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAIL 504
            +  +  I  Q LL P+++++   E   ++    DL RLG+  E FGP A+ +RE+PA L
Sbjct: 489 TEREAGGIARQGLLIPDVVEMSPEEADRLVAAAPDLDRLGLSIEAFGPGAVLVREVPAAL 548

Query: 505 SKKNIPQLLRDIIDEI---------IDSSTTYTLQDRIENILATMACYGSIRSGRKMQSI 555
              +   L+ DI+D +         + ++    L  R++ IL+ M+C+GSIR+GR+++  
Sbjct: 549 IGASTRDLVTDILDALQASGDEESGVAATEGGPLGRRLDAILSRMSCHGSIRAGRRLRPE 608

Query: 556 EMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           EMN LLREME  PNS QCNHGRPT I+LKL+DIE+LFGR
Sbjct: 609 EMNALLREMEATPNSGQCNHGRPTSIELKLADIERLFGR 647


>gi|83594278|ref|YP_428030.1| DNA mismatch repair protein [Rhodospirillum rubrum ATCC 11170]
 gi|123766944|sp|Q2RQ52|MUTL_RHORT RecName: Full=DNA mismatch repair protein mutL
 gi|83577192|gb|ABC23743.1| DNA mismatch repair protein MutL [Rhodospirillum rubrum ATCC 11170]
          Length = 629

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 242/632 (38%), Positives = 363/632 (57%), Gaps = 42/632 (6%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR L   ++N+IAAGE++ERP+ A+KEL+EN++DA +SR++  +  GG++   + D+G
Sbjct: 1   MTIRLLPPVLVNRIAAGEVVERPASAVKELVENAIDAGASRIDITMTDGGRARILVVDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM   E+ +AV+RH TSK+  DD  +IHT GFRGEALPSIG+V+ LTL SR        
Sbjct: 61  RGMDPGELSLAVERHATSKLPGDDLLDIHTLGFRGEALPSIGSVARLTLTSRAAGAGDAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + + G       P +   GT VEVRDLF+  PARL FLK+ + E     DV+ R+A+A+
Sbjct: 121 ALTVEGGAKGEPEPASHPQGTRVEVRDLFYATPARLKFLKAPRTEQMHAVDVVHRLAMAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQG 235
           P V FT S     R ++      G   E    R+  ++G +F +NA+ +  +   I L G
Sbjct: 181 PAVGFTLS--DGTRQQIRLSGAQGELFEARLTRLGAILGREFSDNAIAIEAEREGIRLTG 238

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           +  +PT+N+  +   Y+F+NGR V+DK +   +R AY + +   R  V+ L L++ P  V
Sbjct: 239 HAALPTYNKATSAGQYLFVNGRPVRDKLLHGAVRGAYQDVLAHDRNAVLALYLDLPPEMV 298

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF---HQDNAPK 352
           DVNVHPAK+ +RFR+P ++R  II +++ A+   G   SS +S   + +        AP 
Sbjct: 299 DVNVHPAKAEVRFRDPGLVRGLIIGALRHALAAAGHRASSTVSLAALGALRPAQGSGAPA 358

Query: 353 THLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDP-------------------TYSEDN 393
             LP  A           L+E R +     P+  P                    +    
Sbjct: 359 --LPWGAGGYGGGASHPGLEERRSAYAAQAPAGTPDPWAGRGMGAGGGSGQAAMAWLAGA 416

Query: 394 DPVE-----ESEAT-----HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKM 443
            P       E EA       + LG A  QIH  YII+QT DG+VIVDQHAAHERL+ E+M
Sbjct: 417 PPAAPRLAGEPEAPPTGAEDFPLGAARGQIHDTYIIAQTRDGVVIVDQHAAHERLVMERM 476

Query: 444 RQDF-NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPA 502
           +       ++  Q LL PE+++L E     +     +L +LG+  E FGP A+ +RE+PA
Sbjct: 477 KAALAERGEVARQILLLPEVVELDEPGAVRVATAAAELAKLGLVVEGFGPGAVVVREVPA 536

Query: 503 ILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLR 562
           +L   ++  L+ D+ + + +  T   L+DR+ +++ATMAC+GS+R+GR+++  EMN LLR
Sbjct: 537 LLGDTDVKGLVADLAEGLAEWGTAQALEDRLGDVVATMACHGSVRAGRRLRIEEMNALLR 596

Query: 563 EMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +ME+ P + QCNHGRPT+++L+L DIE+LFGR
Sbjct: 597 DMERTPRAGQCNHGRPTYVELRLGDIERLFGR 628


>gi|254563596|ref|YP_003070691.1| DNA mismatch repair protein mutL [Methylobacterium extorquens DM4]
 gi|254270874|emb|CAX26879.1| DNA mismatch repair protein mutL [Methylobacterium extorquens DM4]
          Length = 662

 Score =  476 bits (1226), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 242/648 (37%), Positives = 380/648 (58%), Gaps = 57/648 (8%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           +R+L   ++++IAAGE++ERP+ A+KEL+EN++DA +  +E  I GGG+   ++ D+G G
Sbjct: 15  VRRLDPILVDRIAAGEVVERPASAVKELVENAIDAGARSIEVAIEGGGRRLIRVVDDGIG 74

Query: 63  MTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M ++++ +AV+RH TSK+ D D + I + GFRGEALPSIGAVS LT+ SR   +  G  +
Sbjct: 75  MGADDLALAVERHATSKLPDGDLTRIGSLGFRGEALPSIGAVSRLTITSRT-ADGEGVSL 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +       VRP     GT +EV +LF   PARL FLK+++ ET  +++++RR+A+A P+
Sbjct: 134 TLDSGVKGPVRPAPAARGTRIEVTELFAATPARLKFLKTDRAETAAVSEILRRLAVAQPQ 193

Query: 182 VSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           + FT  T   +      +S  G      R+  V+G DF  NAV ++       L G+ G+
Sbjct: 194 IRFTLRTESGSPTVFPAESEPGPAALLRRLGAVLGPDFPGNAVPVDMAREGFALAGHVGL 253

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF+RG A+  +  +NGR V+D+ +L  +R AYA+T+   R+PV+ L L  DP  VDVNV
Sbjct: 254 PTFHRGAASHIHFVVNGRPVRDRLLLGAVRGAYADTMSSDRHPVLALHLTCDPALVDVNV 313

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ----DNAP---- 351
           HPAK+ +RFR P ++R  I+ +I +A+ + G  +SS  ++  + +        +AP    
Sbjct: 314 HPAKTELRFREPGLVRALIVSAIHEALRRAGARSSSTGTQAALDALRAGAGMGSAPPMAA 373

Query: 352 -----KTHLPKYATSLTNTQ--EKLFLQENRLSTNDLLPSDDPTYSEDN----------- 393
                  H      S  N +   +LF   +  +     P+  P ++ED+           
Sbjct: 374 GMGQFAVHSGASTASALNPRPASRLFSGPSVAAPAGYRPAPRPAFTEDHPGFAETPQALF 433

Query: 394 -------------DPVEESEA-TH---YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHE 436
                        +P   SEA TH   + LG A AQIH+ YI++QT DG+V+VDQHAAHE
Sbjct: 434 SADLAPPGADLRPEPEMLSEAETHPETHPLGAARAQIHETYIVAQTRDGIVLVDQHAAHE 493

Query: 437 RLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIA 496
           RL++E+++++     + +Q LL P+++++   E   ++E   +L RLG+  E FGP A+ 
Sbjct: 494 RLVYERLKRERAGGGVLAQGLLIPDVVEMAPEEADRLVEAAPELERLGLTLEAFGPGAVL 553

Query: 497 IREIPAILSKKNIPQLLRDIIDEIIDSSTTY----------TLQDRIENILATMACYGSI 546
           +R +P+ L+  ++  L+ D++D +  S               +  R++ IL+ M+C+GSI
Sbjct: 554 VRSVPSALAGGSVKGLVLDVLDALAASGVEEGGPAGAGDPDPVSRRLDAILSRMSCHGSI 613

Query: 547 RSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           R+GR+++  EMN LLREME  P S  CNHGRPTF+ L L+DIE+LFGR
Sbjct: 614 RAGRRLKPEEMNALLREMEATPLSGSCNHGRPTFVSLGLADIERLFGR 661


>gi|298290347|ref|YP_003692286.1| DNA mismatch repair protein MutL [Starkeya novella DSM 506]
 gi|296926858|gb|ADH87667.1| DNA mismatch repair protein MutL [Starkeya novella DSM 506]
          Length = 611

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 241/612 (39%), Positives = 379/612 (61%), Gaps = 20/612 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R L   ++++IAAGE++ERP+ A+KE++EN+LDA ++R+E VI GGG+   ++TD+G
Sbjct: 1   MPLRLLPSTLVDRIAAGEVVERPAAALKEIVENALDAGATRIEVVIDGGGRRLMRVTDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM+++E+ +AV+RH TSK+ ++D  +I T GFRGEALPSIGAV+ L++ SRP  ++T  
Sbjct: 61  CGMSADELALAVERHATSKLDTEDLLSIATLGFRGEALPSIGAVARLSITSRPRGSDTAH 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +I + G   S+V+P A+  GT VEVRDLFF  PARL FLKSE+ ET    D ++R+A+A 
Sbjct: 121 EIRVEGGAKSAVKPAALGFGTRVEVRDLFFATPARLKFLKSERAETAAAVDAVKRLALAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFP---ERISQVIGEDFINNAVELNEKSNEITLQGY 236
           P V F   T   +R  + + + + +      RI+ V+G +   NA++++       L G 
Sbjct: 181 PDVGFILVT--DDRPPVTWPARSADAAGRRARIADVLGHEVGANALDIDGLREGARLSGL 238

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
            G+PT+ + N+   Y+F+NGR V+DK ++  IR AYA+ +P  R+PV  L L++DP +VD
Sbjct: 239 AGLPTYAKANSLSQYLFVNGRPVRDKVLIGAIRAAYADLLPSDRHPVTALFLDLDPHEVD 298

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMIS----SFHQ--DNA 350
           VNVHPAK+ +RFR+   +R  I++++  A+      T+S  ++K+       F Q   N 
Sbjct: 299 VNVHPAKTEVRFRDAGNVRALIVRTLTDALALGVPRTASTAAEKLAQFARPEFRQGAGNP 358

Query: 351 PKTHLPKYATSLT-------NTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEA-T 402
           P+     +  S               F +E       L  +  P+     +    +    
Sbjct: 359 PRPGNYDWTRSWAAPDVAPREASPAGFREEAAGFDFGLGLALAPSADARANAAPPAPDLM 418

Query: 403 HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEI 462
              LG A AQ+H+ YII+QT DG+V++DQHAAHER+++EK++       +  Q LL P +
Sbjct: 419 ERPLGAARAQLHETYIIAQTKDGVVVIDQHAAHERIVYEKLKAAMERDGLARQMLLVPLV 478

Query: 463 IDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIID 522
           ++L   + A + E    L +LG+  E FGP A+ +RE+P++L   ++  L+ ++ +   +
Sbjct: 479 VELDPSDAARLAERAAALEKLGLVLEPFGPGAVLVREVPSLLGDADVCALVTELAEHAAE 538

Query: 523 SSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIK 582
                 L+ R+ +I ATMAC+GS+R+GR+++  EMN LLREME+ PN++QCNHGRPTF+ 
Sbjct: 539 WDDALPLERRLLHIAATMACHGSVRAGRRLRVEEMNALLREMEETPNAAQCNHGRPTFVT 598

Query: 583 LKLSDIEKLFGR 594
           L L+DIE+LF R
Sbjct: 599 LALADIERLFAR 610


>gi|294084710|ref|YP_003551468.1| DNA mismatch repair enzyme [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664283|gb|ADE39384.1| DNA mismatch repair enzyme [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 613

 Score =  476 bits (1224), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 230/624 (36%), Positives = 365/624 (58%), Gaps = 46/624 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR+L ++++NQIAAGE++ERP+ A+KEL+EN+LDA + ++   +  GG     +TD+G 
Sbjct: 4   RIRQLPDRLVNQIAAGEVVERPASALKELVENALDAGAGKISITLKRGGIDEIIVTDDGS 63

Query: 62  GMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           GM+ ++I +AVQRH TSK+ DD   +I   GFRGEALPSIGAVS L+L S     +   +
Sbjct: 64  GMSLDDIKLAVQRHATSKLPDDNLVHIKALGFRGEALPSIGAVSRLSLTSIMADMDHAWR 123

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + +    +    P A+  G+++ V  LF  +PARL FLK+E+ E     D+++R+A+A+P
Sbjct: 124 LVVDAGHVHDPEPAALKQGSMIAVNQLFKAVPARLKFLKTERTEQGQCVDMVKRLAMAWP 183

Query: 181 KVSFTFSTIKSNRYKMN-FQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            V+F  S    +  +++           R+S ++G+ F + A E++   + ITL G  G+
Sbjct: 184 TVAFDLSNDGRSLIRLDACLPGAAGLKRRLSAIMGQSFADEAAEMDAVRDRITLTGLVGL 243

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT NR      ++F+NGR + D+ +L  +R  Y +T+P GR+P+  L + + P  VDVNV
Sbjct: 244 PTMNRPTTGHVFLFVNGRPINDRSLLGAVRAGYGDTLPRGRHPMCALFISLPPEDVDVNV 303

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF-------------- 345
           HPAK+ +RF++   +R  ++  I+  +   GI  +S   ++ ++                
Sbjct: 304 HPAKAEVRFKDAAAVRGLLVGGIRARLEDAGIQATSEGGQQALARLSSSSSSSSSSSSFS 363

Query: 346 -------------HQDNAPKTHL-PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSE 391
                        H  + P+ H  P    S    Q                P + P  + 
Sbjct: 364 GFTAGGSGARGISHVASGPRAHYQPAPPASAHMWQS---------------PVEAPPAAR 408

Query: 392 DNDPVEESE-ATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST 450
             D  E  E A H  LG A AQ+H+ YI+++T DG+ I+DQHAAHERL+ E+M+     T
Sbjct: 409 QIDINEADESARHNLLGAAKAQLHKTYIVAETEDGIAIIDQHAAHERLVMERMKAAMAET 468

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
            + SQ LL PE+I++ E  C  +++  + L ++G+  E FG  A+ +R++PA+L   N+ 
Sbjct: 469 GVPSQALLLPEVINMQEHHCEAVLDAADMLGKMGLTVENFGVGAVVVRDVPAMLGNPNVV 528

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
           QL++DI +E+I+   + +L+DRI ++LAT++C+GS+R+GR +   EMN LLREME  P S
Sbjct: 529 QLVQDIAEELIELGDSTSLEDRINHVLATVSCHGSVRAGRILNGDEMNALLREMEVTPRS 588

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
            QCNHGRPT++ L L++IE LFGR
Sbjct: 589 GQCNHGRPTWVSLSLTEIETLFGR 612


>gi|315500444|ref|YP_004089247.1| DNA mismatch repair protein mutl [Asticcacaulis excentricus CB 48]
 gi|315418456|gb|ADU15096.1| DNA mismatch repair protein MutL [Asticcacaulis excentricus CB 48]
          Length = 643

 Score =  474 bits (1221), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 243/642 (37%), Positives = 383/642 (59%), Gaps = 53/642 (8%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I +L +  IN+IAAGE++ERP+ AIKEL+EN++DA +++++     GG S   I DNG G
Sbjct: 4   ISRLPQDTINRIAAGEVVERPASAIKELVENAIDAGATQIDIFAEMGGLSRILIEDNGRG 63

Query: 63  MTSEEIPMAVQRHCTSKI------SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNN 116
           M ++++P+AV+RH TSK+      + D  +I T GFRGEALPS+G+V+ L + SR    +
Sbjct: 64  MDADDLPLAVERHATSKLKPQADGTWDLLHIQTLGFRGEALPSMGSVARLDITSRAKGMD 123

Query: 117 TGAQIAISGEKISSVRPVAMN--PGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRR 174
               I +    +S +RP A +   GT VE++DLF+  PARL F+K+++ E   I++ ++R
Sbjct: 124 GAIAITVDAGAMSPLRPAAFSRPHGTRVELKDLFYATPARLKFMKTDRAENMAISEEVKR 183

Query: 175 MAIAYPKVSF--TFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEIT 232
            A+A+  V F  T    +S R         G   +R++ ++G+DF +NA+ ++++   + 
Sbjct: 184 QAMAHEHVGFSLTLDGKRSLRLYPEEAGFEGRL-KRLAALLGDDFGHNALLIDQQREGVR 242

Query: 233 LQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDP 292
           L GY G+PTF+RGNA   Y+F+NGR V+DK +   +R AYA+ +   R+P+ VL +E DP
Sbjct: 243 LTGYAGLPTFSRGNAQHQYLFVNGRPVRDKLLTGALRGAYADFLARDRHPMAVLYVETDP 302

Query: 293 RQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF------- 345
           + +DVNVHPAK+ +RFR+P ++R  I+ +++ A+   G   ++ ++ + +S+F       
Sbjct: 303 QNIDVNVHPAKAEVRFRDPNLVRGLIVGALKHALASAGHRAATTVADQALSAFSPLSSGY 362

Query: 346 ------------------HQDNAPKT-------HLPKYATSLTNTQEKLFLQENRLSTND 380
                             +Q  A  T       + P +   LT       ++ + ++   
Sbjct: 363 RAPVQPTLSLHSSALGAGYQPRAYATPQQPHPNYQPAWNADLTFAPSAR-VERDFVAAAP 421

Query: 381 LL--PSDDPTYSEDND------PVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQH 432
           +L  P D        D      P+   E   Y LG A AQ+H+ YI++QT DGL+IVDQH
Sbjct: 422 MLQTPGDSGLAEAGGDLRTLSQPL-PPEFESYPLGAARAQLHETYILAQTKDGLIIVDQH 480

Query: 433 AAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGP 492
           AAHERL++E+M+       +  QTLL PEI+DL   + + +M   +DL   G+  E FGP
Sbjct: 481 AAHERLVYERMKAMMAEGNVARQTLLIPEIVDLDPADVSRLMARRDDLEGFGLMIESFGP 540

Query: 493 NAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKM 552
             I +RE+PA++   ++  L+RD+ D+I ++     L++R+  I   MAC  S+R+GR++
Sbjct: 541 ATILVREVPALIGDGDVAGLIRDLADDIAENGQALILKERMAEICGNMACRNSVRAGRRL 600

Query: 553 QSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            + EMN LLR+ME  P+S QCNHGRPT+++LKL DIEKLFGR
Sbjct: 601 SASEMNALLRQMEATPHSGQCNHGRPTYVELKLKDIEKLFGR 642


>gi|165933924|ref|YP_001650713.1| DNA mismatch repair protein [Rickettsia rickettsii str. Iowa]
 gi|189030407|sp|B0BVP7|MUTL_RICRO RecName: Full=DNA mismatch repair protein mutL
 gi|165909011|gb|ABY73307.1| DNA mismatch repair protein [Rickettsia rickettsii str. Iowa]
          Length = 610

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 249/618 (40%), Positives = 378/618 (61%), Gaps = 32/618 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LSE  IN+IAAGE+IERP+  +KEL+EN++DA S++++ ++   GK+   I+D+G
Sbjct: 1   MTIKFLSESTINRIAAGEVIERPASVVKELVENAVDASSTKIDIILERAGKNLIIISDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +E+ +AV+RH TSK  + DF NI+TFGFRGEALPSI A+S + + S+    +   
Sbjct: 61  IGMTDKELEIAVERHTTSKFDESDFLNINTFGFRGEALPSIAAISKMLITSKKRDADKAF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G     V     N GT +E+RDLFF  PARL FL++++ E      V++++A+A+
Sbjct: 121 QIKLIGGNEKQVTISVHNEGTKIEIRDLFFATPARLKFLRADKTELAATVGVVKKIALAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           PK+SF+ +    N  K+  Q+ +   N  +RI  VIG+DFI NA  ++ K+ + ++ GYT
Sbjct: 181 PKISFSLTHDGKNLLKLKGQNKDAETNLKQRIIDVIGDDFIKNAAYIDFKTPDFSICGYT 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
             PT+NR ++   ++FIN R V+DK +   +R AY + +   RYP+  + L+I+P+ VDV
Sbjct: 241 SSPTYNRASSEDQFLFINNRPVKDKLLQIALRVAYQDYLARDRYPICAIFLQINPQLVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ---------- 347
           NVHPAK+ +RF +P  +RN +I++I+ A+  K   TS+ ++   +  F            
Sbjct: 301 NVHPAKAEVRFHDPDYVRNLLIEAIKNALTNKSHVTSTTIASDALELFKNPLVNKQSPVS 360

Query: 348 ----------DNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVE 397
                     D  P TH      S+ NT  +  + +  + T  L  +      E+    E
Sbjct: 361 KVINVNSKSADYRPTTH------SILNTVPQNHVCQKLIDT--LSHAKIEQEVENRIEHE 412

Query: 398 ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTL 457
           +     Y+LG A AQ+H  YIISQT D +VI DQHAAH+RL +EK++    + ++  Q L
Sbjct: 413 QQIRKQYKLGAAKAQLHTTYIISQTEDSIVITDQHAAHKRLGYEKIKDYLKTEELIKQRL 472

Query: 458 LTPEIIDLL-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDI 516
           L PEI++L  E +   + +H E L++LG+  E+FG  +I + EIP IL   N+ +L++D+
Sbjct: 473 LIPEIVELPNEKKADCLYDHREKLYKLGLTLEKFGEKSIIVTEIPNILGDVNVQKLIQDL 532

Query: 517 IDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHG 576
            D + D      L + IE++  T AC+ SIR+GRK+ + EMN LLR+ME    S QCNHG
Sbjct: 533 ADHLSDFGKNIALTELIEHVTETYACHYSIRAGRKLSADEMNALLRQMENTLLSGQCNHG 592

Query: 577 RPTFIKLKLSDIEKLFGR 594
           RPT+I+LKL DIE+LFGR
Sbjct: 593 RPTYIELKLKDIERLFGR 610


>gi|304321473|ref|YP_003855116.1| DNA mismatch repair protein [Parvularcula bermudensis HTCC2503]
 gi|303300375|gb|ADM09974.1| DNA mismatch repair protein [Parvularcula bermudensis HTCC2503]
          Length = 632

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 237/613 (38%), Positives = 372/613 (60%), Gaps = 24/613 (3%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR+L    +N+IAAGE+IERP+ A+KEL+EN++DA +  +   I  GGK+   + D+G 
Sbjct: 23  RIRRLPAVAVNRIAAGEVIERPAAAVKELVENAIDAGARTITVRIDQGGKALIDVEDDGC 82

Query: 62  GMTSEEIPMAVQRHCTSKISDD------FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQN 115
           GM +E++ +A++RH TSK++ D        +I T GFRGEALPSIGAV+ L + SR    
Sbjct: 83  GMGAEDLILALERHATSKLAADETGCVDLLDIATLGFRGEALPSIGAVAELDIASRC-HG 141

Query: 116 NTGAQIAISGEKISSVRPVA-MNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRR 174
             G +I+     I   RP   +  GT V V+ LFF  PARL FLK++  ET  +++ ++ 
Sbjct: 142 GDGIKISCRAGVIDPPRPHPFVGVGTKVSVKRLFFATPARLKFLKADSAETRAVSETLKA 201

Query: 175 MAIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNE 230
           +A+A P++ FT   I   R + ++    G  PE    R+  ++G++F +NA+ ++     
Sbjct: 202 LAMAQPEIGFTL--IADGRQRFSY-PPEGEGPEGALRRLGHIMGKEFEDNALAIDIDREG 258

Query: 231 ITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEI 290
             L G+ G+PT NRG  ++ Y+F+NGR V+D+ ++  +R AYA+ +   R+P++ L +++
Sbjct: 259 ARLHGFAGVPTLNRGQPDRQYLFVNGRPVKDRLMVGAVRGAYADFLARDRHPLLALYIDL 318

Query: 291 DPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA 350
             +QVDVNVHPAK+ +RFR+   IR  I+  ++  +   G   S+ ++   +S F    A
Sbjct: 319 PFQQVDVNVHPAKTEVRFRDAAAIRGMIVSGLRHMLAAAGHRASTTIAASALSRFEGAEA 378

Query: 351 PKTHLPKYATSLTNT--QEKLFLQENRL-----STNDLLPSDDPTYSEDNDP--VEESEA 401
           P    P   T+  +   +E+  L   +          L   + P+     DP    E E 
Sbjct: 379 PPPQGPNAPTTFVHGAHRERPILPPRQAPPFAAEGTTLFRGEAPSAQTIEDPSQAHEEEG 438

Query: 402 THYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPE 461
             + LG+  AQ+H+ Y+++QTTDG+VIVDQHAAHERLI+E M+       I  QTLL PE
Sbjct: 439 PSFPLGVPRAQLHETYVLAQTTDGIVIVDQHAAHERLIYEAMKSRQRDRGIERQTLLIPE 498

Query: 462 IIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEII 521
           ++DL + E  L+++  E+L  LG+  E FG  A+ +RE+P +    ++  L+RDI  +++
Sbjct: 499 VVDLPQEEAELLIDRTEELAALGLVVEAFGGTAVLVREVPCLFGDGDVAGLIRDIAADLV 558

Query: 522 DSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFI 581
               +  L+ R+ +I   MAC G+I+SGR++ + EMNRLLR+ME  P+S QCNHGRPT++
Sbjct: 559 TLDGSAALETRLGDIAGNMACRGAIKSGRRLTAEEMNRLLRDMEAVPHSGQCNHGRPTYV 618

Query: 582 KLKLSDIEKLFGR 594
           +LKL+DIE+LFGR
Sbjct: 619 ELKLADIERLFGR 631


>gi|157829199|ref|YP_001495441.1| DNA mismatch repair protein [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|166232105|sp|A8GU58|MUTL_RICRS RecName: Full=DNA mismatch repair protein mutL
 gi|157801680|gb|ABV76933.1| DNA mismatch repair protein [Rickettsia rickettsii str. 'Sheila
           Smith']
          Length = 610

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 249/618 (40%), Positives = 377/618 (61%), Gaps = 32/618 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LSE  IN+IAAGE+IERP+  +KEL+EN++DA S++++ ++   GK+   I+D+G
Sbjct: 1   MTIKFLSESTINRIAAGEVIERPASVVKELVENAVDASSTKIDIILERAGKNLIIISDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +E+ +AV+RH TSK  + DF NI+TFGFRGEALPSI A+S + + S+    +   
Sbjct: 61  IGMTDKELEIAVERHTTSKFDESDFLNINTFGFRGEALPSIAAISKMLITSKKRDADKAF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G     V     N GT +E+RDLFF  PARL FL++++ E      V++++A+A+
Sbjct: 121 QIKLIGGNEKQVTISVHNEGTKIEIRDLFFATPARLKFLRADKTELAATVGVVKKIALAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           PK+SF+ +    N  K+  Q+ +   N  +RI  VIG+DFI NA  ++ K+ + ++ GYT
Sbjct: 181 PKISFSLTHDGKNLLKLKGQNKDAETNLKQRIIDVIGDDFIKNAAYIDFKTPDFSICGYT 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
             PT+NR ++   ++FIN R V+DK +   +R AY + +   RYP+  + L+I+P+ VDV
Sbjct: 241 SSPTYNRASSEDQFLFINNRPVKDKLLQIALRVAYQDYLARDRYPICAIFLQINPQLVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ---------- 347
           NVHPAK+ +RF +P  +RN +I++I+ A+  K   TS+ ++   +  F            
Sbjct: 301 NVHPAKAEVRFHDPDYVRNLLIEAIKNALTNKSHVTSTTIASDALELFKNPLVNKQSPVS 360

Query: 348 ----------DNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVE 397
                     D  P TH      S  NT  +  + +  + T  L  +      E+    E
Sbjct: 361 KVINVNSKSADYRPTTH------STLNTVPQNHVCQKLIDT--LSHAKIEQEVENRIEHE 412

Query: 398 ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTL 457
           +     Y+LG A AQ+H  YIISQT D +VI DQHAAH+RL +EK++    + ++  Q L
Sbjct: 413 QQIRKQYKLGAAKAQLHTTYIISQTEDSIVITDQHAAHKRLGYEKIKHYLKTEELIKQRL 472

Query: 458 LTPEIIDLL-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDI 516
           L PEI++L  E +   + +H E L++LG+  E+FG  +I + EIP IL   N+ +L++D+
Sbjct: 473 LIPEIVELPNEKKADCLYDHREKLYKLGLTLEKFGEKSIIVTEIPNILGDVNVQKLIQDL 532

Query: 517 IDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHG 576
            D + D      L + IE++  T AC+ SIR+GRK+ + EMN LLR+ME    S QCNHG
Sbjct: 533 ADHLSDFGKNIALTELIEHVTETYACHYSIRAGRKLSADEMNALLRQMENTLLSGQCNHG 592

Query: 577 RPTFIKLKLSDIEKLFGR 594
           RPT+I+LKL DIE+LFGR
Sbjct: 593 RPTYIELKLKDIERLFGR 610


>gi|182677997|ref|YP_001832143.1| DNA mismatch repair protein MutL [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|238691233|sp|B2II71|MUTL_BEII9 RecName: Full=DNA mismatch repair protein mutL
 gi|182633880|gb|ACB94654.1| DNA mismatch repair protein MutL [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 637

 Score =  472 bits (1215), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 247/636 (38%), Positives = 384/636 (60%), Gaps = 42/636 (6%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L   +I++IAAGE+IERP+ A+KEL+EN+LDA++S ++ V+ GGGK+  ++TDNG
Sbjct: 1   MTIRRLDPVLIDRIAAGEVIERPAAAVKELVENALDAQASEIDVVLEGGGKTLIRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM++E++ ++V+RH TSK+ D D   I T GFRGEALPSIG+VS L+L SR      G 
Sbjct: 61  CGMSAEDLELSVERHATSKLPDGDLFAIATLGFRGEALPSIGSVSVLSLTSRMETATHGV 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            +++   +  +V P     GT +EVR+LF T PARL FLK ++ E     D ++R+A+A+
Sbjct: 121 ALSVEHGRKQTVIPCGQPRGTRIEVRELFRTTPARLKFLKGDRAEARAAADAVQRLAMAH 180

Query: 180 PKVSFTFSTIKSNRYK-MNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           P   FTF++  +  +  +           RI  V+G+DF  NA+ +  +   I L+G+ G
Sbjct: 181 PTRRFTFTSTDTAGFDYLPCAEGPEGLLARIGAVLGKDFEANALPVEAEREGIILEGFIG 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PT++R N    Y+F+NGR V+DK +   +R AY + +P GRYP + L L  DP++VDVN
Sbjct: 241 LPTWHRANGLAQYLFVNGRPVRDKLLTGAVRAAYMDYLPAGRYPALALFLRCDPQEVDVN 300

Query: 299 VHPAKSYIRFRNPTIIRNFII----QSIQKAINKKGISTSSV-LSKKMISSFHQDNAP-- 351
           VHPAK+ +RFR+  ++R  ++    Q++Q+A+++       V L    + S  Q   P  
Sbjct: 301 VHPAKAEVRFRDQGLVRGLLVGALKQTLQQAMHRATPDGGRVALGLLAMHSAGQGQRPVS 360

Query: 352 KTHLPKYATSLTNTQEKLFLQE------------------------NRLSTNDLLP---S 384
              +P  +        + +++E                        +R+  +  LP   +
Sbjct: 361 SASMPSASRQAPTMPPRDWIKEGVQDWDWRQSPARPQNPPQNPPPGDRIEMSGSLPLGFA 420

Query: 385 DDPTYSEDNDPVEESEAT----HYQ-LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLI 439
           + P     +   E SEA     H + LG A AQ+H+ YI++QT DG V+VDQHAAHERL+
Sbjct: 421 ETPAGLNGDSGKELSEAASETPHDEPLGFARAQLHETYIVAQTRDGFVLVDQHAAHERLV 480

Query: 440 FEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIRE 499
           +E+++Q   +  +  Q LL P I++L E +   +++    L   G+  E FGP A+A+RE
Sbjct: 481 YERLKQARAAQTVERQILLLPTIVELPEADVERLVDAASMLADFGLVVESFGPGALAVRE 540

Query: 500 IPAILSKKNIPQLLRDIIDEII-DSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMN 558
           IP +L   ++P L+ D+ +++  D      L+ +++++LAT AC+ S+R+GR++   EMN
Sbjct: 541 IPIVLKDGSVPALIHDLANQLQEDDKALIPLERKLDHVLATFACHHSVRAGRRLGIEEMN 600

Query: 559 RLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            LLREME+ P S QCNHGRPT+I+LKL DIE+LFGR
Sbjct: 601 ALLREMERTPGSGQCNHGRPTYIELKLGDIERLFGR 636


>gi|114569167|ref|YP_755847.1| DNA mismatch repair protein [Maricaulis maris MCS10]
 gi|114339629|gb|ABI64909.1| DNA mismatch repair protein MutL [Maricaulis maris MCS10]
          Length = 633

 Score =  472 bits (1214), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 248/627 (39%), Positives = 383/627 (61%), Gaps = 39/627 (6%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L  + +N+IAAGE++ERP+  +KEL EN+LDA + R++    GGG     I D+G G
Sbjct: 10  IRRLPPETVNRIAAGEVVERPASVVKELAENALDAGARRIDITAEGGGLVRLLIEDDGKG 69

Query: 63  MTSEEIPMAVQRHCTSKI------SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNN 116
           M+  E+ + ++RH TSK+      +DD  NI T GFRGEALPSIG+++ L++ ++     
Sbjct: 70  MSPAELELCIERHATSKLPVGENGADDLLNISTMGFRGEALPSIGSIARLSITTQAKGKG 129

Query: 117 TGAQIAISGEKISSVRPVA--MNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRR 174
               I + G K + + P A     GT +EVRDLF+  PARL FLKSE+ E   ITDV++R
Sbjct: 130 DAWAILVEGGKTNGIAPAAPLGRGGTRIEVRDLFYATPARLKFLKSERSENLGITDVVKR 189

Query: 175 MAIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNE 230
           MA++ P V F F T+   R +++  +  G   +    R+S ++G DF  NA+E+++    
Sbjct: 190 MAMSRPDVGF-FLTL-DGRKRLSVAAERGEGADARIARMSAILGADFGENALEVDQTREG 247

Query: 231 ITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEI 290
           + + G+  +PT++RGNA   Y+F+NGR V+DK +   +R AY + +   R+PVV L +E+
Sbjct: 248 VRIFGFASLPTYSRGNAMHQYLFVNGRPVRDKLLGGAVRGAYQDFLARDRHPVVALNVEL 307

Query: 291 DPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF----- 345
              +VDVNVHPAK+ +RFR+  ++R  I+ S++ A+   G   S+ ++   +        
Sbjct: 308 PTDEVDVNVHPAKAEVRFRDAALVRGLIVGSLRHALAGAGHRASTTVAGYALGRVRPEGY 367

Query: 346 ------------HQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSE-- 391
                       H ++      P+  +     Q+++F            P+ D    E  
Sbjct: 368 QPPQPPPGGYQSHTNSLAGWGAPRPPSE--PVQDRVFDPGMSARVEPDQPAYDGGMGEMP 425

Query: 392 --DNDPVEESEAT--HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDF 447
               DP ++  A    + LG+A AQ+H+ Y+++QT DG+VIVDQHAAHERL++E+M++  
Sbjct: 426 QAGFDPAQQPSAPPLDWPLGVARAQLHETYVVAQTGDGIVIVDQHAAHERLVYERMKKMI 485

Query: 448 NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKK 507
             T +  Q LL PEI++L E E   ++E  E+L  LG+  E FG  AIA+RE P++L K 
Sbjct: 486 AETGVQRQRLLVPEIVNLDEAEARRLLERGEELEELGLVIEAFGQGAIAVRETPSLLKKL 545

Query: 508 NIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKN 567
           NI  L+RD+ D++ +     +L++++E+++ TMAC+GS+RSGR++   EMN LLREME  
Sbjct: 546 NIQGLIRDLADDLAEYDQALSLKEKLEDVVGTMACHGSVRSGRRLTGEEMNALLREMEAT 605

Query: 568 PNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           P+S QCNHGRPT+++LKLSDIE+LFGR
Sbjct: 606 PHSGQCNHGRPTYVELKLSDIERLFGR 632


>gi|217979001|ref|YP_002363148.1| DNA mismatch repair protein MutL [Methylocella silvestris BL2]
 gi|254766172|sp|B8ETE4|MUTL_METSB RecName: Full=DNA mismatch repair protein mutL
 gi|217504377|gb|ACK51786.1| DNA mismatch repair protein MutL [Methylocella silvestris BL2]
          Length = 605

 Score =  471 bits (1212), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 237/608 (38%), Positives = 362/608 (59%), Gaps = 18/608 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L   +I++IAAGE+IERP+ A+KELIEN+LDA + R++  I  GG+   ++ D+G
Sbjct: 1   MPVRRLDPVLIDRIAAGEVIERPASALKELIENALDAGARRIDVAIEAGGRKLIRVVDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM  E++ +AV+RH TSK+ + D S+I T GFRGEALPSIG+V+ L + SR   +  GA
Sbjct: 61  CGMAPEDLDLAVERHATSKLPEGDLSSIETLGFRGEALPSIGSVAALEIFSRAMGSAVGA 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           ++ +         P A   GT VE+RDLF   PARL FL++++ E     +++ R+A+A+
Sbjct: 121 RVKVDCGVKEGPAPAAQPQGTRVEIRDLFAGTPARLKFLRTDRAEARASAEIVERLAMAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQG 235
           P+V F F++     + +   +   + PE    R S V+G+DF +NA+ +  +   + LQG
Sbjct: 181 PQVRFGFASSDVRGFDL---AACADSPEGRLTRFSAVLGKDFRDNALFVEAEREGVRLQG 237

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           + G+PT++R +A   +VF+NGR V+D+ +L   R AY + +P GR+  +VL L  DPR+V
Sbjct: 238 FAGLPTWHRASAAAQHVFVNGRPVRDRLLLGAARAAYMDFLPSGRHAALVLFLTCDPREV 297

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKK--------GISTSSVLSKKMISSFHQ 347
           DVNVHPAK+ +RFR+P + R  I+ ++++ +           G S   VL+++    F  
Sbjct: 298 DVNVHPAKAEVRFRDPGLTRGLIVGALKQTLADAQHRASPVNGASALDVLARRG-PGFSG 356

Query: 348 DNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEES-EATHYQL 406
              P     + + +                       +        +    S E     L
Sbjct: 357 AGGPANWDWRRSPANPGFDAAALAGFAEAPAAAFAAVESLAADTRANAAAPSLEDLEAPL 416

Query: 407 GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLL 466
           G A AQIH+ YI+SQT DG+VIVDQHAAHERL++E+++     +K   Q LL P I++L 
Sbjct: 417 GAARAQIHETYIVSQTRDGIVIVDQHAAHERLVYERLKAARAGSKAPRQALLIPAIVELA 476

Query: 467 EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTT 526
             E   I++    L   G+  E FGP A+A+ E PA+L   +  +L RD+   +++    
Sbjct: 477 RAEVEAILDAAVLLAEFGLIIEPFGPGAVAVTETPALLQDPDPTRLARDLAAALVEDDGA 536

Query: 527 YTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLS 586
             L+ R   +LATMAC+ S+R+GR+M+  EMN LLR+ME+ P S QCNHGRPT+++LKL+
Sbjct: 537 AALERRFNLVLATMACHNSVRAGRRMRPEEMNALLRDMERTPGSGQCNHGRPTYVELKLA 596

Query: 587 DIEKLFGR 594
           D+EKLFGR
Sbjct: 597 DVEKLFGR 604


>gi|329851130|ref|ZP_08265887.1| DNA mismatch repair protein MutL family protein [Asticcacaulis
           biprosthecum C19]
 gi|328839976|gb|EGF89548.1| DNA mismatch repair protein MutL family protein [Asticcacaulis
           biprosthecum C19]
          Length = 616

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 240/615 (39%), Positives = 372/615 (60%), Gaps = 26/615 (4%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I++L +  IN+IAAGE++ERP+ A+KEL+EN++DA +  ++     GG S   I DNG G
Sbjct: 4   IQRLPQDTINRIAAGEVVERPASAVKELVENAIDAGARHIDIRAEQGGLSRILIEDNGSG 63

Query: 63  MTSEEIPMAVQRHCTSKI------SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNN 116
           M   ++ +AV+RH TSK+      + D  +I T GFRGEALPS+G+V+ L ++S+    +
Sbjct: 64  MAGPDLELAVERHATSKLKPQADGTWDLLHIQTLGFRGEALPSMGSVARLNIVSKSRGGD 123

Query: 117 TGAQIAISGEKISSVRPVAM--NPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRR 174
             A I + G  +S ++P A   + GT +++RDLF+  PARL F+KSE+ E   I + ++R
Sbjct: 124 ALA-IQVDGGAVSGLKPAAFGGDHGTRIDLRDLFYATPARLKFMKSERSENMAIAEEVKR 182

Query: 175 MAIAYPKVSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEIT 232
            A+A+  V F+   +   R    F    G      R++ ++G DF +NA+ +++    + 
Sbjct: 183 QAMAHEDVGFSLE-LDGKRVLKLFAEQAGFEGRLRRLAAILGSDFGDNALLIDQAREGVR 241

Query: 233 LQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDP 292
           L GY G+PTF+RGNA   Y+F+N R V+DK +   +R AYA+ +   R+P+  L +EIDP
Sbjct: 242 LTGYAGLPTFSRGNAMHQYLFVNNRPVRDKLLTGALRAAYADFLARDRHPLAALFVEIDP 301

Query: 293 RQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA-P 351
           + +DVNVHPAK+ +RFR+P ++R  II +++  +   G   ++ +++  ++ F  ++  P
Sbjct: 302 QDLDVNVHPAKAEVRFRDPNLVRGLIIGALKHGLASAGHRAATTVAQTALTGFRVESVQP 361

Query: 352 KTHLPKYATSLTNTQEKLFLQENRLSTNDLLP------------SDDPTYSEDNDPVEES 399
             +L +   S           E    T    P            S+ P      D V  S
Sbjct: 362 LLNLNRPTPSQIAAVRPYMAPEPFAPTARFEPVSYETAAYALGVSEAPVLERPVD-VAAS 420

Query: 400 EATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLT 459
               + LG A AQIH+ YII+QT DGLVIVDQHAAHERL++E+M+       + SQ+LL 
Sbjct: 421 AVDAFPLGAARAQIHETYIIAQTADGLVIVDQHAAHERLVYEEMKVAMAQGHVQSQSLLI 480

Query: 460 PEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDE 519
           PEI+DL   E A ++   +DL  +G++ E FGP ++ +R+IPA++   +I  L+RD++D+
Sbjct: 481 PEIVDLEREEVARLVARRDDLATMGLQVEAFGPTSVLVRDIPALMGDCDISGLVRDLVDD 540

Query: 520 IIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPT 579
           + +      L++R+  I    AC  S+RSGR++ + EMN LLR+ME  P+S QCNHGRPT
Sbjct: 541 LTEHGELLALKERMAEICGDHACRHSVRSGRRLNAHEMNALLRQMEATPHSGQCNHGRPT 600

Query: 580 FIKLKLSDIEKLFGR 594
           +++LKL DIEKLFGR
Sbjct: 601 YVELKLKDIEKLFGR 615


>gi|87200143|ref|YP_497400.1| DNA mismatch repair protein MutL [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87135824|gb|ABD26566.1| DNA mismatch repair protein MutL [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 603

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 238/607 (39%), Positives = 364/607 (59%), Gaps = 23/607 (3%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E +IN+IAAGE++ERP+ A+KEL+EN++DA SS V   ++ GG +  +++D+G G
Sbjct: 4   IRRLPETLINRIAAGEVVERPASALKELVENAIDAGSSHVHVRLSEGGLAMIEVSDDGCG 63

Query: 63  MTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M  +EI +A++RH TSK+ D+    + T GFRGEALPSI +V+ +T+ SRP     G + 
Sbjct: 64  MRPDEIALALERHATSKLPDEAIELVETLGFRGEALPSIASVARVTIESRPHGTAEGWKR 123

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +    + +  P A+ PGT V V  LF  IPAR  FL+S + E    +DV+RR+A+A P 
Sbjct: 124 VVDNGALVAEGPAALPPGTRVRVEHLFEKIPARRKFLRSPRSEWAAASDVVRRLAMARPD 183

Query: 182 VSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPT 241
           V FT       R  ++ Q+       R++Q++  +   N+VE++    +  L G  G+PT
Sbjct: 184 VGFTLE--HDGRRALHVQAGE-TLEARVAQLVARELAGNSVEVDLVRGDFHLTGIAGLPT 240

Query: 242 FNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHP 301
           FNRG A+  Y+F+NGR V+D+ ++  +R AYA+ +   R+ V+ L L++   +VDVNVHP
Sbjct: 241 FNRGVADHQYLFVNGRPVKDRLLIGAVRGAYADMLARDRHAVLALFLQVPASEVDVNVHP 300

Query: 302 AKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYATS 361
           AKS +RFR+P ++R  ++  ++ A++     ++   S   ++++    A     P  ++ 
Sbjct: 301 AKSEVRFRDPALVRGMVVSGLRHALSTGDQRSAQAPSASAMAAW---QAEPIAPPPPSSP 357

Query: 362 LTNTQEKLFLQ----ENRLS---------TNDLLPSDDPTYSEDNDPVEESEATHYQLGI 408
            ++ Q  +F Q    E R+S            ++            PV   +A  + LG+
Sbjct: 358 SSDWQGSIFSQQWKPEPRVSEAGQAWRGYEQAIMAPPSARAEPAAQPV--VDAAQHPLGV 415

Query: 409 ACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKIT-SQTLLTPEIIDLLE 467
           A  QI   YI+++  DGLVIVDQHAAHERL+ E++R       +  SQ LL PE+++L E
Sbjct: 416 ARGQISNTYIVAEAEDGLVIVDQHAAHERLVLERLRAAGAGQGVAPSQALLIPEVVELDE 475

Query: 468 GECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTY 527
             C  + E  E L   G+  ERFGPNA+ +R IPA L+K +  +L+ D+ D++       
Sbjct: 476 TACDRLEEASEKLAEFGLALERFGPNAVLVRAIPAALAKGDPARLVADVADDLAHHGDAL 535

Query: 528 TLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSD 587
            L ++++ +LATMAC+GS+R+GR +   EMN LLREME  P S QCNHGRPT++KL   D
Sbjct: 536 LLGEKLDLVLATMACHGSVRAGRTLSVAEMNALLREMEVTPRSGQCNHGRPTWVKLAHGD 595

Query: 588 IEKLFGR 594
           IEKLFGR
Sbjct: 596 IEKLFGR 602


>gi|188583966|ref|YP_001927411.1| DNA mismatch repair protein MutL [Methylobacterium populi BJ001]
 gi|179347464|gb|ACB82876.1| DNA mismatch repair protein MutL [Methylobacterium populi BJ001]
          Length = 671

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 244/657 (37%), Positives = 372/657 (56%), Gaps = 66/657 (10%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           +R+L   ++++IAAGE++ERP+ A+KEL+EN++DA +  +E  I GGG+   ++ D+G G
Sbjct: 15  VRRLDPILVDRIAAGEVVERPASAVKELVENAIDAGARSIEVAIEGGGRRLIRVIDDGIG 74

Query: 63  MTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M +E++ +AV+RH TSK+ D D + I + GFRGEALPSIGAVS LT+ SR   +  G  +
Sbjct: 75  MGAEDLALAVERHATSKLPDGDLTRIGSLGFRGEALPSIGAVSRLTITSRT-ADGEGLSL 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            I       VRP     GT +EV +LF   PARL FLKS++ ET  +++++RR+A+A P+
Sbjct: 134 TIDSGAKGPVRPAPATRGTRIEVTELFAATPARLKFLKSDRAETAAVSEILRRLAVAQPQ 193

Query: 182 VSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           + FT  T   +      +S  G      R+  V+G DF  NAV ++       L G+ G+
Sbjct: 194 IRFTLRTESGSPTVFPAESEPGPAALLRRLGAVLGPDFPGNAVPVDMAREGFALAGHVGL 253

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF+RG AN  +  +NGR V+D+ +L  +R AYA+T+   R+PV+ L L  DP  VDVNV
Sbjct: 254 PTFHRGAANHIHFVVNGRPVRDRLLLGAVRGAYADTMSSDRHPVLALHLTCDPALVDVNV 313

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF-------------- 345
           HPAK+ +RFR P ++R  I+ +I +A+ + G  +SS  ++  + +               
Sbjct: 314 HPAKTELRFREPGLVRALIVSAIHEALRRAGARSSSTGTQAALDALRAGGSLASGSLGGG 373

Query: 346 ----------------HQDNAPKTHL-PKYATSLTN------------TQEKLFLQE--- 373
                           H   +  + L P+ A  L +             Q   F  E   
Sbjct: 374 GLGGVPAMRSGGGFAVHTGASAASPLTPRSAARLFSGPSVAAPAGYRAPQHPAFATERPG 433

Query: 374 -----NRLSTNDLLPSDDPTYSEDNDPVE-ESEATHYQLGIACAQIHQNYIISQTTDGLV 427
                  L   DL P       E     E E+    + LG A AQIH+ YI++QT DG+V
Sbjct: 434 FAETPQALFAADLAPPGADLRPEPEAVFEAETPPDSHPLGAARAQIHETYILAQTRDGIV 493

Query: 428 IVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKA 487
           +VDQHAAHERL++E+++++     +  Q LL P+++++   E   ++E   +L RLG+  
Sbjct: 494 LVDQHAAHERLVYERLKRERAGGGVARQGLLIPDVVEMAPEEADRLVEAAPELERLGLSL 553

Query: 488 ERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTY----------TLQDRIENIL 537
           E FGP A+ +R +PA L+  ++  L+ D++D +  S               +  R++ +L
Sbjct: 554 EAFGPGAVLVRAVPAALAGGSVRNLVLDVLDALQASGVEEGGPAGEGDPDPVSRRLDALL 613

Query: 538 ATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           + M+C+GSIR+GR+++  EMN LLREME  P S  CNHGRPTF+ L L+DIE+LFGR
Sbjct: 614 SRMSCHGSIRAGRRLKPEEMNALLREMEATPLSGSCNHGRPTFVTLGLADIERLFGR 670


>gi|117924347|ref|YP_864964.1| DNA mismatch repair protein MutL [Magnetococcus sp. MC-1]
 gi|117608103|gb|ABK43558.1| DNA mismatch repair protein MutL [Magnetococcus sp. MC-1]
          Length = 632

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 234/624 (37%), Positives = 365/624 (58%), Gaps = 31/624 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           ++++L E + NQIAAGE++ERP+  IKEL+ENS+DA +S +E     GGK   Q+ DNG 
Sbjct: 8   RVQQLPETLANQIAAGEVVERPASVIKELVENSIDAGASLIEVKAEQGGKRLMQVVDNGH 67

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           GM+ +E  +A+ RH TSKI  ++D   I T GFRGEALPS+G+V+ L L +R  +N  G 
Sbjct: 68  GMSEDEASLALTRHATSKIHTAEDLFRIATLGFRGEALPSVGSVAQLELATRIEENADGV 127

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + + G    + + +AM  GT V VR+LFF  PARL FLK+++ E N I ++++R AIAY
Sbjct: 128 ALTVMGGARQASKRLAMPVGTRVTVRNLFFNTPARLKFLKADRTEANQIMELMQRFAIAY 187

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V F  S            +    + ER+  V+G +FI N +E+N    ++ ++G+ G+
Sbjct: 188 PHVGFKLSLNGKEVQHYRAVADESAYVERLGAVLGAEFIPNCMEINSGDAQMRVRGWVGL 247

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT NRG+A+  ++F+NGR V+DK + + +R AY + +P  R+P+  L +++DP +VDVNV
Sbjct: 248 PTLNRGSASAMHLFVNGRWVRDKVVTAAVREAYRDLMPRERFPLTALFVQVDPEEVDVNV 307

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKG-----ISTSSVLSKKMISSFHQD------ 348
           HPAK+ +RFR+   +   + +++ + ++  G      S + + S +    +  D      
Sbjct: 308 HPAKAEVRFRHGQSVYGLLRRTLAEVLHGMGARCYQASEAPLQSAEEPPEYGADLGKQRL 367

Query: 349 ----------NAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLP-------SDDPTYSE 391
                     + P+   P Y  +         +          LP       S  P    
Sbjct: 368 AEPVQLPAAVSQPERWRPSYPPAGEGVPRAAAVANWSPQRQGALPLQSRDSYSPAPGQPR 427

Query: 392 DNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDF-NST 450
              P  E+   H  LG A AQ+H  YI++Q+  G+V++DQHAAHER+++E+M+  +    
Sbjct: 428 PTAPHHEAAMDHGPLGQAVAQLHNLYIVAQSEQGMVLIDQHAAHERIVYERMKGAWARKE 487

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
           K+ +Q LL PE++ L E E   +      L +LGI  E FG NA  IRE+PA+L++  I 
Sbjct: 488 KVETQMLLMPEVLQLSEVEAERMSHWRSTLQQLGIAVEPFGQNAFVIREVPALLARGQIA 547

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
            L+RD+++++        L +  + +LA+MAC+GS+RSGR +   EMN LLREME+ P++
Sbjct: 548 PLVRDVVEQLEQVGQESALSEAQDAVLASMACHGSVRSGRALTREEMNALLREMERTPHT 607

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
            QCNHGRPT ++L L+D+E+LF R
Sbjct: 608 GQCNHGRPTHVRLSLADLERLFER 631


>gi|296284037|ref|ZP_06862035.1| DNA mismatch repair protein [Citromicrobium bathyomarinum JL354]
          Length = 590

 Score =  465 bits (1196), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 234/596 (39%), Positives = 357/596 (59%), Gaps = 27/596 (4%)

Query: 19  IIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTSEEIPMAVQRHCTS 78
           +IERP+ A+KEL+EN++D+ ++R+   +  GG    ++ D+G GM+ EE+ +A++RH TS
Sbjct: 1   MIERPAAALKELVENAIDSGATRITVSLEDGGIGAIEVVDDGCGMSPEEMALALERHATS 60

Query: 79  KISDDF-------SNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAISGEKISSV 131
           K+ +D          + T GFRGEALPSI +V+  TL SRP   ++G +  +   ++   
Sbjct: 61  KLPEDLVGEGHALEQVATLGFRGEALPSIASVARFTLESRPHNADSGWRRVVDHGRVVED 120

Query: 132 RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVSFTFSTIKS 191
           +P A+ PGT   + D F  +PAR  FL++ + E     D++RR+A+A P + FTFS    
Sbjct: 121 KPSAVPPGTRARIEDFFREVPARRKFLRTPRSEFAACQDIVRRLAMARPDIGFTFS---- 176

Query: 192 NRYKMNFQSTNGN-FPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNRGNANQF 250
           N  + + Q   G   PER+ +++  D  +N V ++    E+TL G  G+PT+NRG A+  
Sbjct: 177 NNGRRSLQLQRGEALPERVVRLVSRDLKDNCVPIDLARGEMTLTGIAGLPTYNRGVADHQ 236

Query: 251 YVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSYIRFRN 310
           Y+F+NGR V+D+ ++  +R AYAE +   R+ V+ L L++ P  VDVNVHPAKS +RFR+
Sbjct: 237 YLFVNGRPVKDRLLVGAVRGAYAEMLARDRHAVLALFLDLPPEDVDVNVHPAKSEVRFRD 296

Query: 311 PTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYATSL----TNTQ 366
           P  +R  I+  ++ A++     ++       ++ +  +  P    P  A+        + 
Sbjct: 297 PQGVRGMIVGGLRAALSTGDKRSAQAPDASAMAKWQAE--PVAPEPPAASIFDRFAGGSA 354

Query: 367 EKLFLQENRLSTNDLLPSDDP--TYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTD 424
               LQE R+       +D P    +E+  P+ + EA  Y LGIA  QI   YI+++  D
Sbjct: 355 SATALQEPRMDWRAQQAADAPPSGRAEEAAPLPQ-EARDYPLGIARGQIANTYIVAEAAD 413

Query: 425 GLVIVDQHAAHERLIFEKMRQ-DFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRL 483
           GLV+VDQHAAHERL  E++R  D  S    SQ LL PE+++L E EC  +     DL R+
Sbjct: 414 GLVLVDQHAAHERLTLERLRSADAGSATARSQALLMPEVVELSEAECDRLEGIAADLDRM 473

Query: 484 GIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEI----IDS-STTYTLQDRIENILA 538
           G+  ERFGP A+ +R +P  L K +   LLRDI D++    +D    +  L ++IE +LA
Sbjct: 474 GLAIERFGPAAMLVRSLPHALPKADPHALLRDIADDLATNGVDGEGGSLLLTEKIEYVLA 533

Query: 539 TMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           TMAC+GS+R+GR ++  EMN LLREME+ P S QCNHGRPT++KL + ++EKLFGR
Sbjct: 534 TMACHGSVRAGRTLRVEEMNALLREMERTPRSGQCNHGRPTWVKLSMEEVEKLFGR 589


>gi|148553415|ref|YP_001260997.1| DNA mismatch repair protein [Sphingomonas wittichii RW1]
 gi|166232109|sp|A5V3J3|MUTL_SPHWW RecName: Full=DNA mismatch repair protein mutL
 gi|148498605|gb|ABQ66859.1| DNA mismatch repair protein MutL [Sphingomonas wittichii RW1]
          Length = 594

 Score =  464 bits (1195), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 232/605 (38%), Positives = 367/605 (60%), Gaps = 23/605 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E ++N+IAAGE++ERP+ A+KEL+ENS+DA + R+   ++ GG S   + D+G
Sbjct: 1   MSIRRLPEHLVNRIAAGEVVERPASALKELVENSIDAGARRISVSLSEGGLSAIDVADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +EI +A++RH TSK+ DD    + T GFRGEALPSIG+V+ LT+ SR    +   
Sbjct: 61  CGMTPDEIALALERHATSKLPDDAIEAVTTLGFRGEALPSIGSVADLTIESRVRGADGWH 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +    GE +    P A+ PGT + V +LF  +PAR  FL+S + E     DVI+R+A+A 
Sbjct: 121 RRVDHGELVGE-GPAALPPGTRIRVSNLFAKVPARRKFLRSARAEYAACVDVIKRLAMAR 179

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P + FT   ++    +    + +    +R++ +   D   N+V ++ +   ++L G  G+
Sbjct: 180 PDIGFT---LEHEGRRAILVAPDEQRVDRVAALTDRDLAQNSVAVDFRREAVSLTGVAGL 236

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTFNRG A+  ++F+NGR V+D+ ++  +R AY + +   R+PV+ L +E+   QVDVNV
Sbjct: 237 PTFNRGVADHQFLFVNGRPVKDRLLIGAVRGAYQDMLARDRHPVIALFVELPGDQVDVNV 296

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH----- 354
           HPAK+ +RFR+P ++R  I+  ++ A+++ G  +    S   + ++     P        
Sbjct: 297 HPAKTEVRFRDPGLVRGMIVGGLRAALDEAGHRSVQRPSVAALGNWQAGGLPTASSTAPA 356

Query: 355 LP-KYATSLTNTQEKLFLQENRLSTNDLLPS----DDPTYSEDNDPVEESEATHYQLGIA 409
           +P  +A      +       +R++  D  P+     +P YS    P +++    Y +G+A
Sbjct: 357 IPNGFAFGAAAERSGQGSVWDRVA--DFAPAPMARAEPAYSP---PPQQAS---YPMGVA 408

Query: 410 CAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGE 469
             Q+   YI+++  DGLVIVDQHAAHERL+ E+MR+      +  Q LL PE+++L E  
Sbjct: 409 RGQVAATYIVAEAEDGLVIVDQHAAHERLVLERMRRAMADGGVARQALLLPEVVELDEVG 468

Query: 470 CALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTL 529
           C  +     +L  +G++ ERFGP A+ +R  PA+L + ++  L+ D+ DE+       +L
Sbjct: 469 CDRLETRIAELAEMGLELERFGPKAMLVRATPALLGQGDVHGLIVDLADELAAYDEALSL 528

Query: 530 QDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIE 589
           ++R++++ ATMAC+GS+R+GR +   EMN LLREME  P+S QCNHGRPT+IKL   DIE
Sbjct: 529 KERLDHVAATMACHGSVRAGRTLSVAEMNALLREMEVTPHSGQCNHGRPTWIKLGHGDIE 588

Query: 590 KLFGR 594
           KLFGR
Sbjct: 589 KLFGR 593


>gi|114799039|ref|YP_759640.1| DNA mismatch repair protein [Hyphomonas neptunium ATCC 15444]
 gi|114739213|gb|ABI77338.1| putative DNA mismatch repair protein MutL [Hyphomonas neptunium
           ATCC 15444]
          Length = 634

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 233/624 (37%), Positives = 362/624 (58%), Gaps = 34/624 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IRKL   ++N+IAAGE++ERP+ A+KEL+EN+LDA +  +   I  GG     I D+G G
Sbjct: 11  IRKLPADVVNRIAAGEVVERPAAAVKELVENALDAGARSIAIAIEEGGLKRITIEDDGCG 70

Query: 63  MTSEEIPMAVQRHCTSKISDD------FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNN 116
           ++++++ +A++RH TSK+  D        NI+T GFRGEALPSI +VS + ++SR    +
Sbjct: 71  LSADDLLIALERHATSKLVPDTEGRVDLLNIYTMGFRGEALPSIASVSRMRIVSRASGED 130

Query: 117 TGAQIAISGEKISSVRPVAMNP----GTIVEVRDLFFTIPARLNFLKSEQVETNLITDVI 172
             A+I     ++   RP A       GT ++V DLF   PARL F++ E+ E   +TD +
Sbjct: 131 A-AEIFSDAGRLDGPRPAAFTGRSETGTRIDVNDLFHATPARLKFMRGERAEAMAVTDAV 189

Query: 173 RRMAIAYPKVSFTFSTIKSN--RYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNE 230
           +R+A+A P+V+F+  +   +  RY        G   +R+  ++G DF +NAV ++     
Sbjct: 190 KRLAMANPEVAFSLESNGRSLFRYPAEGPGDAGRL-KRLGAIMGRDFSDNAVAVDATREG 248

Query: 231 ITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEI 290
           + L G+ G+PT NRGNA   ++F+NGR V+D+ +   +R AY + +   R+P+  L +++
Sbjct: 249 VRLSGFAGLPTLNRGNAQMQFLFVNGRPVKDRMLTGVVRAAYQDFLARDRHPMAALFVDL 308

Query: 291 DPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA 350
           DP  VDVNVHPAK+ +RFR+   +R  +I +++ A+   G   S+ ++   +     + A
Sbjct: 309 DPEGVDVNVHPAKTEVRFRDAGGVRGLMISALRHALAAAGHRASTTVAGFALGKARAEPA 368

Query: 351 PKTH----------------LPKYATSLTNTQEKLFLQ--ENRLSTNDLLPSDD-PTYSE 391
           P+                  +P    +    +E         R    D +P    P    
Sbjct: 369 PQAGFLWQAPQPGGYVQRPAMPPQGYAARQVEEDGASAPFAPRGYVPDYVPDQGAPGAKV 428

Query: 392 DNDPVEESEA-THYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST 450
           +  P+        Y LG A AQ+H+ YII+QT DG+VIVDQHAAHERL++E M++     
Sbjct: 429 ETGPMPAPGMLGEYPLGAARAQVHETYIIAQTADGIVIVDQHAAHERLVYEAMKRQMAEG 488

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
            +  Q LL P+I++L E E   +    E+L  LG++ E FGP AIA+R  PA+  + +  
Sbjct: 489 GVRRQALLIPDIVELSEDEAHRVCARAEELAALGLEIEPFGPGAIAVRATPALFGEMDAA 548

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
            L+RD+ D+  +     TL +R E ++  MAC  SIR+GR++ + EMN LLR+ME  P+S
Sbjct: 549 GLIRDLADDFAEYEAGLTLSERFEEVMGNMACRSSIRAGRRLNADEMNALLRQMEATPHS 608

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
            QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 609 GQCNHGRPTYVELKLADIERLFGR 632


>gi|85708576|ref|ZP_01039642.1| DNA mismatch repair enzyme [Erythrobacter sp. NAP1]
 gi|85690110|gb|EAQ30113.1| DNA mismatch repair enzyme [Erythrobacter sp. NAP1]
          Length = 610

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 231/612 (37%), Positives = 367/612 (59%), Gaps = 24/612 (3%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR+L   ++N+IAAGE++ERP+ A+KEL+EN++DA + R+  V+  GG +  ++TD+G 
Sbjct: 3   QIRRLPTALVNRIAAGEVVERPAAALKELVENAIDAGARRIGVVLTDGGLTRLEVTDDGC 62

Query: 62  GMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           GMT +E+ +A++RH TSK+ D+    + T GFRGEALPSI +V+ LTL SRP     G +
Sbjct: 63  GMTPDEMGLALERHATSKLPDEAIEMVATLGFRGEALPSIASVARLTLESRPKGAADGWR 122

Query: 121 IAIS-GEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
             +  GE +    P A+  GT V V  +F  +PAR  FL++ + E     D++RR+A+A 
Sbjct: 123 RVVDHGETVEDA-PAALPVGTRVRVEQIFAKVPARRKFLRTPRSEYIACLDIVRRLAMAR 181

Query: 180 PKVSFTFSTIKSNRYKMNFQS-TNGNFPERISQVIGEDFINNAVEL----NEKSNEITLQ 234
           P ++FT       + +    + T+     R++Q++  +  +NAVE+    +     + L 
Sbjct: 182 PDIAFTLENGAEGKIRKALATQTDEGLSNRVAQIVARELKDNAVEIELERDGPHGPMRLS 241

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           G  G+PT+NRG A+  Y+F+NGR V+DK +   +R AY++ +   R+ V+ L L++ P  
Sbjct: 242 GLAGLPTYNRGVADHQYLFVNGRPVKDKLLTGAVRGAYSDMLARDRHAVLALFLDVPPED 301

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAK+ +RFR+ T +R FI+  +++A+      ++    +  +  +    A   H
Sbjct: 302 VDVNVHPAKTEVRFRDSTGVRGFIVSGLRQALATGDRRSAQGPDRAAMERWQ---AEPVH 358

Query: 355 LPKYATSLTNTQEKLFLQENRLSTN--DLLPSDDPTY----SEDNDPVEESEATHYQLGI 408
            P  A             + R++    +  P  D       +E+  P+ E+E   Y LGI
Sbjct: 359 EPAPAMRSIFESRDWSAPQQRVAEPRVEYTPRPDAALPQGRAEEAAPI-ENEVAEYPLGI 417

Query: 409 ACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLE 467
           A  Q+   YI++++ D L++VDQHAAHERL+ E++ R         SQ LL P+++++ E
Sbjct: 418 ARGQVANTYIVAESKDALILVDQHAAHERLVLERLKRAGAGEATQRSQALLVPDVVEMDE 477

Query: 468 GECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEII-----D 522
            +C  + +  E L R G+  ERFGP A+ +R +P+ ++K +  +LLRD+ D+I      +
Sbjct: 478 ADCDRLEDAAEGLARFGLTVERFGPAAMLVRSVPSAIAKADTGKLLRDLADDIAKHGKQE 537

Query: 523 SSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIK 582
            S +  L +R+E +LATMAC+GS+R+GR +   EMN LLREME  P S QCNHGRPT++K
Sbjct: 538 DSGSLLLAERLEYVLATMACHGSVRAGRVLSVAEMNALLREMEATPRSGQCNHGRPTWVK 597

Query: 583 LKLSDIEKLFGR 594
           L + D+EKLFGR
Sbjct: 598 LSMEDVEKLFGR 609


>gi|85373986|ref|YP_458048.1| DNA mismatch repair protein [Erythrobacter litoralis HTCC2594]
 gi|84787069|gb|ABC63251.1| DNA mismatch repair enzyme [Erythrobacter litoralis HTCC2594]
          Length = 607

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 224/612 (36%), Positives = 357/612 (58%), Gaps = 29/612 (4%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E ++N+IAAGE++ERPS A+KEL+EN++DA ++R+   +  GG +  ++TD+G G
Sbjct: 4   IRRLPEALVNRIAAGEVVERPSAALKELVENAVDAGATRIAVHLIDGGLTRIEVTDDGCG 63

Query: 63  MTSEEIPMAVQRHCTSKISDDF-------SNIHTFGFRGEALPSIGAVSHLTLMSRPPQN 115
           M    + +A++RH TSK+ DD          + T GFRGEALPSIG+VS   L SRP  +
Sbjct: 64  MDPAAMELALERHATSKLPDDLIGEAQAIERVATLGFRGEALPSIGSVSRFALESRPHGS 123

Query: 116 NTGAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRM 175
             G +  +    +    P A+ PGT   +  +F  +PAR  FL++ + E     DVIRR+
Sbjct: 124 EQGWRRVVDHGTLVEEGPAALPPGTRARIEQVFAKVPARRKFLRTPRSEYGACLDVIRRL 183

Query: 176 AIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQG 235
           A+A P + FT       R     Q      P+R++Q++  +  +NAV L+ + + +TL G
Sbjct: 184 AMARPDIGFTLD--HGERRVFALQPGE-ELPDRVAQIVAPELKDNAVLLDMQRDTMTLTG 240

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
             G+PT+NRG A+  Y+F+NGR V+D+ ++  +R AY++ +   R+ V+ L L++    V
Sbjct: 241 IAGLPTYNRGVADHQYLFVNGRPVKDRLLVGAVRGAYSDMLARDRHAVLALFLDLPSEDV 300

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL 355
           DVNVHPAK+ +RFR+   +R FI+  +++A++     ++    +  +  + Q+   +   
Sbjct: 301 DVNVHPAKTEVRFRDAQAVRGFIVSGLRQALSTGDRRSAQGPDRTAMKRWQQEPVREEPS 360

Query: 356 P------------KYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATH 403
           P            K  T +     +    E  +  +   P      +ED   +      H
Sbjct: 361 PALRSIFEGRGWSKPGTGVREPSHEWHSHEGEVIAS---PQGRAVEAED---IAADAKQH 414

Query: 404 YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKIT-SQTLLTPEI 462
           + LG+A  Q+   YI+++  DGLV+VDQHAAHERL+ E+++       ++ SQ LL PE+
Sbjct: 415 FPLGVARGQVANTYIVAEAADGLVLVDQHAAHERLVLERLKAAGAGEAVSRSQALLMPEV 474

Query: 463 IDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIID 522
           ++L E  C  +    E L  +G+  ERFGP A+ +R +P  L+  N  +LL+DI D++  
Sbjct: 475 VELDEPSCDRLESAAEKLDAMGLSIERFGPGAMLVRSLPHALAGSNPGKLLQDIADDLAK 534

Query: 523 SSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIK 582
                 L+++++ +L TMAC+GS+R+GR ++  EMN LLREME+ P S QCNHGRPT++K
Sbjct: 535 HGDALWLEEKLDLVLGTMACHGSVRAGRTLRVDEMNALLREMERTPRSGQCNHGRPTWVK 594

Query: 583 LKLSDIEKLFGR 594
           L + D+EKLFGR
Sbjct: 595 LSMEDVEKLFGR 606


>gi|307292927|ref|ZP_07572773.1| DNA mismatch repair protein MutL [Sphingobium chlorophenolicum L-1]
 gi|306880993|gb|EFN12209.1| DNA mismatch repair protein MutL [Sphingobium chlorophenolicum L-1]
          Length = 590

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 226/595 (37%), Positives = 355/595 (59%), Gaps = 7/595 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E ++N+IAAGE++ERP+ A+KE++EN++DA S R+   IA GG    +++D+G
Sbjct: 1   MSIRRLPEHLVNRIAAGEVVERPASALKEIVENAVDAGSRRIAIRIANGGLDRIEVSDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM S EI +A++RH TSK+ DD   N+ T GFRGEALPSI +V+ L++ SRP   + G 
Sbjct: 61  CGMDSSEIALALERHATSKLPDDAIENVATLGFRGEALPSIASVARLSIDSRP-AGSDGW 119

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
              +    + +  P A+ PGT V V  LF  +PAR  FL+S + E     DV+RR+A+A+
Sbjct: 120 NRTVDNGVVVNEGPAALPPGTRVIVEQLFGKVPARRKFLRSAKAEYAACLDVVRRLAMAH 179

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+       R  +  Q+      +R++ +      +N V +  +   + L G   +
Sbjct: 180 PAIAFSME--HDGRRVLGVQADEAR-EDRVAALTDRALADNHVIVALEREGVRLSGVASL 236

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT+NRG  +  ++F+NGR V+D+ ++  +R AYA+ +   R+PVV L L++ P +VDVNV
Sbjct: 237 PTYNRGVGDHQFLFVNGRPVRDRLLVGAVRGAYADMLARDRHPVVALFLDVPPLEVDVNV 296

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HPAK+ +RFR+P +IR  I+  +++A++ +G           +S++  +  P +  P  A
Sbjct: 297 HPAKTEVRFRDPALIRGMIVSGLRRALDAEGFRAVQHADPAGLSAWRPE--PVSPTPIGA 354

Query: 360 TSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYII 419
             +           +         +  P    +       E T + LG+A  Q+ + YI+
Sbjct: 355 MPIFEAAGAPVPAYSVAERRPTFLTPPPQARAEPAAAPAPEGTSFPLGVARGQVARTYIV 414

Query: 420 SQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDED 479
           ++  DGLVIVDQHAAHERL  E+MR+      + +Q LL PE+++L E  C  +     +
Sbjct: 415 AEAEDGLVIVDQHAAHERLTLERMRRAMEGQGVAAQALLLPEVVELDEPACDRLEARIAE 474

Query: 480 LHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILAT 539
           L   G++ ERFGP A+ +R  PA+L + ++  L+ D+ D++    +  +L++R++ + AT
Sbjct: 475 LKDFGLELERFGPAAMLVRATPAMLGQGDVQGLVSDLADDLAAYDSALSLKERLDLVAAT 534

Query: 540 MACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           MAC+GS+R+GR +   EMN LLREME  P S QCNHGRPT++KL   DIEKLFGR
Sbjct: 535 MACHGSVRAGRILSVAEMNALLREMEITPRSGQCNHGRPTWVKLGHGDIEKLFGR 589


>gi|294011778|ref|YP_003545238.1| DNA mismatch repair protein MutL [Sphingobium japonicum UT26S]
 gi|292675108|dbj|BAI96626.1| DNA mismatch repair protein MutL [Sphingobium japonicum UT26S]
          Length = 590

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 226/595 (37%), Positives = 356/595 (59%), Gaps = 7/595 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E ++N+IAAGE++ERP+ A+KE++EN++DA S R+   I+ GG    +++D+G
Sbjct: 1   MSIRRLPEHLVNRIAAGEVVERPASALKEIVENAVDAGSRRIAIRISNGGLDRIEVSDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM S EI +A++RH TSK+ DD   N+ T GFRGEALPSI +V+ L++ SRP  ++   
Sbjct: 61  CGMDSSEIALALERHATSKLPDDAIENVATLGFRGEALPSIASVARLSIDSRPAGSDGWN 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +   +G  +S   P A+ PGT V V  LF  +PAR  FL+S + E     DV+RR+A+A+
Sbjct: 121 RTVDNGVTVSE-GPAALPPGTRVIVEQLFGKVPARRKFLRSAKAEYAACLDVVRRLAMAH 179

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+       R  +  Q+      +R++ +      +N V +  +   + L G   +
Sbjct: 180 PAIAFSME--HDGRRVLGVQAGEAR-EDRVAALTDRALADNHVIVALEREGVRLSGVASL 236

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT++RG  +  ++F+NGR V+D+ ++  +R AYA+ +   R+PVV L L++ P +VDVNV
Sbjct: 237 PTYHRGVGDHQFLFVNGRPVRDRLLVGAVRGAYADMLARDRHPVVALFLDVPPLEVDVNV 296

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HPAK+ +RFR+P +IR  I+  +++A+  +G           +S++  +  P +  P  A
Sbjct: 297 HPAKTEVRFRDPALIRGMIVSGLRRALEAEGFRAVQHADPAGLSAWRSE--PVSPTPIGA 354

Query: 360 TSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYII 419
             +           +         +  P    +       E T + LG+A  Q+ + YI+
Sbjct: 355 MPIFEAAGAPVPTHSMADRRPAFLTPPPQARAEPAAAPAPEGTSFPLGVARGQVARTYIV 414

Query: 420 SQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDED 479
           ++  DGLVIVDQHAAHERL  E+MR+      I +Q LL PE+++L E  C  +     +
Sbjct: 415 AEAEDGLVIVDQHAAHERLTLERMRRAMEGQGIAAQALLLPEVVELDEPACDRLEARIAE 474

Query: 480 LHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILAT 539
           L   G++ ERFGP A+ +R  PA+L + ++  L+ D+ D++    +  +L++R++ + AT
Sbjct: 475 LKDFGLELERFGPAAMLVRATPAMLGQGDVQGLVSDLADDLAAYDSALSLKERLDLVAAT 534

Query: 540 MACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           MAC+GS+R+GR +   EMN LLREME  P S QCNHGRPT++KL   DIEKLFGR
Sbjct: 535 MACHGSVRAGRILSVAEMNALLREMEITPRSGQCNHGRPTWVKLGHGDIEKLFGR 589


>gi|326387365|ref|ZP_08208974.1| DNA mismatch repair protein MutL [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326208021|gb|EGD58829.1| DNA mismatch repair protein MutL [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 618

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 234/619 (37%), Positives = 366/619 (59%), Gaps = 36/619 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E ++N+IAAGE++ERP+ A+KEL+EN++DA ++ V   ++ GG S  ++TD+G G
Sbjct: 8   IRRLPEHLVNRIAAGEVVERPASALKELVENAIDAGATHVSVRLSEGGLSLIEVTDDGCG 67

Query: 63  MTSEEIPMAVQRHCTSKISDDF-------SNIHTFGFRGEALPSIGAVSHLTLMSRPPQN 115
           M ++E+ +A++RH TSK+ +           + T GFRGEALPSI +V+ LT+ SR  + 
Sbjct: 68  MRADEMALALERHATSKLPESLIGEESALERVITLGFRGEALPSIASVARLTIESRSRET 127

Query: 116 NTGAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRM 175
               +  +    +    P A+ PGT V V DLF  +PAR  FL+S + E     DV+RR+
Sbjct: 128 GEAWKRVVDHGDLVGDGPAALPPGTRVRVEDLFGRVPARRKFLRSARSEWAAALDVVRRL 187

Query: 176 AIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQG 235
           A+A P + FT       R  +  Q        R++Q++  D I+N+V ++    +  L G
Sbjct: 188 AMARPDIGFTLE--HDGRRALQVQPGE-RLDMRVAQLVSRDLISNSVAVDLVRGDYHLIG 244

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
             G+PT+NRG A+  Y+F+NGR V+D+ +L  +R AYA+ +   R+ V+ L L +   +V
Sbjct: 245 VAGLPTYNRGVADHQYLFVNGRPVRDRLLLGAVRGAYADMLARDRHAVLALFLTLPAEEV 304

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD--NAPKT 353
           DVNVHPAK+ +RFR+  ++R  I+  +++A+++    ++       + ++  +   AP+ 
Sbjct: 305 DVNVHPAKTEVRFRDSALVRGMIVSGLRQALSEGDRRSAQAPDATAMQAWQVEPVAAPE- 363

Query: 354 HLPKYATSLTNTQEKLFLQ--------ENRLS---------TNDLLPSDDPTYSEDNDPV 396
             P + + +   Q  LF +          RL            +++   +        PV
Sbjct: 364 --PVF-SPVPPVQSNLFARPASRPAYVPQRLGEAGVAWRGYEAEVMALPEARAEPATAPV 420

Query: 397 EESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMR-QDFNSTKITSQ 455
            E EA  + LG+A  QI + YI+++  DGLVIVDQHAAHERL+ E++R          +Q
Sbjct: 421 PEGEA--HPLGVARGQIGKTYIVAEAADGLVIVDQHAAHERLVLERLRAAGAGEGDAPAQ 478

Query: 456 TLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRD 515
            LL PE+++L E +C  + E   +L R G+  ERFGP A+ IR +PA+L K +   L+RD
Sbjct: 479 ALLLPEVVELDEVDCDRLEEAAHELARFGLILERFGPGAVLIRSVPAMLGKGDPQALVRD 538

Query: 516 IIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNH 575
           + D++  +  T  + +R++ +LATMAC+GS+R+GR +   EMN LLREME+ P S QCNH
Sbjct: 539 VADDLARNGATLLVGERLDLVLATMACHGSVRAGRVLSVPEMNALLREMEETPRSGQCNH 598

Query: 576 GRPTFIKLKLSDIEKLFGR 594
           GRPT++KL   DIEKLFGR
Sbjct: 599 GRPTWVKLAHGDIEKLFGR 617


>gi|332185051|ref|ZP_08386800.1| DNA mismatch repair MutL family protein [Sphingomonas sp. S17]
 gi|332014775|gb|EGI56831.1| DNA mismatch repair MutL family protein [Sphingomonas sp. S17]
          Length = 583

 Score =  454 bits (1169), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 220/587 (37%), Positives = 357/587 (60%), Gaps = 16/587 (2%)

Query: 19  IIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTSEEIPMAVQRHCTS 78
           ++ERP+ A+KEL+ENS+DA ++R+  V+  GG    ++ D+G GM+++++ +A++RHCTS
Sbjct: 1   MVERPASALKELVENSIDAGATRIAIVLVQGGIGRIEVADDGCGMSADDMALALERHCTS 60

Query: 79  KISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAISGEKISSVRPVAMN 137
           K+ D+    + T GFRGEALPSI +V+ +T+ SRP  ++  +++  +GE +    P A+ 
Sbjct: 61  KLPDEAIEAVLTLGFRGEALPSIASVARVTIESRPAGSDGWSRVVDNGEVLRD-GPAAVP 119

Query: 138 PGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVSFTFSTIKSNRYKMN 197
           PGT + V DLF  +PAR  FL+S + E     D++RR+A+A P ++FT       R  + 
Sbjct: 120 PGTRIVVEDLFARVPARRKFLRSPRSEYAACLDMVRRLAMARPDIAFTLE--HDGRRVLT 177

Query: 198 FQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNRGNANQFYVFINGR 257
                   P R++ +       N+V ++   + ++L G  G+PTFNRG A+  Y+F+NGR
Sbjct: 178 VPGGE-ERPGRVAGLTDRALAENSVAIDWVRDMVSLGGVAGLPTFNRGIADHQYLFVNGR 236

Query: 258 TVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSYIRFRNPTIIRNF 317
            V+D+ ++  IR AYAE +P  R+ VV L L++ P +VDVNVHPAK+ +RFR+P +IR  
Sbjct: 237 PVRDRLLMGAIRGAYAEMLPRDRHAVVALFLDMPPSEVDVNVHPAKTEVRFRDPALIRGM 296

Query: 318 IIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKL--FLQENR 375
           I+  +++A+++ G  +        ++ +  +   +      A +    ++       E R
Sbjct: 297 IVSGLRRALDEAGHRSVQRPPDSALAMWQTEAVGEAGAFPPAPAAPLPRDGWGPAAPETR 356

Query: 376 LSTNDLLPSDDPTYSEDNDPVEESEATH--------YQLGIACAQIHQNYIISQTTDGLV 427
           +     L +  P +     P+  +EA H        + +G+A  Q+ + YI+++  DGLV
Sbjct: 357 VMERQSLFAPRPGFMAPP-PLARAEAAHAPPPEVRQFPMGVARGQVAKTYIVAEAEDGLV 415

Query: 428 IVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKA 487
           +VDQHAAHERL+ E+MR      ++ SQ +L PE+++L E  C  +    E+L   G+  
Sbjct: 416 LVDQHAAHERLVLERMRAALTGGRVASQAMLIPEVVELDEPACDRLEARAEELAEFGLDL 475

Query: 488 ERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIR 547
           ERFGP A+ +R  PA+L + +   L+ D+ DE+       +L++R++++ ATMAC+GS+R
Sbjct: 476 ERFGPTAMLVRSTPALLGQSDPKGLVSDLADELAAFDQALSLRERLDHVAATMACHGSVR 535

Query: 548 SGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +GR +   EMN LLREME  P+S QCNHGRPT++KL+  DIEKLFGR
Sbjct: 536 AGRILSVAEMNALLREMEVTPHSGQCNHGRPTWVKLQHGDIEKLFGR 582


>gi|149184476|ref|ZP_01862794.1| DNA mismatch repair enzyme [Erythrobacter sp. SD-21]
 gi|148831796|gb|EDL50229.1| DNA mismatch repair enzyme [Erythrobacter sp. SD-21]
          Length = 600

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 224/600 (37%), Positives = 359/600 (59%), Gaps = 10/600 (1%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR+L + ++N+IAAGE++ERPS A+KEL+EN++DA +SR+   +  GG +  ++TD+G 
Sbjct: 3   EIRRLPDTLVNRIAAGEVVERPSSALKELVENAIDAGASRIAVKLVEGGLTSLEVTDDGC 62

Query: 62  GMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           GM  +E+ +A++RH TSK+ D+    + T GFRGEALPSI +V+  TL SRP     G +
Sbjct: 63  GMNPDEMALALERHATSKLPDEAIEQVATLGFRGEALPSIASVARFTLESRPRGAEQGWK 122

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
             +   ++ +  P A+ PGT V V +LF  IPAR  FL++ + E     DV++R+A+A P
Sbjct: 123 RVVDHGELVAEGPAALPPGTRVRVENLFAKIPARRKFLRTPRSEYAACLDVVKRLAMARP 182

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V+ T      +R  +  Q   G    R++QV+  +   N V ++     + L G  G+P
Sbjct: 183 DVAITLD--HGDRRILGLQGGEG-LANRVAQVVARELKENGVAIDLDRGTMRLTGIAGLP 239

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           T+NRG A+  Y+F+NGR V+D+ +   +R AY++ +   R+ V+ L L + P  VDVNVH
Sbjct: 240 TYNRGIADHQYLFVNGRPVKDRLLTGAVRGAYSDMLARDRHAVLALFLVLPPEMVDVNVH 299

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAI---NKKGIST--SSVLSKKMISSFHQDNAPKTHL 355
           PAK+ +RFR+   +R FI+  ++ A+   +K+   T  +S +S+       ++ AP    
Sbjct: 300 PAKTEVRFRDSQAVRGFIVSGLRNALATGDKRSAQTPDASAMSRWQQEPVREEPAPALRS 359

Query: 356 PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQ 415
                  +  Q ++          +     +P    +      +    Y LG+A  Q+  
Sbjct: 360 IFEGRDWSTPQTRVSEAGAAWRGYEAEVMAEPRGRAEEAAPAPAAEQDYPLGVARGQVAN 419

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKIT-SQTLLTPEIIDLLEGECALIM 474
            YI+++  DGLV+VDQHAAHERL+ E+++       +  SQ LL PE+++L E  C  + 
Sbjct: 420 TYIVAEAKDGLVLVDQHAAHERLVLERLKAAGAEEAVARSQALLIPEVVELEETSCDRLE 479

Query: 475 EHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIE 534
           E  + L + G+  ERFGP+A+ +R +P  +++ +  +LLRDI D++  +     L ++++
Sbjct: 480 EAADTLAKHGLAIERFGPSAMLVRSLPHAIARTDPEKLLRDIDDDLALNGEALHLGEKLD 539

Query: 535 NILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            +LATMAC+GS+R+GR ++  EMN LLREME+ P S QCNHGRPT++KL + D+EKLFGR
Sbjct: 540 LVLATMACHGSVRAGRTLRVDEMNALLREMERTPRSGQCNHGRPTWVKLSMEDVEKLFGR 599


>gi|51474047|ref|YP_067804.1| DNA mismatch repair protein [Rickettsia typhi str. Wilmington]
 gi|81826273|sp|Q68VN4|MUTL_RICTY RecName: Full=DNA mismatch repair protein mutL
 gi|51460359|gb|AAU04322.1| DNA mismatch repair protein MutL [Rickettsia typhi str. Wilmington]
          Length = 600

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 237/612 (38%), Positives = 373/612 (60%), Gaps = 34/612 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LSE  IN+IAAGE+IERP+  +KEL+EN++D  S++++ ++   GK+   ++D+G
Sbjct: 1   MTIKFLSESTINRIAAGEVIERPASVVKELVENAVDGGSTKIDIILERAGKNLIIVSDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +E+ +AV+RH TSK+++ DF NIHTFGFRGEALPSI A+S + + S+  + +   
Sbjct: 61  IGMTDKELEIAVERHTTSKLNESDFLNIHTFGFRGEALPSIAAISKMLITSKKREADKAF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G     +     N GT +E+RDLFF  PARL FLKS++ E     D+++++A+A+
Sbjct: 121 QIKLIGGNKQQITVSVHNEGTKIEIRDLFFATPARLKFLKSDRTELAASLDIVKKIALAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTN--GNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           PK+SF       N  K+  Q+ +   N  +RI  VIG+ FI NA  +N K+ + ++ GYT
Sbjct: 181 PKISFNLIHNSKNLLKLKGQNKDFETNLKQRIIDVIGDVFIKNASYINFKTPDFSICGYT 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
            IPT++R ++   ++FIN R ++DK +   +R AY + +   RY +  + L+IDP+ VDV
Sbjct: 241 SIPTYSRASSEDQFLFINNRPIKDKLLQVALRVAYQDYLARDRYALCAIFLQIDPQLVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD--------- 348
           NVHPAK+ +RF +P  +RN +I++I+ A+  K  S  +V +   I  F            
Sbjct: 301 NVHPAKAEVRFHDPNYVRNILIEAIKNALTNK--SQVTVTTTDAIELFKNPLVNKQPPIN 358

Query: 349 -----NAPKTHLPKYATSLTNTQEKLFLQENRL--STNDLLPSDDPTYSEDNDPVEESEA 401
                N+  +    +  +     +KL LQ +++       +  D+ +Y +          
Sbjct: 359 KAINVNSKASEYISFNFNRNTVCQKLTLQSDKIEQEVGKCIEHDNQSYKQ---------- 408

Query: 402 THYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPE 461
             Y+ GIA AQ+H  YIISQT D +VI+DQHA +ERL +EK++    + ++  Q LL PE
Sbjct: 409 --YKFGIAKAQLHTTYIISQTEDSIVIIDQHAVYERLGYEKIKYCLKNGELVKQRLLIPE 466

Query: 462 IIDLLEGECA-LIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEI 520
           I++L  GE A  + E+ + L +L +  E+FG  +I + E+P +L   N+ +L++D+ D +
Sbjct: 467 IVELSSGEKADYLYENRDKLFKLSLTIEKFGEKSIIVTEVPNLLRDVNVQKLIQDLADHL 526

Query: 521 IDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTF 580
            D S    L++ IE+++    C+ SIR+ RK+   EMN LLR+ME    S+QCNH RPT+
Sbjct: 527 SDFSKNIALKELIEHVIKIYICHYSIRAVRKLSVDEMNSLLRQMENMSFSAQCNHNRPTY 586

Query: 581 IKLKLSDIEKLF 592
           I+LKL DIE+LF
Sbjct: 587 IELKLKDIERLF 598


>gi|94496337|ref|ZP_01302914.1| DNA mismatch repair protein MutL [Sphingomonas sp. SKA58]
 gi|94424083|gb|EAT09107.1| DNA mismatch repair protein MutL [Sphingomonas sp. SKA58]
          Length = 594

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 227/601 (37%), Positives = 355/601 (59%), Gaps = 15/601 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E ++N+IAAGE++ERP+ A+KE++EN+LDA + R+   ++ GG    ++ D+G
Sbjct: 1   MSIRRLPEHLVNRIAAGEVVERPASALKEIVENALDAGAHRIAVRLSNGGLDRIEVIDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM S E+ +A++RH TSK+ DD   N+ T GFRGEALPSI +V+ L++ SRP +   G 
Sbjct: 61  CGMDSGEMALALERHATSKLPDDAIENVATLGFRGEALPSIASVARLSIDSRP-RGADGW 119

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
              +   ++ +  P A+ PGT + V  LF  +PAR  FL+S + E     + IRR+A+A+
Sbjct: 120 NRTVDNGQLVAEGPAALPPGTRITVEQLFAKVPARRKFLRSPKAEYAACLNCIRRLAMAH 179

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V+F+       R  +  Q       ER++ +      +N V ++ +   I L G   +
Sbjct: 180 PAVAFSVE--HDGRRVLGVQEGEAR-EERVAALTDRQLADNHVIVSLEREGIRLSGVASL 236

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT NRG  +  Y+F+NGR V+D+ ++  +R AYA+ +   R+PVV L L++   +VDVNV
Sbjct: 237 PTCNRGVGDHQYLFVNGRPVKDRLLIGALRGAYADMLARDRHPVVALFLDVPAHEVDVNV 296

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA---PKTHLP 356
           HPAK+ +RFR+P +IR  I+  +++A++ +G           +S++  +     P   +P
Sbjct: 297 HPAKTEVRFRDPALIRGMIVSGLRRALDAEGFRAVQHADPAGLSAWRPEPVSPTPIGAMP 356

Query: 357 KYATSLTNTQEKLFLQ---ENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQI 413
            +  +          Q   + R S     P      +    P   S    + LG+A  Q+
Sbjct: 357 IFEAAGQPVSYNPSFQTVADRRASFQAPPPQARAEPAAAPAPEGAS----FPLGVARGQV 412

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
            + YI+++  DGLVIVDQHAAHERL  E+MR+      + SQ LL PE+++L E  C  +
Sbjct: 413 ARTYIVAEAEDGLVIVDQHAAHERLTLERMRRAMEGQGVASQALLLPEVVELDEPACDRL 472

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRI 533
                +L   G++ ERFGP+A+ +R  PA+L + ++  L+ D+ D++    +  +L++R+
Sbjct: 473 EARAGELREFGLELERFGPSAMLVRAAPAMLGQSDVQGLVTDLADDLAAYDSALSLKERL 532

Query: 534 ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFG 593
           + + ATMAC+GS+R+GR +   EMN LLREME  P S QCNHGRPT++KL   DIEKLFG
Sbjct: 533 DLVAATMACHGSVRAGRVLSVAEMNALLREMEVTPRSGQCNHGRPTWVKLGHGDIEKLFG 592

Query: 594 R 594
           R
Sbjct: 593 R 593


>gi|103487111|ref|YP_616672.1| DNA mismatch repair protein [Sphingopyxis alaskensis RB2256]
 gi|123078316|sp|Q1GSN3|MUTL_SPHAL RecName: Full=DNA mismatch repair protein mutL
 gi|98977188|gb|ABF53339.1| DNA mismatch repair protein MutL [Sphingopyxis alaskensis RB2256]
          Length = 603

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 233/610 (38%), Positives = 360/610 (59%), Gaps = 24/610 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E ++N+IAAGE++ERP+ A+KEL+EN++DA ++R+   IA GG +  ++ D+G
Sbjct: 1   MSIRRLPETLVNRIAAGEVVERPAAALKELVENAIDAGATRIAVRIAEGGIARLEVEDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT+ ++ +A++RH TSK+ DD    + T GFRGEALPSI +V+ LTL SR    +   
Sbjct: 61  CGMTAADMVLALERHATSKLPDDAIEAVTTLGFRGEALPSIASVARLTLESRTAGGDGWR 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           ++  +G  ++   P A+  GT V V  LF  +PAR  FL+S + E     DV+RR+A+A 
Sbjct: 121 RVVDNGAVVAE-GPAALGQGTRVIVEHLFARVPARRKFLRSARSEYAACLDVVRRLAMAR 179

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V FT       R  ++ Q        R++ +   D   N++ ++    E+ L G   +
Sbjct: 180 PDVGFTLE--HDGRRVLDVQGGQDRV-GRVAALTSRDLAANSIGVDLDRGEVHLGGVISL 236

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT+NRG A+  Y+F+NGR V+D+ ++  +R AYA+ +   R+PVV L L++   +VDVNV
Sbjct: 237 PTYNRGIADHQYLFVNGRPVKDRLLVGALRGAYADLLARDRHPVVALFLDVPTGEVDVNV 296

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HPAK+ +RFR+P +IR  I+  +++A+++ G  +    ++  ++++ Q+       P  A
Sbjct: 297 HPAKTEVRFRDPQLIRGMIVGGLRRALDEHGFRSVQKPAEAALAAWQQEPVA----PPPA 352

Query: 360 TSL-----TNTQEKLFLQENRLSTND-------LLPSDDP---TYSEDNDPVEESEATHY 404
           T              F  E  L   D       L+P   P       +        A  +
Sbjct: 353 TGFLFDRRAGAAVHPFAAEVSLPAADVARVYDRLMPFTAPAPLAGRAEVAATPPPAAEAH 412

Query: 405 QLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIID 464
            LGIA  QI + YI+++  DGLVIVDQHAAHERL+ E +++      + SQ LL PE+++
Sbjct: 413 PLGIARGQIAKTYIVAEAEDGLVIVDQHAAHERLVLETLKRGMAGQAVPSQGLLIPEVVE 472

Query: 465 LLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSS 524
           L E  C  +    + L  LG++ ERFGP A+ +R  PA+L   +  +L+ DI D++    
Sbjct: 473 LDEPACDRLEAAADGLAALGVELERFGPGAVMVRATPAMLGAIDCHRLVTDIADDLAGYD 532

Query: 525 TTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLK 584
               L +R+E + ATMAC+GS+R+GR +   EMN LLR+ME  P+S QCNHGRPT++KL 
Sbjct: 533 AALGLNERLELVAATMACHGSVRAGRTLSVAEMNALLRQMEVTPHSGQCNHGRPTWVKLA 592

Query: 585 LSDIEKLFGR 594
           + D+E+LFGR
Sbjct: 593 MGDVERLFGR 602


>gi|15604708|ref|NP_221226.1| DNA mismatch repair protein [Rickettsia prowazekii str. Madrid E]
 gi|6225738|sp|Q9ZC88|MUTL_RICPR RecName: Full=DNA mismatch repair protein mutL
 gi|3861403|emb|CAA15302.1| DNA MISMATCH REPAIR PROTEIN MUTL (mutL) [Rickettsia prowazekii]
          Length = 595

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 233/598 (38%), Positives = 370/598 (61%), Gaps = 11/598 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LSE  IN+IAAGE+IERP+  +KEL+EN++D  S++++ ++   GK+   ++D+G
Sbjct: 1   MTIKFLSESTINRIAAGEVIERPASVVKELVENAIDGGSTKIDIILERAGKNLIIVSDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +E+ +AV+RH TSK+++ DF NIHTFGFRGEAL SI A+S + + S+  + +   
Sbjct: 61  IGMTDKELEIAVKRHTTSKLNESDFFNIHTFGFRGEALASIAAISKMLITSKKREADKAF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G     +     N GT +EVRDLFF  PARL FL+S++ E     D+++++A+A+
Sbjct: 121 QIKLIGGNKQQITVSVHNEGTKIEVRDLFFATPARLKFLRSDKTELAASIDIVKKIALAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P++SF       N  K+  Q+ +   N  +RI  VIG+ FI NA  ++ K+ + ++ GYT
Sbjct: 181 PRISFNLIHDNKNLLKLKGQNKDSETNLKQRIIDVIGDVFIKNAAYIDFKTPDFSICGYT 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
            IPT+N+ ++   ++FIN R ++DK +   +R AY + +   RY + V+ L+IDP+ VDV
Sbjct: 241 SIPTYNKASSEDQFLFINNRPIKDKLLQVALRVAYQDYLARDRYALCVIFLQIDPQLVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPK 357
           NVHPAK+ +RF +P  +RN +I++I+ A+  K   T++ +     S  +++  P  H   
Sbjct: 301 NVHPAKAEVRFHDPNYVRNILIEAIKNALTNKSQITATTIGSDKNSLVNKE--PTIHKAT 358

Query: 358 YATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATH--YQLGIACAQIHQ 415
              S  +       + N  +    LP       E    +E +  +H  Y+ G+A AQ+H 
Sbjct: 359 NVNSKASEYTSFNFKRN--TAYHTLPY-GKIEQEVGKCIEHNNQSHKQYKFGVAKAQLHT 415

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECA-LIM 474
            YIISQT D +VI+DQHAA+ERL + K++    + ++  Q LL PEI++L   + A  + 
Sbjct: 416 TYIISQTEDSIVIIDQHAAYERLGYAKIKYCLKNGELVKQRLLIPEIVELSSQKKADCLY 475

Query: 475 EHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIE 534
           E+ E L +L +  E+FG  +I + EIP IL   N+ +L++D+ D + D +    L++ IE
Sbjct: 476 ENREKLFKLSLTIEKFGEKSIIVTEIPNILGDVNVQKLIQDLADHLSDFAKNMPLKELIE 535

Query: 535 NILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLF 592
           +++    C+ SIR+ RK+ + EMN LLR+ME    S+QCN+ RPT+I+LKL DIE LF
Sbjct: 536 HVIKIYICHYSIRAARKLSADEMNSLLRQMENMSFSAQCNNNRPTYIELKLKDIELLF 593


>gi|258541836|ref|YP_003187269.1| DNA mismatch repair protein MutL [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632914|dbj|BAH98889.1| DNA mismatch repair protein MutL [Acetobacter pasteurianus IFO
           3283-01]
 gi|256635971|dbj|BAI01940.1| DNA mismatch repair protein MutL [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639026|dbj|BAI04988.1| DNA mismatch repair protein MutL [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642080|dbj|BAI08035.1| DNA mismatch repair protein MutL [Acetobacter pasteurianus IFO
           3283-22]
 gi|256645135|dbj|BAI11083.1| DNA mismatch repair protein MutL [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648190|dbj|BAI14131.1| DNA mismatch repair protein MutL [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651243|dbj|BAI17177.1| DNA mismatch repair protein MutL [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654234|dbj|BAI20161.1| DNA mismatch repair protein MutL [Acetobacter pasteurianus IFO
           3283-12]
          Length = 643

 Score =  445 bits (1144), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 238/633 (37%), Positives = 364/633 (57%), Gaps = 52/633 (8%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           +R+L E I+N+IAAGE+IERP+ A+KEL+EN++DA + R+E  +AGGG     +TD+G G
Sbjct: 21  VRRLPEVIVNRIAAGEVIERPAAAVKELVENAIDAGARRLEVSLAGGGVDRIIVTDDGVG 80

Query: 63  MTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M+++++ +AV RHCTSK+ D+   +I T GFRGEALPSIGA + L + SRP   +   +I
Sbjct: 81  MSADDLALAVDRHCTSKLRDETLVHISTLGFRGEALPSIGAAARLCITSRPRGESGAWRI 140

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            + G K+S V P A  PGT V V DLFF  PAR  FLKS +VE     +V+RR+A+A P+
Sbjct: 141 RVEGGKVSPVEPAAGAPGTSVVVEDLFFATPARRKFLKSARVEGRHAENVVRRLALAVPQ 200

Query: 182 VSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPT 241
            +F F   +   + +  Q    +   R + ++     +  +E++ + + +TL G+   P+
Sbjct: 201 TAFRFMLDERVLFDLPAQ----DMATRSAALLDASEADGFLEISGERDGMTLSGFICPPS 256

Query: 242 FNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHP 301
            +R  AN  ++ +NGR V D  + + +R AY   I  GR+PVV L+L + P +VDVNVHP
Sbjct: 257 VHRSTANGQFMLVNGRPVVDPVLKTAVRVAYRRVIEPGRHPVVALMLTVPPDRVDVNVHP 316

Query: 302 AKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISS-------FHQDNAPKTH 354
           AK+ +RF +   +R+ +I +IQ+A+        SV  + ++SS       ++        
Sbjct: 317 AKTELRFADEASVRSLVIGTIQRALEH---GAGSVGVRPVLSSAPRQARIWYPPEKGAAP 373

Query: 355 LPKYATSLTNTQEKLFLQENRLSTND----------LLPS-----------------DDP 387
                     T E +   E RL   D           +PS                  +P
Sbjct: 374 PVPAPAFHAPTPEGVRFAEGRLQFGDAPAARTLPPVAMPSLHARWDAPAVGTPATGQAEP 433

Query: 388 TYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDG-LVIVDQHAAHERLIFEKMRQD 446
            Y+    PV    A  + LG A AQ+   YI++   DG LV+VDQHAAHERL  E++R  
Sbjct: 434 AYTASAQPV----AADHPLGAAIAQVLDTYILAVAADGSLVLVDQHAAHERLTHERLRAQ 489

Query: 447 FNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSK 506
           F S  + +Q LL P+++DL   +  L++     L +LG++ E FG +++ +R +PA+L  
Sbjct: 490 FLSGHVQAQRLLVPDVVDLPRVQVDLLLARQPTLEKLGVEIEAFGGDSVLVRALPAMLRS 549

Query: 507 KNIPQLLRDIIDEI-IDSSTT----YTLQDRIENILATMACYGSIRSGRKMQSIEMNRLL 561
            +   LLRD+ DE+  D +        L  R++ ++A MAC+GSIR+GR++   EMN LL
Sbjct: 550 SDAVSLLRDLADELEADENGAPDEMAALDGRLDAVIARMACHGSIRAGRRLSVEEMNALL 609

Query: 562 REMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           R+ME+ P +  C+HGRPT++KL  +D+EKLFGR
Sbjct: 610 RQMEETPRAGTCSHGRPTWLKLSKADLEKLFGR 642


>gi|283856238|ref|YP_162089.2| DNA mismatch repair protein [Zymomonas mobilis subsp. mobilis ZM4]
 gi|283775233|gb|AAV88978.2| DNA mismatch repair protein MutL [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 613

 Score =  444 bits (1143), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 219/615 (35%), Positives = 369/615 (60%), Gaps = 24/615 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +IN+IAAGE++ERP+ A+KEL+EN++DA+S+R+   +  GG    ++ DNG
Sbjct: 1   MSIRRLPEDVINRIAAGEVVERPASALKELVENAIDAQSTRILIRLLKGGLDGIEVIDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD--FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+ ++E+ +A++RH TSK+ D+     + T GFRGEALPSI +V+ LTL SR   +++G
Sbjct: 61  IGIPADEMRLALERHATSKLPDNDAIEAVTTLGFRGEALPSIASVARLTLESRTADSDSG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +I +            +  GT ++V  LF  IPAR  F++S + E     DV+RR+A+ 
Sbjct: 121 WKIIVDNGHFEKEGIAPLPKGTRIKVDSLFARIPARRKFMRSAKSEYMACHDVVRRLAMT 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P ++F+        + +N   +      R++ +I     +N+V +  + +++ L+G   
Sbjct: 181 RPDIAFSLEHDGRRIFSLNGGESR---QRRVAALIDRTLKDNSVAVEYQRDQMQLEGVAS 237

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+RG A+  Y+F+NGR V+D+ ++ ++R AY + +   R+PV+ L L +    VD+N
Sbjct: 238 LPTFHRGLADHQYLFVNGRPVKDRLLIGSVRAAYHDLLAKDRHPVLALFLTLPNSDVDIN 297

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDN---APKTHL 355
           VHPAK  +RFR+   +R+ I+ +++++++  G  ++     + +  + + +   AP   +
Sbjct: 298 VHPAKGEVRFRDSQAVRSLIVGALRESLDLSGFRSAQPADVQAMGKWQKSSELAAPSKAV 357

Query: 356 PKYATSLTNTQEKLFLQENRLSTNDL--LPSDDPTYSE--------------DNDPVEES 399
           P + +  + +   L  +   +       +P+   T S+               N   + S
Sbjct: 358 PSHESRQSLSDSGLLFKSRTIEAPKATSIPTPQGTASDLWSAATKSPLPPMGRNSATDSS 417

Query: 400 EATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLT 459
           E + + LG+A  QI   YII+++ DGLVIVDQHAAHERL+ E+MR+   + ++TSQ LL 
Sbjct: 418 EQSDFPLGLARGQIAATYIIAESKDGLVIVDQHAAHERLVMERMRRALQNGQVTSQRLLM 477

Query: 460 PEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDE 519
           P+++++ E  C L  +  ++   +G++ ERFG  AI +R  PA+L    +  +++D+  E
Sbjct: 478 PDVVEMDEVSCDLFEQRQDEFAAMGLETERFGHEAILVRATPAMLGNCEVKAMIKDLAAE 537

Query: 520 IIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPT 579
           I     +  L+++ ++I+ATMAC+GS+R+GR +   EMN LLREME  P+S QCNHGRPT
Sbjct: 538 IAAYDQSLLLKEKFDHIVATMACHGSVRAGRLLSIAEMNALLREMEITPHSGQCNHGRPT 597

Query: 580 FIKLKLSDIEKLFGR 594
           ++KL   DIEKLFGR
Sbjct: 598 WVKLGHKDIEKLFGR 612


>gi|292572544|gb|ADE30459.1| DNA mismatch repair protein MutL [Rickettsia prowazekii Rp22]
          Length = 595

 Score =  444 bits (1142), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 232/598 (38%), Positives = 370/598 (61%), Gaps = 11/598 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LSE  IN+IAAGE+IERP+  +KEL+EN++D  S++++ ++   GK+   ++D+G
Sbjct: 1   MTIKFLSESTINRIAAGEVIERPASVVKELVENAIDGGSTKIDIILERAGKNLIIVSDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +E+ +AV+RH TSK+++ DF NIHTFGFRGEAL SI A+S + + S+  + +   
Sbjct: 61  IGMTDKELEIAVKRHTTSKLNESDFFNIHTFGFRGEALASIAAISKMLITSKKREADKAF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G     +     N GT +EVRDLFF  PARL FL+S++ E     D+++++A+A+
Sbjct: 121 QIKLIGGNKQQITVSVHNEGTKIEVRDLFFATPARLKFLRSDKTELAASIDIVKKIALAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P++SF       N  K+  Q+ +   N  +RI  VIG+ FI NA  ++ K+ + ++ GY+
Sbjct: 181 PRISFNLIHDNKNLLKLKGQNKDSETNLKQRIIDVIGDVFIKNAAYIDFKTPDFSICGYS 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
            IPT+N+ ++   ++FIN R ++DK +   +R AY + +   RY + V+ L+IDP+ VDV
Sbjct: 241 SIPTYNKASSEDQFLFINNRPIKDKLLQVALRVAYQDYLARDRYALCVIFLQIDPQLVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPK 357
           NVHPAK+ +RF +P  +RN +I++I+ A+  K   T++ +     S  +++  P  H   
Sbjct: 301 NVHPAKAEVRFHDPNYVRNILIEAIKNALTNKSQITATTIGSDKNSLVNKE--PTIHKAT 358

Query: 358 YATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATH--YQLGIACAQIHQ 415
              S  +       + N  +    LP       E    +E +  +H  Y+ G+A AQ+H 
Sbjct: 359 NVNSKASEYTSFNFKRN--TAYHTLPY-GKIEQEVGKCIEHNNQSHKQYKFGVAKAQLHT 415

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECA-LIM 474
            YIISQT D +VI+DQHAA+ERL + K++    + ++  Q LL PEI++L   + A  + 
Sbjct: 416 TYIISQTEDSIVIIDQHAAYERLGYAKIKYCLKNGELVKQRLLIPEIVELSSQKKADCLY 475

Query: 475 EHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIE 534
           E+ E L +L +  E+FG  +I + EIP IL   N+ +L++D+ D + D +    L++ IE
Sbjct: 476 ENREKLFKLSLTIEKFGEKSIIVTEIPNILGDVNVQKLIQDLADHLSDFAKNMPLKELIE 535

Query: 535 NILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLF 592
           +++    C+ SIR+ RK+ + EMN LLR+ME    S+QCN+ RPT+I+LKL DIE LF
Sbjct: 536 HVIKIYICHYSIRAARKLSADEMNSLLRQMENMSFSAQCNNNRPTYIELKLKDIELLF 593


>gi|260753121|ref|YP_003226014.1| DNA mismatch repair protein [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|258552484|gb|ACV75430.1| DNA mismatch repair protein MutL [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 613

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 218/615 (35%), Positives = 370/615 (60%), Gaps = 24/615 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +IN+IAAGE++ERP+ A+KEL+EN++DA+S+R+   +  GG    ++ DNG
Sbjct: 1   MSIRRLPEDVINRIAAGEVVERPASALKELVENAIDAQSTRILIRLLKGGLDGIEVIDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD--FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+ ++E+ +A++RH TSK+ D+     + T GFRGEALPSI +V+ LTL SR   +++G
Sbjct: 61  IGIPADEMRLALERHATSKLPDNDAIEAVTTLGFRGEALPSIASVARLTLESRTADSDSG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +I +            +  GT ++V  LF  IPAR  F++S + E     D++RR+A+ 
Sbjct: 121 WKIIVDNGHFEKEGIAPLPKGTRIKVDSLFARIPARRKFMRSAKSEYMACHDIVRRLAMT 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P ++F+        + +N   +      R++ +I     +N+V +  + +++ L+G   
Sbjct: 181 RPDIAFSLEHDGRRIFSLNGGESR---QRRVAALIDRTLKDNSVAVEYQRDQMQLEGVAS 237

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+RG A+  Y+F+NGR V+D+ ++ ++R AY + +   R+PV+ L L +    VD+N
Sbjct: 238 LPTFHRGLADHQYLFVNGRPVKDRLLIGSVRAAYHDLLAKDRHPVLALFLTLPNSDVDIN 297

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDN---APKTHL 355
           VHPAK  +RFR+   +R+ I+ +++++++  G  ++     + +  + + +   AP   +
Sbjct: 298 VHPAKGEVRFRDSQAVRSLIVGALRESLDLSGFKSAQPADVQAMGKWQKSSELAAPSKAV 357

Query: 356 PKYATSLTNTQEKLFLQENRLST--NDLLPSDDPTYSE--------------DNDPVEES 399
           P + +  + +   L  +   +    +  +P+   T S+               N   + S
Sbjct: 358 PSHESRQSLSDSGLLFKSRTIEAPKSTSIPTPQGTASDLWSAATKSPLPPMGRNSATDSS 417

Query: 400 EATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLT 459
           E + + LG+A  QI   YII+++ DGLVIVDQHAAHERL+ E+MR+   + ++TSQ LL 
Sbjct: 418 EQSDFPLGLARGQIAATYIIAESKDGLVIVDQHAAHERLVMERMRRALQNGQVTSQRLLM 477

Query: 460 PEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDE 519
           P+++++ E  C L  +  ++   +G++ ERFG  AI +R  PA+L    +  +++D+  E
Sbjct: 478 PDVVEMDEVSCDLFEQRQDEFAAMGLETERFGHEAILVRATPAMLGNCEVKAMIKDLAAE 537

Query: 520 IIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPT 579
           I     +  L+++ ++I+ATMAC+GS+R+GR +   EMN LLREME  P+S QCNHGRPT
Sbjct: 538 IAAYDQSLLLKEKFDHIVATMACHGSVRAGRLLSIAEMNALLREMEITPHSGQCNHGRPT 597

Query: 580 FIKLKLSDIEKLFGR 594
           ++KL   DIEKLFGR
Sbjct: 598 WVKLGHKDIEKLFGR 612


>gi|329114388|ref|ZP_08243150.1| DNA mismatch repair protein MutL [Acetobacter pomorum DM001]
 gi|326696464|gb|EGE48143.1| DNA mismatch repair protein MutL [Acetobacter pomorum DM001]
          Length = 646

 Score =  442 bits (1136), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 240/633 (37%), Positives = 368/633 (58%), Gaps = 49/633 (7%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           +R+L E I+N+IAAGE+IERP+ A+KEL+EN++DA + R+E  +AGGG     +TD+G G
Sbjct: 21  VRRLPEVIVNRIAAGEVIERPAAAVKELVENAIDAGARRLEVSLAGGGVDRIIVTDDGVG 80

Query: 63  MTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M+++++ +AV RHCTSK+ D+   +I T GFRGEALPSIGA + L + SRP   +   +I
Sbjct: 81  MSADDLALAVDRHCTSKLRDETLVHISTLGFRGEALPSIGAAARLCITSRPKGESGAWRI 140

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            + G K+S V P A  PGT V V DLFF  PAR  FLKS +VE     +V+RR+A+A P+
Sbjct: 141 RVEGGKVSPVEPAAGAPGTSVVVEDLFFATPARRKFLKSARVEGRHAENVVRRLALAVPQ 200

Query: 182 VSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPT 241
            +F F   +   + +  Q    +   R + ++     +  +E++ + + +TL G+   P+
Sbjct: 201 TAFRFVLDERVLFDLPAQ----DMAARSAALLDASEADGFLEISGERDGMTLSGFICPPS 256

Query: 242 FNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHP 301
            +R  AN  ++ +NGR V D  + + +R AY   I  GR+PVV ++L + P +VDVNVHP
Sbjct: 257 VHRSTANGQFMLVNGRPVVDPVLKTAVRVAYRRVIEPGRHPVVAIMLTVPPDRVDVNVHP 316

Query: 302 AKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYATS 361
           AK+ +RF +   +R+ +I +IQ+A+        SV  + ++SS  +  A   + P+   +
Sbjct: 317 AKTELRFADEAGVRSLVIGTIQRALEH---GAGSVGMRPVLSSAPR-QARIWYPPEKGAA 372

Query: 362 L--------TNTQEKLFLQENRLSTND----------LLPSDDPTY--SEDNDPVEESEA 401
                    T T E +   E RL   D           +PS    +  S  N P     A
Sbjct: 373 PPMPAPAFHTPTPEGVRFAEGRLQFGDAPAARTLPPVAMPSPSAGWDASAVNTPTTGQAA 432

Query: 402 THY--------------QLGIACAQIHQNYIISQTTDG-LVIVDQHAAHERLIFEKMRQD 446
           + Y               LG A AQ+   YI++   DG LV+VDQHAAHERL  E++R  
Sbjct: 433 SSYVMDGASGPSVAADHPLGAAIAQVLDTYILAVAADGSLVLVDQHAAHERLTHERLRAQ 492

Query: 447 FNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSK 506
           F S  + +Q LL P+++DL   +  L++     L +LG++ E FG +++ +R +PA+L  
Sbjct: 493 FLSGHVQAQRLLVPDVVDLPRVQVELLLARQPTLEKLGVEIEAFGGDSVLVRALPAMLRS 552

Query: 507 KNIPQLLRDIIDEI-IDSSTT----YTLQDRIENILATMACYGSIRSGRKMQSIEMNRLL 561
            +   LLRD+ DE+  D +        L  R++ ++A MAC+GSIR+GR++   EMN LL
Sbjct: 553 SDAVNLLRDLADELEADENGAPDEMAALDGRLDAVIARMACHGSIRAGRRLSVEEMNALL 612

Query: 562 REMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           R+ME+ P +  C+HGRPT++KL  +D+EKLFGR
Sbjct: 613 RQMEETPRAGTCSHGRPTWLKLSKADLEKLFGR 645


>gi|325916959|ref|ZP_08179201.1| DNA mismatch repair protein MutL [Xanthomonas vesicatoria ATCC
           35937]
 gi|325536810|gb|EGD08564.1| DNA mismatch repair protein MutL [Xanthomonas vesicatoria ATCC
           35937]
          Length = 623

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 233/625 (37%), Positives = 360/625 (57%), Gaps = 35/625 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    +I DNG
Sbjct: 1   MAIRQLPEILINQIAAGEVVERPASVVKELVENALDAGATRVDIDLEEGGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+   E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TL+SR      G
Sbjct: 61  GGIPPHELPLAVSRHATSKIASLDDLETVATLGFRGEALPSIASVSRFTLISRRHDAQHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           A + I G ++  V P A  PGT VEVR+LFF +PAR  FL++E+ E   I + +R +A+A
Sbjct: 121 AALQIEGGRLGEVTPHAHAPGTTVEVRELFFNVPARRKFLRAERTELGHIEEWLRSLALA 180

Query: 179 YPKVSFTFS--TIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
            P V    S     S RYK     ++     R+ + +GEDF   A+ ++     + L G+
Sbjct: 181 RPDVELRVSHNGKPSRRYKPGDLYSDA----RLGETLGEDFARQALRVDHSGAGLRLHGW 236

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
              P ++R + +Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VD
Sbjct: 237 VAQPHYSRASTDQQYLYVNGRSVRDRSVAHAVKMAYGDVLFHGRQPAYVLFLELDPARVD 296

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAI--NKKGISTSSVL--SKKMISSFHQDNAPK 352
           VNVHPAK  +RFR   +I +F+ +++Q A+   + G + +S+       +++    N P 
Sbjct: 297 VNVHPAKHEVRFREARLIHDFVYRTLQDALAQTRAGATPNSIGNDGAGYLAAGGMGNLPG 356

Query: 353 THLPKYA------------TSLTNTQEKLFLQ--ENRLSTNDL---LP------SDDPTY 389
             +  Y              + T +Q  L L+  E R + + L   LP      S  P +
Sbjct: 357 GAVTPYTGTPGNGGGSGSYANWTPSQSPLGLRVDEARAAYSALYAPLPGSVQQSSSLPQF 416

Query: 390 SEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
           S    PV   ++    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++   +S
Sbjct: 417 SGTGLPVTAEDSGVPPLGYAVAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKHAHDS 476

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             + +Q LL P  + + E E        E L  LG +  R GP ++ +R IPA+L+    
Sbjct: 477 IGLHAQPLLVPMTLAVGEREADTAEREAETLGTLGFEITRAGPQSLHVRSIPALLANAEP 536

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
             LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME    
Sbjct: 537 EALLRDVLGDLREHGQSRRIASARDELLSTMACHGAVRANRRLTVPEMNALLRDMEATER 596

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ +  LSDI++ F R
Sbjct: 597 SGQCNHGRPTWARFTLSDIDRWFLR 621


>gi|241760909|ref|ZP_04758998.1| DNA mismatch repair protein MutL [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|241374528|gb|EER63989.1| DNA mismatch repair protein MutL [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 613

 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 222/616 (36%), Positives = 366/616 (59%), Gaps = 26/616 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +IN+IAAGE++ERP+ A+KEL+EN++DA+S+R+   +  GG    ++ DNG
Sbjct: 1   MSIRRLPEDVINRIAAGEVVERPASALKELVENAIDAQSTRILIRLLKGGLDGIEVIDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD--FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+ ++E+ +A++RH TSK+ D+     + T GFRGEALPSI +V+ LTL SR   +++G
Sbjct: 61  IGIPADEMRLALERHATSKLPDNDAIEAVTTLGFRGEALPSIASVARLTLESRTADSDSG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +I +            +  GT ++V  LF  IPAR  F++S + E     DV+RR+A+ 
Sbjct: 121 WKIIVDNGHFEKEGIAPLPKGTRIKVDSLFARIPARRKFMRSAKSEYMACHDVVRRLAMT 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P ++F+        + +N   +      R++ +I     +N+V +  + +++ L+G   
Sbjct: 181 RPDIAFSLEHDGRRIFSLNGGESR---QRRVAALIDRTLKDNSVTVEYQRDQMQLEGVAS 237

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+RG A+  Y+F+NGR V+D+ ++ ++R AY + +   R+PV+ L L +    VD+N
Sbjct: 238 LPTFHRGLADHQYLFVNGRPVKDRLLIGSVRAAYHDLLAKDRHPVLALFLTLPNSDVDIN 297

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD-------NAP 351
           VHPAK  +RFR+   +R+ I+ +++++++  G  ++     + +  + +        N  
Sbjct: 298 VHPAKGEVRFRDSQAVRSLIVGALRESLDLSGFRSAQPADVQAMGKWRKSSDLPISTNPA 357

Query: 352 KTHLPKYATS---------LTNTQEKLFLQENRLSTNDLLP----SDDPTYSEDNDPVEE 398
             H  K A S          T   +    Q ++ + +DL      S  P     N   + 
Sbjct: 358 AIHEEKSALSDSGLLFKSRPTEAPKAPSAQAHQRTADDLWSAATKSPIPPMGR-NTSTDS 416

Query: 399 SEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLL 458
           SE + + LG+A  QI   YII+++ DGLVIVDQHAAHERL+ E+MR+   + ++ SQ LL
Sbjct: 417 SEQSDFPLGLARGQIAATYIIAESKDGLVIVDQHAAHERLVMERMRRALENGQVASQRLL 476

Query: 459 TPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIID 518
            P+++++ E  C L  +  ++   +G++ ERFG  AI +R  PA+L    +  +++D+  
Sbjct: 477 MPDVVEMDEVSCDLFEQRQDEFAAMGLETERFGHEAILVRATPAMLGNCEVKAMIKDLAA 536

Query: 519 EIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRP 578
           EI     +  L+++ ++I+ATMAC+GS+R+GR +   EMN LLREME  P+S QCNHGRP
Sbjct: 537 EITAYDQSLLLKEKFDHIVATMACHGSVRAGRLLSIAEMNALLREMEITPHSGQCNHGRP 596

Query: 579 TFIKLKLSDIEKLFGR 594
           T++KL   DIEKLFGR
Sbjct: 597 TWVKLGHKDIEKLFGR 612


>gi|87122647|ref|ZP_01078524.1| DNA mismatch repair protein [Marinomonas sp. MED121]
 gi|86162105|gb|EAQ63393.1| DNA mismatch repair protein [Marinomonas sp. MED121]
          Length = 637

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 231/633 (36%), Positives = 369/633 (58%), Gaps = 40/633 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  +KEL+ENSLDA +++++  +  GG    +I DNG 
Sbjct: 3   RINLLSPRLANQIAAGEVVERPASVVKELLENSLDAGATQLDVEVEQGGVRQIKIRDNGA 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+A+ RH TSKI   DD   + + GFRGEAL SI +VS L L S+        
Sbjct: 63  GIVKDDLPLALSRHATSKIHTLDDLEAVQSLGFRGEALASISSVSRLLLTSKAKGEQDAW 122

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           ++   G+ + + V+P +   GT +EVRDLFF  PAR  FL++++ E N +++V++R+A++
Sbjct: 123 RVEAEGKDMGANVKPASHPEGTCIEVRDLFFNTPARRKFLRTDKTEFNHLSEVVKRLALS 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F  S      Y +   +   +   R++ ++G+ F+ NA+ ++ ++  + L G+ G
Sbjct: 183 RYDVAFRLSHDGKQVYDLRAVTDQMHAEHRLATLLGKSFVQNALAIDVEAAGLRLWGWIG 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL LE+DP  VDVN
Sbjct: 243 LPTFSRSQADLQYFFVNGRVVKDKLVAHAVRQAYRDVLYNGRHPTFVLYLELDPATVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKA---INKKGISTSSVLSKKMISS--FHQDN---- 349
           VHP K  +RFR+  ++ +F+   I K    +  +  +   V+    +S     QD+    
Sbjct: 303 VHPTKHEVRFRDGRLVHDFLFSKIHKVLADVRPEATAELDVVDNAAVSQSITQQDSLTLS 362

Query: 350 --APKT-------HLPKYATSLTNTQEKLFLQENRLS-----TNDLLPSDDPTYSED--- 392
             +P T            A+S   T  ++  Q   +S      + +  SD P  + +   
Sbjct: 363 NRSPMTPGAMGDVSWMSAASSAPVTSGQVSGQMGVMSQMADFAHQVTSSDVPVSNVNPLT 422

Query: 393 ----------NDPVEESEATHY-QLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFE 441
                      D V E+E +    LG A AQ+H  YI+S+   GL++VD HAAHER+++E
Sbjct: 423 GEVIERAPMYKDGVAEAERSGMPPLGFAIAQLHGIYILSENQHGLIVVDMHAAHERILYE 482

Query: 442 KMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIP 501
           KM+  F + +I SQ LL P  I + + E  L+ E DE     G++ ER GP +I +RE+P
Sbjct: 483 KMKNAFYAKQIVSQPLLVPINISVAQSEADLVEEADEVFSSFGLRVERSGPESIMVREVP 542

Query: 502 AILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLL 561
            ILS+ ++  L+RD++ ++I   TT  L+ R   ++ATMAC+GS+R+ RK+   EMN LL
Sbjct: 543 VILSQGHVENLVRDVVSDLIMHGTTDILEARSNELMATMACHGSVRANRKLTIAEMNSLL 602

Query: 562 REMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           R+ME    S QCNHGRPT+ ++ +S+++KLF R
Sbjct: 603 RDMEITERSGQCNHGRPTWTQMTMSELDKLFLR 635


>gi|58582355|ref|YP_201371.1| DNA mismatch repair protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84624234|ref|YP_451606.1| DNA mismatch repair protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188576161|ref|YP_001913090.1| DNA mismatch repair protein [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|81311818|sp|Q5GZ85|MUTL_XANOR RecName: Full=DNA mismatch repair protein mutL
 gi|123739091|sp|Q2P295|MUTL_XANOM RecName: Full=DNA mismatch repair protein mutL
 gi|238691577|sp|B2SHP8|MUTL_XANOP RecName: Full=DNA mismatch repair protein mutL
 gi|58426949|gb|AAW75986.1| DNA mismatch repair protein MutL [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84368174|dbj|BAE69332.1| DNA mismatch repair protein mutL [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|188520613|gb|ACD58558.1| DNA mismatch repair protein MutL [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 625

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 230/627 (36%), Positives = 359/627 (57%), Gaps = 37/627 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    +I DNG
Sbjct: 1   MAIRQLPEMLINQIAAGEVVERPASVVKELVENALDAGATRVDIELEEGGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  +E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TL SR      G
Sbjct: 61  GGIAPDELPLAVSRHATSKIASLDDLETVATLGFRGEALPSIASVSRFTLTSRRHDAEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           + + I G ++  V P A  PGT VEVR+LFF +PAR  FL++E+ E   I + +R +A+A
Sbjct: 121 SALEIDGGRLGEVVPRAHAPGTTVEVRELFFNVPARRKFLRAERTELGHIEEWLRSLALA 180

Query: 179 YPKVSFTFS--TIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
            P V    S     S RYK     ++     R+ + +GEDF   A+ ++     + L G+
Sbjct: 181 RPDVELRVSHNGKPSRRYKPGDLYSDA----RLGETLGEDFARQALRVDHSGAGLRLHGW 236

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
              P ++R + +Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VD
Sbjct: 237 VAQPHYSRASTDQQYLYVNGRSVRDRSVAHAVKMAYGDVLFHGRQPAYVLFLELDPARVD 296

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKA------------INKKGISTSSVLSKKM--I 342
           VNVHPAK  +RFR   +I +F+ +++Q A            I   G   +   + +M  I
Sbjct: 297 VNVHPAKHEVRFREARLIHDFVYRTLQDALAHTRAGATPNSIGSDGAGYTGATAGEMGNI 356

Query: 343 SS---FHQDNAPKTHLPKYA-TSLTNTQEKLFLQ--ENRLSTNDLLP---------SDDP 387
           +S    +  NAP      Y+  + T +Q  L L+  E R + + L           +  P
Sbjct: 357 ASGGPANHGNAPGRSGSAYSYANWTPSQTPLGLRVDEARAAYSALYAPPPRNAPQSTGMP 416

Query: 388 TYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDF 447
           + +    P    ++    LG A AQ+H  YI+++  +GL++VD HAAHER+++E+++   
Sbjct: 417 SMAGTGLPATSEDSGVPPLGYAIAQLHGIYILAENAEGLIVVDMHAAHERIVYERLKNAH 476

Query: 448 NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKK 507
           +S  + +Q LL P  + + E E        + L  LG +  R GP ++ +R IPA+L+  
Sbjct: 477 DSIGLHAQPLLVPMTLAVGEREADTAEREADTLATLGFEITRAGPQSLHVRSIPALLANA 536

Query: 508 NIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKN 567
               LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME  
Sbjct: 537 EPEALLRDVLGDLREHGQSCRIASARDELLSTMACHGAVRANRRLTVPEMNALLRDMEAT 596

Query: 568 PNSSQCNHGRPTFIKLKLSDIEKLFGR 594
             S QCNHGRPT+ +  LSDI++ F R
Sbjct: 597 ERSGQCNHGRPTWARFTLSDIDRWFLR 623


>gi|325928077|ref|ZP_08189290.1| DNA mismatch repair protein MutL [Xanthomonas perforans 91-118]
 gi|325541575|gb|EGD13104.1| DNA mismatch repair protein MutL [Xanthomonas perforans 91-118]
          Length = 630

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 231/627 (36%), Positives = 359/627 (57%), Gaps = 37/627 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    +I DNG
Sbjct: 6   MAIRQLPEILINQIAAGEVVERPASVVKELVENALDAGATRVDIELEEGGVRLIRIRDNG 65

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  +E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TL SR      G
Sbjct: 66  GGIAPDELPLAVSRHATSKIASLDDLETVATLGFRGEALPSIASVSRFTLTSRRHDAEHG 125

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           + + I G ++  V P A  PGT VEVR+LFF +PAR  FL++E+ E   I + +R +A+A
Sbjct: 126 SALEIDGGRLGEVVPRAHAPGTTVEVRELFFNVPARRKFLRAERTELGHIEEWLRSLALA 185

Query: 179 YPKVSFTFS--TIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
            P V    S     S RYK     ++     R+ + +G+DF   A+ ++     + L G+
Sbjct: 186 RPDVELRVSHNGKPSRRYKPGDLYSDA----RLGETLGDDFARQALRVDHSGAGLRLHGW 241

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
              P ++R + +Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VD
Sbjct: 242 VAQPHYSRASTDQQYLYVNGRSVRDRSVAHAVKMAYGDVLFHGRQPAYVLFLELDPARVD 301

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAI--NKKGISTSSVLSKKMISSF--------- 345
           VNVHPAK  +RFR   +I +F+ +++Q A+   + G++ +S+ S                
Sbjct: 302 VNVHPAKHEVRFREARLIHDFVYRTLQDALAHTRAGVTPNSIGSDGAGDPGATAGGLGNI 361

Query: 346 ------HQDNAPKTHLPKY-ATSLTNTQEKLFLQ--ENRLSTNDLL---PSDD------P 387
                 +  NAP +    Y   S T +Q  L L+  E R + + L    PS        P
Sbjct: 362 AGSGVPNHGNAPGSSGSGYNYPSWTPSQTPLGLRVDEARAAYSALYAPPPSSAQQSAGMP 421

Query: 388 TYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDF 447
           + +    P    ++    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++   
Sbjct: 422 SMAGTGLPATAQDSGVPPLGYAVAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKNAH 481

Query: 448 NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKK 507
           +S  + +Q LL P  + + E E        E L  LG +  R GP ++ +R IPA+L+  
Sbjct: 482 DSIGLHAQPLLVPMTLAVGEREADTAEREAETLATLGFEITRAGPQSLHVRSIPALLANA 541

Query: 508 NIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKN 567
               LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME  
Sbjct: 542 EPEALLRDVLGDLREHGQSRRIASARDELLSTMACHGAVRANRRLTVPEMNALLRDMEAT 601

Query: 568 PNSSQCNHGRPTFIKLKLSDIEKLFGR 594
             S QCNHGRPT+ +  LSDI++ F R
Sbjct: 602 ERSGQCNHGRPTWARFTLSDIDRWFLR 628


>gi|78048158|ref|YP_364333.1| DNA mismatch repair protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|123757458|sp|Q3BSD0|MUTL_XANC5 RecName: Full=DNA mismatch repair protein mutL
 gi|78036588|emb|CAJ24279.1| DNA mismatch repair protein MutL [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 625

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 229/627 (36%), Positives = 360/627 (57%), Gaps = 37/627 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    +I DNG
Sbjct: 1   MAIRQLPEILINQIAAGEVVERPASVVKELVENALDAGATRVDIELEEGGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  +E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TL SR      G
Sbjct: 61  GGIAPDELPLAVSRHATSKIASLDDLETVATLGFRGEALPSIASVSRFTLTSRRHDAEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           + + I G ++  V P A  PGT VEVR+LFF +PAR  FL++E+ E   I + +R +A+A
Sbjct: 121 SALEIDGGRLGEVVPRAHAPGTTVEVRELFFNVPARRKFLRAERTELGHIEEWLRSLALA 180

Query: 179 YPKVSFTFS--TIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
            P V    S     S RYK     ++     R+ + +G+DF   A+ ++     + L G+
Sbjct: 181 RPDVELRVSHNGKPSRRYKPGDLYSDA----RLGETLGDDFARQALRVDHSGAGLRLHGW 236

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
              P ++R + +Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VD
Sbjct: 237 VAQPHYSRASTDQQYLYVNGRSVRDRSVAHAVKMAYGDVLFHGRQPAYVLFLELDPARVD 296

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAI--NKKGISTSSVLSKKM----ISSFHQDNA 350
           VNVHPAK  +RFR   +I +F+ +++Q A+   + G++ +S+ S        ++    N 
Sbjct: 297 VNVHPAKHEVRFREARLIHDFVYRTLQDALAHTRAGVTPNSIGSDGAGDPGATAGGLGNI 356

Query: 351 PKTHLPKYA------------TSLTNTQEKLFLQ--ENRLSTNDLL---PSDD------P 387
             + +P +              S T +Q  L L+  E R + + L    PS        P
Sbjct: 357 AGSGVPNHGNAAGSSGSGYNYASWTPSQTPLGLRVDEARAAYSALYAPPPSSAQQSAGMP 416

Query: 388 TYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDF 447
           + +    P    ++    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++   
Sbjct: 417 SMAGTGLPATAQDSGVPPLGYAVAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKNAH 476

Query: 448 NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKK 507
           +S  + +Q LL P  + + E E        E L  LG +  R GP ++ +R IPA+L+  
Sbjct: 477 DSIGLHAQPLLVPMTLAVGEREADTAEREAETLATLGFEITRAGPQSLHVRSIPALLANA 536

Query: 508 NIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKN 567
               LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME  
Sbjct: 537 EPEALLRDVLGDLREHGQSRRIASARDELLSTMACHGAVRANRRLTVPEMNALLRDMEAT 596

Query: 568 PNSSQCNHGRPTFIKLKLSDIEKLFGR 594
             S QCNHGRPT+ +  LSDI++ F R
Sbjct: 597 ERSGQCNHGRPTWARFTLSDIDRWFLR 623


>gi|254524173|ref|ZP_05136228.1| DNA mismatch repair protein MutL [Stenotrophomonas sp. SKA14]
 gi|219721764|gb|EED40289.1| DNA mismatch repair protein MutL [Stenotrophomonas sp. SKA14]
          Length = 634

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 231/627 (36%), Positives = 357/627 (56%), Gaps = 39/627 (6%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR L + +INQIAAGE++ERP+  +KEL+EN++DA +SRV+  +  GG    +I DNG G
Sbjct: 10  IRPLPDILINQIAAGEVVERPASVVKELVENAIDAGASRVDIDLEEGGVRLIRIRDNGSG 69

Query: 63  MTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  E++P+AV RH TSKI+D  D  ++ T GFRGEALPSI +VS  TL SR   +  G+ 
Sbjct: 70  IAPEQLPLAVSRHATSKIADLDDLESVATLGFRGEALPSIASVSRFTLASRRAHDEHGSA 129

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + I G KI  V P A  PGT VEVR+LF+ +PAR  FL++E+ E   I + +R +A+A P
Sbjct: 130 LQIEGGKIGEVTPRAHAPGTTVEVRELFYNVPARRKFLRAERTELGHIEEWLRSLALARP 189

Query: 181 KVSFTFS--TIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            V    S     S RYK     ++     R+++ +GEDF N AV ++     + L G+  
Sbjct: 190 DVELRVSHNGKASRRYKPGDLYSDA----RLAETLGEDFANQAVRVDHSGAGLRLHGWIA 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P ++R +A+Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VDVN
Sbjct: 246 QPHYSRASADQQYLYVNGRSVRDRSVAHAVKMAYGDVLYHGRQPAYVLFLELDPTRVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI--NKKGIS---------------TSSVLSKKM 341
           VHPAK  +RFR+  ++ +F+ ++++ A+   + G+S               T+ + S   
Sbjct: 306 VHPAKHEVRFRDSRLVHDFVYRTLKDALADTRAGMSAQEIGALPAHPVDAATTPMASSAG 365

Query: 342 ISSFHQDNAPK---THLPKYATSLTNTQEKLFLQ-----------ENRLSTNDLLPSDDP 387
            S F     P            S    Q+ L LQ               S  +   +  P
Sbjct: 366 ASGFGLVRGPAPGSGSGGGGGFSGWRPQQPLGLQVADAPAAYAALYAAPSGAERGATLPP 425

Query: 388 TYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDF 447
             SE+  PV  ++A    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++   
Sbjct: 426 MPSENGLPVTSADAGVPPLGYAIAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKNAH 485

Query: 448 NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKK 507
           +   + SQ LL P  + + E E        E L  LG +  R GP A+ +R IPA+L+  
Sbjct: 486 DGIGLQSQPLLVPITLAVGEREADTAESEAETLAALGFEVTRAGPGALHVRSIPALLAHA 545

Query: 508 NIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKN 567
               LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME  
Sbjct: 546 EPEGLLRDVLTDLREHGQSRRVASARDELLSTMACHGAVRANRRLTVPEMNALLRDMEIT 605

Query: 568 PNSSQCNHGRPTFIKLKLSDIEKLFGR 594
             S QCNHGRPT+ +  L++I++ F R
Sbjct: 606 ERSGQCNHGRPTWARFSLAEIDRWFLR 632


>gi|190571443|ref|YP_001975801.1| DNA mismatch repair protein MutL [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018841|ref|ZP_03334649.1| DNA mismatch repair protein MutL [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357715|emb|CAQ55164.1| DNA mismatch repair protein MutL [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995792|gb|EEB56432.1| DNA mismatch repair protein MutL [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 609

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 245/615 (39%), Positives = 363/615 (59%), Gaps = 28/615 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I  L  K IN+IAAGE+IERP+  +KEL+EN++DA SS +E  I  GG++   + D+G
Sbjct: 1   MAIVLLDTKTINRIAAGEVIERPASVVKELVENAIDARSSEIEIKIESGGRNLITVIDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            G+  +++ +A  RH TSK+SD +   I   GFRGEALPSI AVS + L S+  + +   
Sbjct: 61  SGVKKDDLELAFMRHATSKLSDSELIEIKHLGFRGEALPSIAAVSRIKLSSKASKADQAW 120

Query: 120 QIAI-SGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            I    GEKI  + P  ++ GT +EVRDLFF  P RL FLK+E+ ET  I D++  +A+ 
Sbjct: 121 SIRYEGGEKIGELVPYPLSIGTYIEVRDLFFATPNRLKFLKTERAETQSIVDIVNNLAMI 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              + FT   I  N+  + +   N  F  R+ +V  E+F  N+++++E+ + I L GY  
Sbjct: 181 NYGIEFTL--ISDNKKLLKYAKQNSLFS-RLCEV-EEEFHENSLQISEEEDGIRLTGYIC 236

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            PT NR N+ Q Y F+NGR ++D  ++  IR AY + IP  RYP   L LEI   QVDVN
Sbjct: 237 KPTVNRSNSTQIYTFVNGRPIKDNLLIGAIRYAYHDLIPSNRYPFAALHLEIPYDQVDVN 296

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH---- 354
           VHP KS +RF+N  +I   + + + K ++K+     +VL++   ++ H  + P +     
Sbjct: 297 VHPNKSEVRFQNKRLIYEIVRRGLIKVLSKRIDLAETVLAQNGTTTNHLSSDPFSRSSLK 356

Query: 355 ---LPKYATSLTNTQEKLFLQEN--RLSTNDLLPSDDPTYSEDNDPVEESEATH------ 403
                + +    N   + F   N    S ++   S D T  + + P  E+          
Sbjct: 357 NEFYGRRSDPFENQLMRKFTSPNIETKSLSEHSKSFDYTGMQKSPPRAETTILERKQTDL 416

Query: 404 ---YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTP 460
              Y LG A  QI+  YII++  D L+IVDQHAAHERL++E +++    + I  Q LL P
Sbjct: 417 IRDYPLGFAHCQIYNTYIIAEVRDKLIIVDQHAAHERLVYECLKE---KSSIKRQKLLLP 473

Query: 461 EIIDLL-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDE 519
           E++++  +    +I  + + L  +G   E    NAI ++EIPAIL   ++ ++L DI+D 
Sbjct: 474 EMVEIKSQAGMEMIEVYKDKLFEMGFDIEIKSENAIIVKEIPAILGSIDVKKMLIDIVDR 533

Query: 520 IIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPT 579
           +I+   T  ++D+I  ILAT+AC+GSIR+GRKM+  EMN LLR++EK P S QCNHGRPT
Sbjct: 534 LIEIEDTLPIEDKINKILATIACHGSIRAGRKMKLEEMNELLRQIEKTPYSGQCNHGRPT 593

Query: 580 FIKLKLSDIEKLFGR 594
           +I++KLSDIEKLF R
Sbjct: 594 YIEMKLSDIEKLFER 608


>gi|83648044|ref|YP_436479.1| DNA mismatch repair protein [Hahella chejuensis KCTC 2396]
 gi|83636087|gb|ABC32054.1| DNA mismatch repair enzyme (predicted ATPase) [Hahella chejuensis
           KCTC 2396]
          Length = 612

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 219/614 (35%), Positives = 363/614 (59%), Gaps = 27/614 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI  LS ++ NQIAAGE++ERPS  +KEL+EN+LDA + ++E  I  GG    +I D+G 
Sbjct: 3   KIHLLSPRLANQIAAGEVVERPSSVVKELVENALDAGARKIEVDIENGGVKLIRIRDDGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  E++P+A+ RH TSKI   +D   + T GFRGEAL SI +VS L L SRP       
Sbjct: 63  GIPREDLPLALSRHATSKIETLEDLEAVATLGFRGEALASICSVSRLALTSRPQNQGEAW 122

Query: 120 QIAISGEKIS-SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           ++ + G ++   + P A  PGT VEVRDLF+  PAR  F+++E+ E   I ++I+R A+ 
Sbjct: 123 KVEVEGREMKPEISPAAHTPGTTVEVRDLFYNTPARRKFMRTEKTEFGHIEEIIKRQALG 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+FT    +   +++   ++  +   RI Q+ G +FI +A+ +N  ++ ++L G+  
Sbjct: 183 RLSVAFTLRHNQKVVHQLRPAASEEDHIRRIGQLCGANFIESAIPINVSASGLSLTGWVA 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            PTF+R  A+  Y F+NGR ++DK +   +R AY + +  GR+P  VL LE+DP  VDVN
Sbjct: 243 KPTFSRSQADLQYFFVNGRVIRDKLVAHAVRQAYQDVLYHGRHPAFVLYLELDPATVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI-----NKKGISTSSVLSKK--MISSFHQDNAP 351
           VHP K  +RFR   ++ +F+ +S+ +A+         + T  V+ ++  ++    QD  P
Sbjct: 303 VHPTKHEVRFREGRMVHDFLFRSLHRALAEVKPQAAAVETLPVVEQERPVMQWPTQDALP 362

Query: 352 KTHLPKYA---------TSLTNTQEKLFLQ-ENRLSTNDLL-PSDDPTYSEDNDPVEESE 400
               P  +          S    Q   + Q  ++   +D+   + +   S  +D VE   
Sbjct: 363 LRQQPAASGFSMTGNPPASAVRDQISAYGQLHDKSGLSDMFGAAPEKVLSVVDDAVEAP- 421

Query: 401 ATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTP 460
                LG A AQ+H  ++++Q   G+V+VD HAAHER+++E+M++  +++ +T+Q +L P
Sbjct: 422 -----LGYAIAQLHGVFVLAQNAQGMVLVDMHAAHERIVYERMKRSLHNSGVTTQPMLVP 476

Query: 461 EIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEI 520
             + +   E   + E+ E L +LG++    G  +I +R++PA+L   N+  L+RD+I E+
Sbjct: 477 MNLAVSRRESLAVEENAETLRQLGLEITAAGAESIIVRQVPALLRNANVEALVRDVIAEL 536

Query: 521 IDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTF 580
            +  +T  +++ +  +L TMAC+G++R+ R++   EMN LLR+ME    S QCNHGRPT+
Sbjct: 537 AEHGSTRKVEETMNELLGTMACHGAVRANRQLTIAEMNALLRDMEDTERSGQCNHGRPTW 596

Query: 581 IKLKLSDIEKLFGR 594
           ++L +S+++KLF R
Sbjct: 597 VQLTMSELDKLFLR 610


>gi|294666460|ref|ZP_06731703.1| DNA mismatch repair protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292603766|gb|EFF47174.1| DNA mismatch repair protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 625

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 231/627 (36%), Positives = 359/627 (57%), Gaps = 37/627 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    +I DNG
Sbjct: 1   MAIRQLPEILINQIAAGEVVERPASVVKELVENALDAGATRVDIELEEGGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+T +E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TL SR      G
Sbjct: 61  GGITPDELPLAVSRHATSKIASLDDLETVATLGFRGEALPSIASVSRFTLTSRRHDAEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           + + I G ++  V P A  PGT VEVR+LFF +PAR  FL++E+ E   I + +R +A+A
Sbjct: 121 SALEIDGGRLGEVVPRAHAPGTTVEVRELFFNVPARRKFLRAERTELGHIEEWLRSLALA 180

Query: 179 YPKVSFTFS--TIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
            P V    S     S RYK     ++     R+ + +G+DF   A+ ++     + L G+
Sbjct: 181 RPDVELRVSHNGKPSRRYKPGDLYSDA----RLGETLGDDFARQALRVDHSGAGLRLHGW 236

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
              P ++R + +Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VD
Sbjct: 237 VAQPHYSRASTDQQYLYVNGRSVRDRSVAHAVKMAYGDVLFHGRQPAYVLFLELDPARVD 296

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAI--NKKGISTSSVLSKKM----ISSFHQDNA 350
           VNVHPAK  +RFR   +I +F+ +++Q A+   + G + +S+ S ++     +S    + 
Sbjct: 297 VNVHPAKHEVRFREARLIHDFVYRTLQDALAQTRAGATPNSIGSDRVGDMGTTSGGMGSL 356

Query: 351 PKTHLPKYA------------TSLTNTQEKLFLQ--ENRLSTNDLL---PSDD------P 387
                P++              S T +Q  L L+  E R +   L    PS        P
Sbjct: 357 AGGGAPRHGGMPGGSNGTYGYASWTPSQAPLGLRVDEARAAYGALYAPPPSSAQQSAGMP 416

Query: 388 TYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDF 447
                  P    ++    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++Q  
Sbjct: 417 NMVGTGLPATAEDSGVPPLGYAIAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKQAH 476

Query: 448 NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKK 507
           +S  + +Q LL P  + + E E        E L  LG +  R GP ++ +R IPA+L+  
Sbjct: 477 DSIGLHAQPLLVPMTLAVGEREADTAEREAETLATLGFEITRAGPQSLHVRSIPALLANA 536

Query: 508 NIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKN 567
               LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME  
Sbjct: 537 EPEALLRDVLGDLREHGQSRRIASARDELLSTMACHGAVRANRRLTVPEMNALLRDMEAT 596

Query: 568 PNSSQCNHGRPTFIKLKLSDIEKLFGR 594
             S QCNHGRPT+ +  LSDI++ F R
Sbjct: 597 ERSGQCNHGRPTWARFTLSDIDRWFLR 623


>gi|294626021|ref|ZP_06704631.1| DNA mismatch repair protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292599691|gb|EFF43818.1| DNA mismatch repair protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 625

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 231/627 (36%), Positives = 359/627 (57%), Gaps = 37/627 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    +I DNG
Sbjct: 1   MAIRQLPEILINQIAAGEVVERPASVVKELVENALDAGATRVDIELEEGGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+T +E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TL SR      G
Sbjct: 61  GGITPDELPLAVSRHATSKIASLDDLETVATLGFRGEALPSIASVSRFTLTSRRHDAEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           + + I G ++  V P A  PGT VEVR+LFF +PAR  FL++E+ E   I + +R +A+A
Sbjct: 121 SALEIDGGRLGEVVPRAHAPGTTVEVRELFFNVPARRKFLRAERTELGHIEEWLRSLALA 180

Query: 179 YPKVSFTFS--TIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
            P V    S     S RYK     ++     R+ + +G+DF   A+ ++     + L G+
Sbjct: 181 RPDVELRVSHNGKPSRRYKPGDLYSDA----RLGETLGDDFARQALRVDHSGAGLRLHGW 236

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
              P ++R + +Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VD
Sbjct: 237 VAQPHYSRASTDQQYLYVNGRSVRDRSVAHAVKMAYGDVLFHGRQPAYVLFLELDPARVD 296

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAI--NKKGISTSSVLSKKM----ISSFHQDNA 350
           VNVHPAK  +RFR   +I +F+ +++Q A+   + G + +S+ S ++     +S    + 
Sbjct: 297 VNVHPAKHEVRFREARLIHDFVYRTLQDALAQTRAGATPNSIGSDRVGDMGTTSGGMGSL 356

Query: 351 PKTHLPKYA------------TSLTNTQEKLFLQ--ENRLSTNDLL---PSDD------P 387
                P +              S T +Q  L L+  E R +   L    PS        P
Sbjct: 357 AGGGAPSHGGMPGGSNGTYGYASWTPSQTPLGLRVDEARAAYGALYAPPPSSAQQSAGMP 416

Query: 388 TYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDF 447
             +    P    ++    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++Q  
Sbjct: 417 NMAGTGLPATAEDSGVPPLGYAIAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKQAH 476

Query: 448 NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKK 507
           +S  + +Q LL P  + + E E        E L  LG +  R GP ++ +R IPA+L+  
Sbjct: 477 DSIGLHAQPLLVPMTLAVGEREADTAEREAETLATLGFEITRAGPQSLHVRSIPALLANA 536

Query: 508 NIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKN 567
               LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME  
Sbjct: 537 EPEALLRDVLGDLREHGQSRRIASARDELLSTMACHGAVRANRRLTVPEMNALLRDMEAT 596

Query: 568 PNSSQCNHGRPTFIKLKLSDIEKLFGR 594
             S QCNHGRPT+ +  LSDI++ F R
Sbjct: 597 ERSGQCNHGRPTWARFTLSDIDRWFLR 623


>gi|166711797|ref|ZP_02243004.1| DNA mismatch repair protein [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 625

 Score =  429 bits (1104), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 230/627 (36%), Positives = 358/627 (57%), Gaps = 37/627 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    +I DNG
Sbjct: 1   MAIRQLPEMLINQIAAGEVVERPASVVKELVENALDAGATRVDIELEEGGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  +E+ +AV RH TSKI+  DD   + T GFRGEALPSI +VS  TL SR      G
Sbjct: 61  GGIAPDELSLAVSRHATSKIASLDDLETVATLGFRGEALPSIASVSRFTLTSRRHDAEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           + + I G ++  V P A  PGT VEVR+LFF +PAR  FL++E+ E   I + +R +A+A
Sbjct: 121 SALEIDGGRLGEVVPRAHAPGTTVEVRELFFNVPARRKFLRAERTELGHIEEWLRSLALA 180

Query: 179 YPKVSFTFS--TIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
            P V    S     S RYK     ++     R+ + +GEDF   A+ ++     + L G+
Sbjct: 181 RPDVELRVSHNGKPSRRYKPGDLYSDA----RLGETLGEDFARQALRVDHSGAGLRLHGW 236

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
              P ++R + +Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VD
Sbjct: 237 VAQPHYSRASTDQQYLYVNGRSVRDRSVAHAVKMAYGDVLFHGRQPAYVLFLELDPARVD 296

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKA------------INKKGISTSSVLSKKM--I 342
           VNVHPAK  +RFR   +I +F+ +++Q A            I   G   +   + +M  I
Sbjct: 297 VNVHPAKHEVRFREARLIHDFVYRTLQDALAHTRAGATPNSIGSDGAGDTGATAGEMGNI 356

Query: 343 SS---FHQDNAPKTHLPKYA-TSLTNTQEKLFLQ--ENRLSTNDLLP---------SDDP 387
           +S    +  NAP +    Y+  S T +Q  L L+  E R + + L           +  P
Sbjct: 357 ASGGLANHGNAPGSSGRAYSYASWTPSQTPLGLRVDEARAAYSALYAPPPRNAPQSTGMP 416

Query: 388 TYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDF 447
           + +    P    ++    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++   
Sbjct: 417 SMAGTGLPATAEDSGVPPLGYAIAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKNAH 476

Query: 448 NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKK 507
           +S  + +Q LL P  + + E E        + L  LG +  R GP ++ +R IPA+L+  
Sbjct: 477 DSIGLHAQPLLVPMTLAVGEREADTAEREADTLATLGFEITRAGPQSLHVRSIPALLANA 536

Query: 508 NIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKN 567
               LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME  
Sbjct: 537 EPEALLRDVLGDLREHGQSRRIASARDELLSTMACHGAVRANRRLTVPEMNALLRDMEAT 596

Query: 568 PNSSQCNHGRPTFIKLKLSDIEKLFGR 594
             S QCNHGRPT+ +  LSDI++ F R
Sbjct: 597 ERSGQCNHGRPTWARFTLSDIDRWFLR 623


>gi|319787568|ref|YP_004147043.1| DNA mismatch repair protein MutL [Pseudoxanthomonas suwonensis
           11-1]
 gi|317466080|gb|ADV27812.1| DNA mismatch repair protein MutL [Pseudoxanthomonas suwonensis
           11-1]
          Length = 617

 Score =  428 bits (1101), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 216/617 (35%), Positives = 359/617 (58%), Gaps = 25/617 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR L + +INQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    +I D+G
Sbjct: 1   MPIRPLPDTLINQIAAGEVVERPASVVKELVENALDAGATRVDIDLEEGGIRLIRIRDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  EE+P+A+ RH TSKI+  DD   + T GFRGEALPSI +VS   L SRP     G
Sbjct: 61  GGIPPEELPLAISRHATSKIASLDDLEAVATLGFRGEALPSIASVSRFMLASRPRDAEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           A + + G ++  + P A  PGT VEVR+LF+ +PAR  FL++E+ E   I + +R +A+A
Sbjct: 121 AALHVDGGRVGEIVPKAHAPGTTVEVRELFYNVPARRKFLRAERTELGHIEEWLRSLALA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P V    S   + +    +++ + +   R+ + +GEDF  +A+ ++     + L G+  
Sbjct: 181 RPDVELRVS--HNGKPSRRYRAGDLDAAARLGETLGEDFARSALRIDHSGAGLRLHGWIA 238

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P ++R +A+Q Y+++NGR V+D+ +   ++ AY + +  GR P  VL LE+DP +VDVN
Sbjct: 239 QPHYSRASADQQYLYVNGRAVRDRSVAHAVKLAYQDVLYHGRQPAYVLFLELDPTRVDVN 298

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINK------KGISTSSVLSKKMISSFHQDNAPK 352
           VHPAK  +RFR+  +I +F+ +++Q+A+ +       G++ S++  +  +      +A  
Sbjct: 299 VHPAKHEVRFRDARLIHDFVFRTLQEALAQTRAGVETGVAASAMPGQAPMGWQPSASAAP 358

Query: 353 THLPKYATS-----LTNTQEKLFLQENRLST----------NDLLPSDDPTYSEDNDPVE 397
           + L   A +      T   + L L+ +  +           N    S  P     +  + 
Sbjct: 359 SPLDNGAGARPFVPWTPAPQPLGLRVDEAAGAYAALYGEPGNSSGASAMPVLPRQDMALP 418

Query: 398 ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTL 457
           E++     LG A AQ+H  YI+++  +GLV+VD HAAHER+ +E+++   +   + +Q L
Sbjct: 419 EAQGEVPPLGYAIAQLHGIYILAENAEGLVVVDMHAAHERIGYERLKTAHDGIGLRAQPL 478

Query: 458 LTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDII 517
           L P  + + E +  +     E L +LG +  R GP  +A+R +PA+L+  +   LLRD++
Sbjct: 479 LVPLSLAVGERDADVAERESETLVQLGFEVTRSGPQTLAVRSVPALLAHADPEALLRDVL 538

Query: 518 DEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGR 577
            ++ +   T  +    + +L+TMAC+G++R+ R++   EMN LLR+ME    S QCNHGR
Sbjct: 539 ADLREHGATRRVAAARDELLSTMACHGAVRANRRLTIPEMNALLRDMEATERSGQCNHGR 598

Query: 578 PTFIKLKLSDIEKLFGR 594
           PT+ +  L +I++ F R
Sbjct: 599 PTWARFSLGEIDRWFLR 615


>gi|53804020|ref|YP_114135.1| DNA mismatch repair protein [Methylococcus capsulatus str. Bath]
 gi|53757781|gb|AAU92072.1| DNA mismatch repair protein MutL [Methylococcus capsulatus str.
           Bath]
          Length = 611

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 230/617 (37%), Positives = 354/617 (57%), Gaps = 43/617 (6%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M+IR+L  ++INQIAAGE+IERP+  +KEL+EN+ DA + +VE  +  GG    ++ D+G
Sbjct: 13  MRIRRLPPQLINQIAAGEVIERPASVVKELVENAFDAGARQVEVDVEQGGVRLIRVRDDG 72

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  E++ +A+ RH TSKI+  +D   + + GFRGEALPSI AV+ LTL SR      G
Sbjct: 73  CGIDREDLGLALSRHATSKIASLEDLERVASMGFRGEALPSISAVARLTLTSRTADVPCG 132

Query: 119 AQIAISG-EKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
            Q++  G E    ++P     GT VEVRDLF+  PAR  FL++E+ E   I  +++RMA+
Sbjct: 133 WQVSADGSESDFDIQPAQHAQGTTVEVRDLFYNTPARRKFLRAEKTEFGHIQTLVQRMAL 192

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           A   V F     +    ++   +  G  PERI  + G DF+  A+ +  +++ + L G+ 
Sbjct: 193 ARFDVGFRLRHNQREVLRLQPDAEEGGRPERIGALCGPDFLEQALRVEFEASGLRLHGWV 252

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PTF+R  A+  + ++N R ++DK +   IR AY + +   R PV VL LEIDP  VDV
Sbjct: 253 GLPTFSRSQADLQFFYVNHRPIRDKLVGHAIRQAYQDVLYHQRQPVYVLYLEIDPALVDV 312

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAI-NKKGISTSSVLSKKMISSFHQDNAPKTHLP 356
           N HPAK  +RFR   ++ +F+  ++ +AI   +   T+SV++           AP T  P
Sbjct: 313 NAHPAKLEVRFREGRMVHDFLFSALHRAIAGHRPGRTASVVA-----------APATEHP 361

Query: 357 K-YATSLTNTQEKLFL-----QENRLSTNDL-------------LPSDDPTYSEDNDPVE 397
              A     +Q+ LF      Q   LS+ D              LP+   T +E   P  
Sbjct: 362 APLAEQPQQSQQPLFRVAETPQRPYLSSGDSETLGDLRRLYSVSLPNPTETRAEQEIP-- 419

Query: 398 ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTL 457
                   LG A A +   YI+++   GL++VD HAAHER+ +E+M++ + +  I SQ L
Sbjct: 420 -------PLGYALAHLKGVYILAENAQGLILVDGHAAHERITYERMKRQYQAGGIASQPL 472

Query: 458 LTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDII 517
           L P  I L   +  L  E+ E L RLGI+  R G  ++ +R +PA+L   ++ +L+RD +
Sbjct: 473 LLPVRIRLSRADADLAEEYGEHLARLGIELRRTGEGSVLVRSVPALLEGSDVERLVRDTL 532

Query: 518 DEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGR 577
            ++ +  ++  LQ+ +  +LA+MAC+GS+R+GRK+   EMN LLREME    + QCNHGR
Sbjct: 533 ADLREHGSSGRLQETLNTVLASMACHGSVRAGRKLTVPEMNALLREMEATERAGQCNHGR 592

Query: 578 PTFIKLKLSDIEKLFGR 594
           PT+++L    +++LF R
Sbjct: 593 PTWVQLDTQALDRLFLR 609


>gi|120555682|ref|YP_960033.1| DNA mismatch repair protein [Marinobacter aquaeolei VT8]
 gi|120325531|gb|ABM19846.1| DNA mismatch repair protein MutL [Marinobacter aquaeolei VT8]
          Length = 629

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 225/625 (36%), Positives = 361/625 (57%), Gaps = 34/625 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ LS ++ NQIAAGE++ERP+  +KEL+EN+LDA +SRV+  I  GG    ++ D+G G
Sbjct: 4   IQLLSPRLANQIAAGEVVERPASVVKELVENALDAGASRVDVEIEQGGAKLIRVRDDGSG 63

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +   ++P+A+ RH TSKI   DD   + + GFRGEAL SI +VS LTL SR       A+
Sbjct: 64  IEEADLPLALSRHATSKILTLDDLEAVASLGFRGEALASISSVSRLTLTSRTELQEAAAR 123

Query: 121 IAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           + + G  + + + P A   GT VEVRDLFF  PAR  FL++E+ E N + + +RR A+  
Sbjct: 124 VEVEGRDMDARISPAAHPVGTTVEVRDLFFNTPARRKFLRTEKTEFNHVEECVRRQALGR 183

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
               FT    +     +    T+ +   RI  + G+ FI+NAV ++ ++  + L G+  +
Sbjct: 184 FDTGFTLRHNQRVVQSLRPAETDLDKERRIGSLCGQQFIDNAVVIDAEATGLRLWGWVAL 243

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF+R  A+  Y F+NGR ++DK +   +R AY + +   R+P  VL LE+DP  VDVNV
Sbjct: 244 PTFSRSQADLQYFFVNGRVIRDKLVAHAVRQAYRDVLYNNRHPAFVLYLEVDPATVDVNV 303

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------NKKGISTSSVLSKKMI----SSFHQD 348
           HP K  +RFR+  ++ +FI +++ +A+       + +G +  S   +  +     S    
Sbjct: 304 HPTKHEVRFRDGRLVHDFIFRTLHRALADVRPDDHLRGAAAQSFGRESAVVEPEHSAGGF 363

Query: 349 NAPKTHLP--------KYATSLTNTQEKLFLQENRLS-----------TNDLLPSDDPTY 389
           +AP T  P         Y +S   + ++ +   ++++           +  +  ++ P  
Sbjct: 364 SAPGTSGPWPTQSRTEAYPSSPGQSPQQEWRASDQMAFYQSLNEGGGVSTPVARAEMPAA 423

Query: 390 SEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
           S    P  + +A    LG A AQ+H  YI++Q+  GL++VD HAAHER+ +E+M++    
Sbjct: 424 SASVTPPRD-DAEEPPLGYAIAQLHGIYILAQSRAGLIVVDMHAAHERITYERMKRALVE 482

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             + SQ LL P  + + + E AL   H E+L +LG++ ER GP  +A+R+IPA+L   + 
Sbjct: 483 QDLKSQPLLVPLSLAVSQKEAALAESHGEELQQLGLQIERIGPETLAVRQIPALLRGADT 542

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            QL+RD++ ++I+   +  ++     +L TMAC+GS+R+ R++   EMN LLR+ME    
Sbjct: 543 EQLVRDVLADLIEHGQSDRVEAVTHELLGTMACHGSVRANRQLTIPEMNSLLRDMEATER 602

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+  + LS+++KLF R
Sbjct: 603 SGQCNHGRPTWTLVTLSELDKLFLR 627


>gi|42521099|ref|NP_967014.1| DNA mismatch repair protein MutL-1 [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|42410840|gb|AAS14948.1| DNA mismatch repair protein MutL-1 [Wolbachia endosymbiont of
           Drosophila melanogaster]
          Length = 608

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 243/615 (39%), Positives = 359/615 (58%), Gaps = 29/615 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I  L  K IN+IAAGE+IERP+  +KEL+EN++DA S  +E  I  GG++   +TD+G
Sbjct: 1   MAIILLDTKTINRIAAGEVIERPASVVKELVENAIDAGSLEIEIKIESGGRNLIIVTDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            G+   ++ +A  RH TSK+SD +   I   GFRGEALPSI AVS + L S+  + N   
Sbjct: 61  NGVEKNDLELAFMRHATSKLSDNELIEIKHLGFRGEALPSIAAVSRIKLSSKAREANEAW 120

Query: 120 QIAI-SGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            I+   GEKI    P +++ GT +EVRDLFF  P RL FLK+E+ ET  I D++  +A+ 
Sbjct: 121 SISYEGGEKIGEQTPYSLSQGTHIEVRDLFFATPNRLKFLKTERAETQSIVDIVNNLAMI 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              + FT ++   N+  + +      F  R+ +V  E+F  N++E+NE+ + I L G+  
Sbjct: 181 NYHIGFTLTS--GNKKLLKYAKQTSLF-HRLCEV-EEEFQGNSLEINEEEDGIKLTGHIC 236

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            PT NRG + Q Y F+NGR ++D  ++  +R AY + IP  RYP   L LEI   QVDVN
Sbjct: 237 KPTVNRGKSTQIYTFVNGRPIKDNLLIGAVRYAYHDFIPSDRYPFAALHLEIPYDQVDVN 296

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISS----FHQDNAPKTH 354
           VHP KS +RF+N  +I   + + + KA++++ I T     +KM S+    F + N  K  
Sbjct: 297 VHPNKSEVRFQNKKLIYEIMTRGLIKALSRR-IGTFPAHDQKMDSTLPDPFDKPNVQKEF 355

Query: 355 LPKYATSLTNTQEKLFLQENRLSTN-------------DLLPSDDPTYSEDNDPVEESEA 401
             K  +   N   K F   N  +                  PS   T   +   +E+ + 
Sbjct: 356 YEKRPSPFKNQLIKEFASPNEKAKGLSEQSKSFDYTGIQKFPSQAETMVLEKKVLEQVDL 415

Query: 402 TH-YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTP 460
              + LG A  Q++  YII++  D L+IVDQHAAHERL++E ++Q    + +  Q LL P
Sbjct: 416 IESHPLGFARCQVYNTYIIAEVRDKLIIVDQHAAHERLVYECLKQ---KSSVKRQKLLLP 472

Query: 461 EIIDLL-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDE 519
           E +++  +    +I  + + L  +G   E    N + ++EIPAIL   ++ ++L +I+D 
Sbjct: 473 ETVEIKNQAGMEMIEIYKDKLFEMGFDIEIKPENKVIVKEIPAILGAIDVKEMLINIVDR 532

Query: 520 IIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPT 579
           + +   T  ++D++  ILAT+ACYGSIR+GRKM+  EMN LLR+MEK P S QCNHGRPT
Sbjct: 533 LTEIEDTLPVEDKVNKILATIACYGSIRAGRKMRFEEMNVLLRQMEKTPYSGQCNHGRPT 592

Query: 580 FIKLKLSDIEKLFGR 594
           +I++KLSDIEKLF R
Sbjct: 593 YIEMKLSDIEKLFER 607


>gi|285017885|ref|YP_003375596.1| DNA mismatch repair protein mutl [Xanthomonas albilineans GPE PC73]
 gi|283473103|emb|CBA15608.1| probable dna mismatch repair protein mutl [Xanthomonas albilineans]
          Length = 623

 Score =  426 bits (1095), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 223/626 (35%), Positives = 358/626 (57%), Gaps = 37/626 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN+LDA + RV+  +  GG    +I D+G
Sbjct: 1   MSIRQLPEILINQIAAGEVVERPASVVKELVENALDAGARRVDVDLEEGGVRLIRIRDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+ +EE+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TL SR   +  G
Sbjct: 61  SGIPAEELPLAVSRHATSKIASLDDLETVGTLGFRGEALPSIASVSRFTLASRRADDAHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           A + + G K+ +V+P A +PGT VEVR+LF+ +PAR  FL++E+ E   I + +R +A+A
Sbjct: 121 AMLQVEGGKVGAVQPHAQSPGTTVEVRELFYNVPARRKFLRAERTELGHIEEWLRSLALA 180

Query: 179 YPKVSFTFS--TIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
            P V    S     S RYK     ++     R+ + +GEDF   A+ ++     + L G+
Sbjct: 181 RPDVELRVSHNGKPSRRYKPGDLYSDA----RLGETLGEDFARQALRVDHSGAGLRLHGW 236

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
              P ++R +A+Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VD
Sbjct: 237 IAQPHYSRASADQQYLYVNGRSVRDRSVAHAVKMAYGDVLFHGRQPAYVLFLELDPSRVD 296

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINK-KGISTSSVLSKKMISSFHQDNAPKTHL 355
           VNVHPAK  +RFR+  +I +F+ +++Q  + + +  S  S  +   + +     +     
Sbjct: 297 VNVHPAKHEVRFRDARLIHDFVYRTLQDTLAQTRAGSLPSTAADAPVQTLPTHGSGAGAW 356

Query: 356 PKYATSLTNTQEK--------------LFLQE-------------NRLSTNDLLPSDDPT 388
           P    S+  +  K              L +QE             +  ST   LPS  P 
Sbjct: 357 PPPRASVGGSSGKGEGAQWRSAQSPLGLRVQEAPAAYAALYAASADSGSTAAHLPS-PPQ 415

Query: 389 YSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFN 448
            +    P    ++    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++   +
Sbjct: 416 DAAGGLPPTAPDSGVPPLGYAIAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKSAHD 475

Query: 449 STKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKN 508
              + +Q LL P  + + E +        + L  LG +  R GP ++ +R IPA+L++  
Sbjct: 476 GIGLHTQPLLVPITLAVGERDADTAEREAQTLAALGFEVTRSGPQSLHVRSIPALLAQAE 535

Query: 509 IPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNP 568
              LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME   
Sbjct: 536 PEALLRDVLTDLREHGHSGRVAGARDALLSTMACHGAVRANRRLTLPEMNALLRDMEATE 595

Query: 569 NSSQCNHGRPTFIKLKLSDIEKLFGR 594
            S QCNHGRPT+ +  L++I++ F R
Sbjct: 596 RSGQCNHGRPTWARFTLAEIDRWFLR 621


>gi|21231736|ref|NP_637653.1| DNA mismatch repair protein [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66768138|ref|YP_242900.1| DNA mismatch repair protein [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188991275|ref|YP_001903285.1| DNA mismatch repair protein [Xanthomonas campestris pv. campestris
           str. B100]
 gi|25090745|sp|Q8P8E4|MUTL_XANCP RecName: Full=DNA mismatch repair protein mutL
 gi|81305885|sp|Q4UVP3|MUTL_XANC8 RecName: Full=DNA mismatch repair protein mutL
 gi|229486329|sp|B0RRZ8|MUTL_XANCB RecName: Full=DNA mismatch repair protein mutL
 gi|21113440|gb|AAM41577.1| DNA mismatch repair protein [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66573470|gb|AAY48880.1| DNA mismatch repair protein [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|167733035|emb|CAP51233.1| DNA mismatch repair protein MutL [Xanthomonas campestris pv.
           campestris]
          Length = 624

 Score =  426 bits (1095), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 224/626 (35%), Positives = 349/626 (55%), Gaps = 36/626 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    +I DNG
Sbjct: 1   MAIRQLPEILINQIAAGEVVERPASVVKELVENALDAGATRVDIDLEEGGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  EE+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TL SR P    G
Sbjct: 61  GGIAPEELPLAVSRHATSKIASLDDLETVATLGFRGEALPSIASVSRFTLASRRPDAEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           + + I G ++  V P A  PGT VEVR+LFF +PAR  FL++E+ E   I + +R +A+A
Sbjct: 121 SALQIEGGRLGEVMPRAHAPGTTVEVRELFFNVPARRKFLRAERTELGHIEEWLRSLALA 180

Query: 179 YPKVSFTFS--TIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
            P V    S     S RYK     ++     R+ + +GEDF   A+ ++     + L G+
Sbjct: 181 RPDVELRVSHNGKPSRRYKPGDLYSDA----RLGETLGEDFARQALRVDHSGAGLRLHGW 236

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
              P ++R + +Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VD
Sbjct: 237 VAQPHYSRASTDQQYLYVNGRSVRDRSVAHAVKMAYGDVLFHGRQPAYVLFLELDPARVD 296

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGIST--------------SSVLSKKMI 342
           VNVHPAK  +RFR   +I +F+ +++Q A+ +                      ++ +  
Sbjct: 297 VNVHPAKHEVRFREARLIHDFVYRTLQDALAQTRAGALPADVGVGGAAALGIGAVAAQGG 356

Query: 343 SSFHQDNA---PKTHLPKYATSLTNTQEKLFLQENRLST-----------NDLLPSDDPT 388
            S+  D     P         S   +Q  L L+ +               + L     P 
Sbjct: 357 GSYVADAGAGHPGAGSGSGYASWAPSQAPLGLRVDEARAAYAALYAPAAGSALRDDGQPV 416

Query: 389 YSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFN 448
            S    P    ++    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++Q  +
Sbjct: 417 LSGTGLPATAHDSGVPPLGYAVAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKQAHD 476

Query: 449 STKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKN 508
           S  + +Q LL P  + + E E        + L  LG +  R GP ++ +R IPA+L+  +
Sbjct: 477 SIGLHAQPLLVPMTLAVGEREADTAEREADTLASLGFEITRSGPQSLHVRSIPALLANAD 536

Query: 509 IPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNP 568
              LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME   
Sbjct: 537 PEALLRDVLGDLREHGQSRRIATARDELLSTMACHGAVRANRRLTVPEMNALLRDMEATE 596

Query: 569 NSSQCNHGRPTFIKLKLSDIEKLFGR 594
            S QCNHGRPT+ +  L +I++ F R
Sbjct: 597 RSGQCNHGRPTWARFTLGEIDRWFLR 622


>gi|71275150|ref|ZP_00651437.1| DNA mismatch repair protein [Xylella fastidiosa Dixon]
 gi|71898231|ref|ZP_00680405.1| DNA mismatch repair protein [Xylella fastidiosa Ann-1]
 gi|170731141|ref|YP_001776574.1| DNA mismatch repair protein [Xylella fastidiosa M12]
 gi|238687954|sp|B0U5C6|MUTL_XYLFM RecName: Full=DNA mismatch repair protein mutL
 gi|71163959|gb|EAO13674.1| DNA mismatch repair protein [Xylella fastidiosa Dixon]
 gi|71731970|gb|EAO34027.1| DNA mismatch repair protein [Xylella fastidiosa Ann-1]
 gi|167965934|gb|ACA12944.1| DNA mismatch repair protein MutL [Xylella fastidiosa M12]
          Length = 621

 Score =  426 bits (1095), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 222/628 (35%), Positives = 352/628 (56%), Gaps = 43/628 (6%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN++DA ++RV+  +   G    +I DNG
Sbjct: 1   MPIRQLPEILINQIAAGEVVERPASVVKELVENAIDAGATRVDIELEAAGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            GM ++E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TLMSR   +  G
Sbjct: 61  HGMAAQELPLAVLRHATSKIASLDDLEAVATLGFRGEALPSIASVSRFTLMSRRATDEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           A + I G  +  V P A  PGT VEVR+LF+ +PAR  FL++E+ E   I +  R +A+A
Sbjct: 121 AVLQIEGGTLGEVIPHAHAPGTTVEVRELFYNVPARRKFLRAERTELGHIEEWARSLALA 180

Query: 179 YPKVSFTFS--TIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
           +P +    S     S RYK     ++     R+ +++GEDF + A+ ++     + L G 
Sbjct: 181 HPDLELRLSHNGKLSRRYKPGDWYSDA----RLIEILGEDFAHQALRVDHSGAGLRLHGC 236

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
              P ++R NA+Q Y+++NGR V+D+ +   ++ AY++ +  GR+P  VL LE+DP +VD
Sbjct: 237 IVQPHYSRLNADQQYLYVNGRPVRDRSVAHAVKQAYSDVLYQGRHPAYVLFLELDPARVD 296

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVL------------------- 337
           VNVHPAK  +RFR+  +I +F+ +++Q  + +    T  +                    
Sbjct: 297 VNVHPAKHEVRFRDARLIHDFVYRTVQGTLAQTRAGTPPLAVGVGDVEGEGEGARPPGRH 356

Query: 338 ----------SKKMISSFHQDNAPKTH-LPKYATSLTNTQEKLFLQENRLSTNDLLPSDD 386
                     +  ++ S+    AP    +P  + +                  D +P   
Sbjct: 357 AVSFSGRRGGASHVLGSYSTSTAPLMQGVPSVSVADAPAAYAALYAAPPTQVMDAVPQ-- 414

Query: 387 PTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQD 446
               +   P+         LG A AQ+H  YI+++  DGL++VD HAAHER+ +E++++ 
Sbjct: 415 ---MQTGLPLAAGAGDVPPLGYAIAQLHGIYILAECADGLIVVDMHAAHERIGYERLKRA 471

Query: 447 FNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSK 506
            +   + +Q LL P  + + E E  +     E L  LG +  R GP ++ +R IPA+LS+
Sbjct: 472 HDGIGLRTQPLLVPMTLMVAEREADVAECEAETLASLGFEVTRSGPGSLQVRSIPALLSQ 531

Query: 507 KNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEK 566
                LLRD++ ++ +   T  + +  + +LATMAC+G++R+ R++   EMN LLR+ME 
Sbjct: 532 AEPEMLLRDVLSDLSEHGHTRRVAEARDTLLATMACHGAVRAHRRLSISEMNALLRDMEA 591

Query: 567 NPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
              S QCNHGRPT+ +  L++I++ F R
Sbjct: 592 TERSGQCNHGRPTWARFSLAEIDRWFLR 619


>gi|326403389|ref|YP_004283470.1| DNA mismatch repair protein MutL [Acidiphilium multivorum AIU301]
 gi|325050250|dbj|BAJ80588.1| DNA mismatch repair protein MutL [Acidiphilium multivorum AIU301]
          Length = 582

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 223/597 (37%), Positives = 341/597 (57%), Gaps = 20/597 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L    IN+IAAGE+IERP+ A+KEL+EN+LDA + R+   I GGG    ++TD+G
Sbjct: 1   MPIRRLDPTTINRIAAGEVIERPAAAVKELVENALDAGARRIGVTIEGGGIGRIEVTDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            G+   E+P+A++RH TSK++D+    I T GFRGEALPSIGA   LT+ SRP   ++ A
Sbjct: 61  HGIPEAELPLAIERHATSKLTDEALVRIATLGFRGEALPSIGAAGRLTVTSRPAGQDSAA 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +I + G  +  V PVA   GT V V DLF   PAR  FL+S   E     D +R +A+A 
Sbjct: 121 RIVVDGGAVREVEPVAGPVGTCVTVEDLFHATPARRKFLRSAGAEAGSCADAVRHLALAA 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V F+ +   +  + +  Q       ER++ + G       +E+     E+ L+G+   
Sbjct: 181 PAVGFSLTIDGAASFDLPPQDRR----ERVAAIYGRADAEKLLEIEAVREEVALRGFISP 236

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
            +  R  A   ++ +NGR V+D  +   +R AY E IP GR+P+  L LEI    +DVNV
Sbjct: 237 ASLTRAAARHQHMVVNGRPVRDPLLRMALRLAYRERIPAGRHPLAALWLEIPAEMLDVNV 296

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HPAK+ +RF  P  +R+ +I ++Q+A+     + + + +   +S      A  + +P+Y 
Sbjct: 297 HPAKAELRFAAPDAVRSLMIGAVQRALA----TPADLAAAPSVSMPRTSWAASSPMPRYP 352

Query: 360 TSLTNTQEKLFLQENRLSTNDLLPSD-DPTYSEDNDPVEESEATHYQLGIACAQIHQNYI 418
            +   ++      E  L   DL P+   P    ++ P        Y LG   AQ+   YI
Sbjct: 353 QA--ESRAARGFAEAELRGLDLPPARVAPEVLPESRP-------DYPLGTPIAQVFDTYI 403

Query: 419 ISQTTDG-LVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHD 477
           ++Q+ DG LV+VDQHAAHERL   ++R + +S  I +Q LL P +++L   + A ++   
Sbjct: 404 LAQSGDGTLVLVDQHAAHERLTEIRLRAERDSGAIPAQALLAPSVVELPAEDIARLLGAA 463

Query: 478 EDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENIL 537
           E L  LG++ E FGP A+ +R +PA L+K +   L RD+ D + +S T   L+ +++ +L
Sbjct: 464 ERLAGLGLEIEAFGPGAVLVRAVPAALAKADPAALARDVADTLAESGTATALEAKLDAVL 523

Query: 538 ATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
             MAC+ S+R+GR++   EM  LLR ME  P +  C HGRPT ++L   D+E++FGR
Sbjct: 524 IRMACHRSVRAGRRLAFAEMEALLRAMETTPLAQTCPHGRPTVLRLSRGDLERMFGR 580


>gi|148259642|ref|YP_001233769.1| DNA mismatch repair protein MutL [Acidiphilium cryptum JF-5]
 gi|166231100|sp|A5FW68|MUTL_ACICJ RecName: Full=DNA mismatch repair protein mutL
 gi|146401323|gb|ABQ29850.1| DNA mismatch repair protein MutL [Acidiphilium cryptum JF-5]
          Length = 582

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 223/597 (37%), Positives = 341/597 (57%), Gaps = 20/597 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L    IN+IAAGE+IERP+ A+KEL+EN+LDA + R+   I GGG    ++TD+G
Sbjct: 1   MPIRRLDPTTINRIAAGEVIERPAAAVKELVENALDAGARRIGVTIEGGGIGRIEVTDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            G+   E+P+A++RH TSK++D+    I T GFRGEALPSIGA   LT+ SRP   ++ A
Sbjct: 61  HGIPEAELPLAIERHATSKLTDEALVRIATLGFRGEALPSIGAAGRLTVTSRPAGQDSAA 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +I + G  +  V PVA   GT V V DLF   PAR  FL+S   E     D +R +A+A 
Sbjct: 121 RIVVDGGAVREVEPVAGPVGTCVTVEDLFHATPARRKFLRSAGSEAGSCADAVRHLALAA 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V F+ +   +  + +  Q       ER++ + G       +E+     E+ L+G+   
Sbjct: 181 PAVGFSLTIDGAASFDLPPQDRR----ERVAAIYGRADAEKLLEIEAVREEVALRGFISP 236

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
            +  R  A   ++ +NGR V+D  +   +R AY E IP GR+P+  L LEI    +DVNV
Sbjct: 237 ASLTRAAARHQHMVVNGRPVRDPLLRMALRLAYRERIPAGRHPLAALWLEIPAEMLDVNV 296

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HPAK+ +RF  P  +R+ +I ++Q+A+     + + + +   +S      A  + +P+Y 
Sbjct: 297 HPAKAELRFATPDAVRSLMIGAVQRALA----TPADLAAAPSVSMPRTSWAASSPMPRYP 352

Query: 360 TSLTNTQEKLFLQENRLSTNDLLPSD-DPTYSEDNDPVEESEATHYQLGIACAQIHQNYI 418
            +   ++      E  L   DL P+   P    ++ P        Y LG   AQ+   YI
Sbjct: 353 QA--ESRAARGFAEAELRGLDLPPARVAPEVLPESRP-------DYPLGTPIAQVFDTYI 403

Query: 419 ISQTTDG-LVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHD 477
           ++Q+ DG LV+VDQHAAHERL   ++R + +S  I +Q LL P +++L   + A ++   
Sbjct: 404 LAQSGDGTLVLVDQHAAHERLTEIRLRAERDSGAIPAQALLAPSVVELPAEDIARLLGAA 463

Query: 478 EDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENIL 537
           E L  LG++ E FGP A+ +R +PA L+K +   L RD+ D + +S T   L+ +++ +L
Sbjct: 464 ERLAGLGLEIEAFGPGAVLVRAVPAALAKADPAALARDVADTLAESGTAMALEAKLDAVL 523

Query: 538 ATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
             MAC+ S+R+GR++   EM  LLR ME  P +  C HGRPT ++L   D+E++FGR
Sbjct: 524 IRMACHRSVRAGRRLAFAEMEALLRAMETTPLAQTCPHGRPTVLRLSRGDLERMFGR 580


>gi|28199765|ref|NP_780079.1| DNA mismatch repair protein [Xylella fastidiosa Temecula1]
 gi|28057886|gb|AAO29728.1| DNA mismatch repair protein MutL [Xylella fastidiosa Temecula1]
          Length = 621

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 218/624 (34%), Positives = 351/624 (56%), Gaps = 37/624 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN++DA ++RV+  +   G    +I DNG
Sbjct: 3   MPIRQLPEILINQIAAGEVVERPASVVKELVENAIDAGATRVDIELEAAGVRLIRIRDNG 62

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            GM ++E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TLMSR   +  G
Sbjct: 63  HGMAAQELPLAVLRHATSKIASLDDLEAVATLGFRGEALPSIASVSRFTLMSRRATDEHG 122

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           A + I G  +  V P A  PGT VEVR+LF+ +PAR  FL++E+ E   I +  R +A+A
Sbjct: 123 AVLQIEGGTLGEVIPHAHAPGTTVEVRELFYNVPARRKFLRAERTELGHIEEWARSLALA 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +P +    S   + +    ++  +     R+ +++GEDF + A+ ++     + L G   
Sbjct: 183 HPDLELRLS--HNGKLSRRYKPGDWYSDVRLIEILGEDFAHQALRVDHSGAGLRLHGCIV 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P ++R NA+Q Y+++NGR V+D+ +   ++ AY++ +  GR+P  VL LE+DP +VDVN
Sbjct: 241 QPHYSRLNADQQYLYVNGRPVRDRSVAHAVKQAYSDVLYQGRHPAYVLFLELDPARVDVN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVL--------------------- 337
           VHPAK  +RFR+  +I +F+ +++Q  + +    T  +                      
Sbjct: 301 VHPAKHEVRFRDARLIHDFVYRTVQGTLAQTRAGTPPLAVGVGDVEGEGARPPGRHAVSF 360

Query: 338 ------SKKMISSFHQDNAPKTH-LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYS 390
                 +  ++ S+    AP    +P  + +                  D +P       
Sbjct: 361 SGRRGGASHVLGSYSASTAPLMQGVPSVSVADAPAAYAALYAAPPTQVMDAVPQ-----M 415

Query: 391 EDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST 450
           +   P+         LG A AQ+H  YI+++  DGL++VD HAAHER+ +E++++  +  
Sbjct: 416 QTGLPLAAGAGDVPLLGYAIAQLHGIYILAECADGLIVVDMHAAHERIGYERLKRAHDGI 475

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
            + +Q LL P  + + E E  +     E L  LG +  R GP ++ +R IPA+LS+    
Sbjct: 476 GLRTQPLLVPMTLMVAEREADVAECEAETLANLGFEVTRSGPGSLQVRSIPALLSQAEPE 535

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
            LLRD++ ++ +   T  + +  + +LATMAC+G++R+ R++   EMN LLR+ME    S
Sbjct: 536 MLLRDVLSDLSEHGHTRRVAEARDTLLATMACHGAVRAHRRLSISEMNALLRDMEATERS 595

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
            QCNHGRPT+ +  L++I++ F R
Sbjct: 596 GQCNHGRPTWARFSLAEIDRWFLR 619


>gi|182682515|ref|YP_001830675.1| DNA mismatch repair protein [Xylella fastidiosa M23]
 gi|32129762|sp|Q87AC9|MUTL_XYLFT RecName: Full=DNA mismatch repair protein mutL
 gi|238691108|sp|B2I9E6|MUTL_XYLF2 RecName: Full=DNA mismatch repair protein mutL
 gi|182632625|gb|ACB93401.1| DNA mismatch repair protein MutL [Xylella fastidiosa M23]
 gi|307578792|gb|ADN62761.1| DNA mismatch repair protein [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 619

 Score =  425 bits (1092), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 218/624 (34%), Positives = 351/624 (56%), Gaps = 37/624 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN++DA ++RV+  +   G    +I DNG
Sbjct: 1   MPIRQLPEILINQIAAGEVVERPASVVKELVENAIDAGATRVDIELEAAGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            GM ++E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TLMSR   +  G
Sbjct: 61  HGMAAQELPLAVLRHATSKIASLDDLEAVATLGFRGEALPSIASVSRFTLMSRRATDEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           A + I G  +  V P A  PGT VEVR+LF+ +PAR  FL++E+ E   I +  R +A+A
Sbjct: 121 AVLQIEGGTLGEVIPHAHAPGTTVEVRELFYNVPARRKFLRAERTELGHIEEWARSLALA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +P +    S   + +    ++  +     R+ +++GEDF + A+ ++     + L G   
Sbjct: 181 HPDLELRLS--HNGKLSRRYKPGDWYSDVRLIEILGEDFAHQALRVDHSGAGLRLHGCIV 238

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P ++R NA+Q Y+++NGR V+D+ +   ++ AY++ +  GR+P  VL LE+DP +VDVN
Sbjct: 239 QPHYSRLNADQQYLYVNGRPVRDRSVAHAVKQAYSDVLYQGRHPAYVLFLELDPARVDVN 298

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVL--------------------- 337
           VHPAK  +RFR+  +I +F+ +++Q  + +    T  +                      
Sbjct: 299 VHPAKHEVRFRDARLIHDFVYRTVQGTLAQTRAGTPPLAVGVGDVEGEGARPPGRHAVSF 358

Query: 338 ------SKKMISSFHQDNAPKTH-LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYS 390
                 +  ++ S+    AP    +P  + +                  D +P       
Sbjct: 359 SGRRGGASHVLGSYSASTAPLMQGVPSVSVADAPAAYAALYAAPPTQVMDAVPQ-----M 413

Query: 391 EDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST 450
           +   P+         LG A AQ+H  YI+++  DGL++VD HAAHER+ +E++++  +  
Sbjct: 414 QTGLPLAAGAGDVPLLGYAIAQLHGIYILAECADGLIVVDMHAAHERIGYERLKRAHDGI 473

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
            + +Q LL P  + + E E  +     E L  LG +  R GP ++ +R IPA+LS+    
Sbjct: 474 GLRTQPLLVPMTLMVAEREADVAECEAETLANLGFEVTRSGPGSLQVRSIPALLSQAEPE 533

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
            LLRD++ ++ +   T  + +  + +LATMAC+G++R+ R++   EMN LLR+ME    S
Sbjct: 534 MLLRDVLSDLSEHGHTRRVAEARDTLLATMACHGAVRAHRRLSISEMNALLRDMEATERS 593

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
            QCNHGRPT+ +  L++I++ F R
Sbjct: 594 GQCNHGRPTWARFSLAEIDRWFLR 617


>gi|71901139|ref|ZP_00683245.1| DNA mismatch repair protein [Xylella fastidiosa Ann-1]
 gi|71729103|gb|EAO31228.1| DNA mismatch repair protein [Xylella fastidiosa Ann-1]
          Length = 621

 Score =  425 bits (1092), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 222/628 (35%), Positives = 352/628 (56%), Gaps = 43/628 (6%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN++DA ++RV+  +   G    +I DNG
Sbjct: 1   MPIRQLPEILINQIAAGEVVERPASVVKELVENAIDAGATRVDIELEAAGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            GM ++E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TLMSR   +  G
Sbjct: 61  HGMAAQELPLAVLRHATSKIASLDDLEAVATLGFRGEALPSIASVSRFTLMSRRATDEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           A + I G  +  V P A  PGT VEVR+LF+ +PAR  FL++E+ E   I +  R +A+A
Sbjct: 121 AVLQIEGGTLGEVIPHAHAPGTTVEVRELFYNVPARRKFLRAERTELGHIEEWARSLALA 180

Query: 179 YPKVSFTFS--TIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
           +P +    S     S RYK     ++     R+ +++GEDF + A+ ++     + L G 
Sbjct: 181 HPDLELRLSHNGKLSRRYKPGDWYSDA----RLIEILGEDFAHQALPVDHSGAGLRLHGC 236

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
              P ++R NA+Q Y+++NGR V+D+ +   ++ AY++ +  GR+P  VL LE+DP +VD
Sbjct: 237 IVQPHYSRLNADQQYLYVNGRPVRDRSVAHAVKQAYSDVLYQGRHPAYVLFLELDPARVD 296

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVL------------------- 337
           VNVHPAK  +RFR+  +I +F+ +++Q  + +    T  +                    
Sbjct: 297 VNVHPAKHEVRFRDARLIHDFVYRTVQGTLAQTRAGTPPLAVGVGDVEGEGEGARPPGRH 356

Query: 338 ----------SKKMISSFHQDNAPKTH-LPKYATSLTNTQEKLFLQENRLSTNDLLPSDD 386
                     +  ++ S+    AP    +P  + +                  D +P   
Sbjct: 357 AVSFSGRRGGASHVLGSYSASTAPLMQGVPSVSVADAPAAYAALYAAPPTQVMDAVPQ-- 414

Query: 387 PTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQD 446
               +   P+         LG A AQ+H  YI+++  DGL++VD HAAHER+ +E++++ 
Sbjct: 415 ---MQTGLPLAAGAGDVPPLGYAIAQLHGIYILAECADGLIVVDMHAAHERIGYERLKRA 471

Query: 447 FNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSK 506
            +   + +Q LL P  + + E E  +     E L  LG +  R GP ++ +R IPA+LS+
Sbjct: 472 HDGIGLRTQPLLVPMTLMVAEREADVAECEAETLANLGFEVTRSGPGSLQVRSIPALLSQ 531

Query: 507 KNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEK 566
                LLRD++ ++ +   T  + +  + +LATMAC+G++R+ R++   EMN LLR+ME 
Sbjct: 532 AEPEMLLRDVLSDLSEHGHTRRVAEARDTLLATMACHGAVRAHRRLSISEMNALLRDMEA 591

Query: 567 NPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
              S QCNHGRPT+ +  L++I++ F R
Sbjct: 592 TERSGQCNHGRPTWARFSLAEIDRWFLR 619


>gi|330994147|ref|ZP_08318075.1| DNA mismatch repair protein mutL [Gluconacetobacter sp. SXCC-1]
 gi|329758614|gb|EGG75130.1| DNA mismatch repair protein mutL [Gluconacetobacter sp. SXCC-1]
          Length = 620

 Score =  424 bits (1091), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 223/614 (36%), Positives = 357/614 (58%), Gaps = 28/614 (4%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+LSE+++N+IAAGE+IERP+ A+KEL+EN++D+ + R+   +  GG     ++D+G G
Sbjct: 12  IRRLSEQVVNRIAAGEVIERPAAALKELVENAVDSGARRIHIRLDRGGIDRIDVSDDGCG 71

Query: 63  MTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M+ +++ +AV+RHCTSK+ D+   +I T GFRGEALPSIGA + L++MSR    ++   I
Sbjct: 72  MSPDDLLLAVERHCTSKLRDETLVHISTLGFRGEALPSIGAAARLSVMSRQAGADSAWSI 131

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            + G  +S+  P A  PGT V V DLFF  PAR  FLKS +VE+    +V+RR+A++ P 
Sbjct: 132 RVEGGVVSTPEPCAGAPGTRVLVEDLFFATPARRKFLKSPRVESGHAENVVRRLALSAPH 191

Query: 182 VSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPT 241
           ++F       +R  ++  +   +   R++ ++     +  + +  +  ++ L GY   P+
Sbjct: 192 IAFRLEF--DDRLILDLPAQ--DRAARVAAILESGDADGLLAVEGQRGDLKLSGYICAPS 247

Query: 242 FNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHP 301
            +R  AN   + +NGR V D  + + +R AY   +  GR+ VV L LEI P QVDVNVHP
Sbjct: 248 VHRATANGQMLLVNGRPVVDPVLRTAVRVAYRNVMEHGRHAVVALSLEIPPEQVDVNVHP 307

Query: 302 AKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYATS 361
           AK+ +R+ +   +R  +I ++ +A+   G   + V    +I S     A   + P+    
Sbjct: 308 AKTELRYADSAAVRALVIGALGRALG-TGAGVAGV-RPDLIQSRGSSPARIWYPPERNAD 365

Query: 362 LTNTQEKLF---------------LQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQL 406
             +   +L                  E+ L    L  +        +D    + A  + L
Sbjct: 366 AADLSTRLARPLVPARPDSGLPSGFAESSLPLAGLPAARQTAPDTLHDQAATTAAMAHPL 425

Query: 407 GIACAQIHQNYIISQTTDG-LVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDL 465
           G A AQ+   YI+SQT DG LV+VDQHAAHERL  E +R+ +   +I +Q LL PE++DL
Sbjct: 426 GAAVAQVLGTYIVSQTADGALVLVDQHAAHERLTHEILREQYMGGEIRAQRLLLPEVVDL 485

Query: 466 LEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDI-----IDEI 520
              +  +++     L RLG++ E FG  A+ +R +PA+L K+N   +LRD+      D++
Sbjct: 486 PARQVDVLLSFGAALARLGVEIEPFGGTAVLVRAMPALLGKENPGGMLRDLAEELEADDL 545

Query: 521 IDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTF 580
              +    L  R++ ++A MAC+GS+R+GR++   EMN LLR+ME+ P +  C+HGRPT+
Sbjct: 546 ASPAQADALDARMDAVIARMACHGSVRAGRRLTHEEMNALLRDMERTPRAGTCSHGRPTW 605

Query: 581 IKLKLSDIEKLFGR 594
           +KL+ +DIE++FGR
Sbjct: 606 LKLEKADIERMFGR 619


>gi|21243139|ref|NP_642721.1| DNA mismatch repair protein [Xanthomonas axonopodis pv. citri str.
           306]
 gi|25090749|sp|Q8PJX2|MUTL_XANAC RecName: Full=DNA mismatch repair protein mutL
 gi|21108659|gb|AAM37257.1| DNA mismatch repair protein MutL [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 625

 Score =  424 bits (1091), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 230/628 (36%), Positives = 357/628 (56%), Gaps = 39/628 (6%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    +I DNG
Sbjct: 1   MAIRQLPEILINQIAAGEVVERPASVVKELVENALDAGATRVDIELEEGGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+T +E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TL SR      G
Sbjct: 61  GGITPDELPLAVSRHATSKIASLDDLETVATLGFRGEALPSIASVSRFTLTSRRHDAEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           + + I G ++  V P A  PGT VEVR+LFF +PAR  FL++E+ E   I + +R +A+A
Sbjct: 121 SALEIDGGRLGEVVPRAHAPGTTVEVRELFFNVPARRKFLRAERTELGHIEEWLRSLALA 180

Query: 179 YPKVSFTFS--TIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
            P V    S     S RYK     ++     R+ + +G+DF   A+ ++     + L G+
Sbjct: 181 RPDVELRVSHNGKPSRRYKPGDLYSDA----RLGETLGDDFARQALRVDHSGAGLRLHGW 236

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
              P ++R + +Q Y+++NGR+V+++ +   ++ AY + +  GR P  VL LE+DP +VD
Sbjct: 237 VAQPHYSRASTDQQYLYVNGRSVRERSVAHAVKMAYGDVLFHGRQPAYVLFLELDPARVD 296

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAI--NKKGISTSSV----LSKKMISSFHQDNA 350
           VNVHPAK  +RFR   +I +F+ +++Q A+   + G + +S+          +S      
Sbjct: 297 VNVHPAKHEVRFREARLIHDFVYRTLQDALAHTRAGATPNSIGGDGTGYTAATSGGMGGI 356

Query: 351 PKTHLP-------------KYATSLTNTQEKLFLQ--ENRLSTNDLL---PSDD------ 386
               +P              YA S T +Q  L L+  E R + + L    PS        
Sbjct: 357 ASGGVPGNGGASIGSGGAYSYA-SWTPSQTPLGLRVDEARAAYSALYAPPPSSAQQSAGM 415

Query: 387 PTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQD 446
           P  +    P    ++    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++  
Sbjct: 416 PNMAGTGLPATAQDSGVPPLGYAIAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKHA 475

Query: 447 FNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSK 506
            +S  + +Q LL P  + + E E        E L  LG +  R GP ++ +R IPA+L+ 
Sbjct: 476 HDSIGLHAQPLLVPMTLAVGEREADTAEREAETLATLGFEITRAGPQSLHVRSIPALLAN 535

Query: 507 KNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEK 566
                LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME 
Sbjct: 536 AEPEALLRDVLSDLREHGQSRRIASARDELLSTMACHGAVRANRRLTVPEMNALLRDMEA 595

Query: 567 NPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
              S QCNHGRPT+ +  LSDI++ F R
Sbjct: 596 TERSGQCNHGRPTWARFTLSDIDRWFLR 623


>gi|325923187|ref|ZP_08184872.1| DNA mismatch repair protein MutL [Xanthomonas gardneri ATCC 19865]
 gi|325546332|gb|EGD17501.1| DNA mismatch repair protein MutL [Xanthomonas gardneri ATCC 19865]
          Length = 620

 Score =  424 bits (1091), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 224/622 (36%), Positives = 355/622 (57%), Gaps = 32/622 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L + +INQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    +I DNG
Sbjct: 1   MAIRQLPDILINQIAAGEVVERPASVVKELVENALDAGATRVDIELEEGGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  +E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TL+SR      G
Sbjct: 61  GGIPPDELPLAVSRHATSKIASLDDLETVATLGFRGEALPSIASVSRFTLVSRRHDAEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           + + I G ++  V P A  PGT VEVR+LF+ +PAR  FL++E+ E   I + +R +A+A
Sbjct: 121 SALEIEGGRLGEVTPRAHAPGTTVEVRELFYNVPARRKFLRAERTELGHIEEWLRSLALA 180

Query: 179 YPKVSF--TFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
            P V      +   S RYK     ++     R+ + +GEDF   A+ ++     + L G+
Sbjct: 181 RPDVELRVAHNGKPSRRYKPGDLYSDA----RLGETLGEDFTRQALRVDHSGAGLRLHGW 236

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
              P ++R + +Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VD
Sbjct: 237 VAQPHYSRASTDQQYLYVNGRSVRDRSVAHAVKMAYGDVLFHGRQPAYVLFLELDPARVD 296

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKA------------INKKGISTSSVLSKKMISS 344
           VNVHPAK  +RFR   +I +F+ +++Q A            I  +G S +      M ++
Sbjct: 297 VNVHPAKHEVRFREARLIHDFVYRTLQDALAHTRAGAMPNSIGTEGTSDTGAAPSGMANT 356

Query: 345 FHQDNAPKTHLPKYATSLTNTQEKLFLQ--ENRLSTNDLL--PSDDP--------TYSED 392
            +   A  +       + T +Q  L L+  E R + + L   PS           T+S  
Sbjct: 357 PNYGGATGSGGGTGYGNWTPSQTPLGLRVDEARAAYSALYAPPSGSAQQQSAAMQTFSGT 416

Query: 393 NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
             P    ++    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++   +S  +
Sbjct: 417 GLPATSHDSGVPPLGYAVAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKNAHDSIGL 476

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
            +Q LL P  + + E E        + L  LG +  R GP ++ +R IPA+L+      L
Sbjct: 477 HAQPLLVPMTLAVGEREADTAEREADTLASLGFEITRAGPQSLHVRSIPALLANAEPEAL 536

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           LRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME    S Q
Sbjct: 537 LRDVLGDLREHGQSRRIATARDELLSTMACHGAVRANRRLSVPEMNALLRDMEATERSGQ 596

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT+ +  L +I++ F R
Sbjct: 597 CNHGRPTWARFTLGEIDRWFLR 618


>gi|15837362|ref|NP_298050.1| DNA mismatch repair protein [Xylella fastidiosa 9a5c]
 gi|20455160|sp|Q9PFB8|MUTL_XYLFA RecName: Full=DNA mismatch repair protein mutL
 gi|9105652|gb|AAF83570.1|AE003917_4 DNA mismatch repair protein MutL [Xylella fastidiosa 9a5c]
          Length = 619

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 220/626 (35%), Positives = 350/626 (55%), Gaps = 41/626 (6%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE+++RP+  +KEL+EN++DA ++RV+  +   G    +I DNG
Sbjct: 1   MPIRQLPEILINQIAAGEVVQRPASVVKELVENAIDAGATRVDIELEAAGGRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            GM ++E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TLMSR   +  G
Sbjct: 61  HGMAAQELPLAVLRHATSKIASLDDLEAVATLGFRGEALPSIVSVSRFTLMSRRAMDEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           A + I G  +  V P A  PGT VEVRDLF+ +PAR  FL++E+ E   I +  R +A+A
Sbjct: 121 AVLQIEGGTLGEVIPHAHAPGTTVEVRDLFYNVPARRKFLRAERTELGHIEEWARSLALA 180

Query: 179 YPKVSFTFS--TIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
           +P +    S     S RYK     ++     R+ +++GEDF + A+ ++     + L G 
Sbjct: 181 HPDLELRLSHNGKLSRRYKPGDWYSDA----RLIEILGEDFAHQALRVDHSGAGLRLHGC 236

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
              P ++R N +Q Y+++NGR V+D+ +   ++ AY++ +  GR+P  VL LE+DP +VD
Sbjct: 237 IVQPHYSRSNTDQQYLYVNGRAVRDRSVAHAVKQAYSDVLYQGRHPAYVLFLELDPARVD 296

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVL------------------- 337
           VNVHPAK  +RFR+  +I +F+ +++Q  + +    T  +                    
Sbjct: 297 VNVHPAKQEVRFRDARLIHDFVYRTVQGTLAQTRAGTPPLAVGAGDVGGEGARPPVRHAV 356

Query: 338 --------SKKMISSFHQDNAPKTH-LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPT 388
                   +  ++ S+    AP     P  + +                  D +P     
Sbjct: 357 SFSGRRGGASHVLGSYSASTAPLMQSAPSVSVADAPAAYAALYAAPPTQVIDAVPQ---- 412

Query: 389 YSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFN 448
             +   P+         LG A AQ+H  YI+++  DGL++VD HAAHER+ +E++++  +
Sbjct: 413 -MQTGLPLAAGAGDVPPLGYAIAQLHGIYILAECADGLIVVDMHAAHERIGYERLKRAHD 471

Query: 449 STKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKN 508
              + +Q LL P  + + E E  +     E L  LG +  R GP ++ +R IPA+L++  
Sbjct: 472 GIGLRTQPLLVPMTLMVAEREADVAECEAETLASLGFEVTRSGPGSLQVRSIPALLAQAE 531

Query: 509 IPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNP 568
              LLRD++ ++ +   T  + +  + +LATMAC+G++R+ R++   EMN LLR+ME   
Sbjct: 532 PEILLRDVLSDLSEHGHTRRVAEARDTLLATMACHGAVRAQRRLSISEMNALLRDMEATE 591

Query: 569 NSSQCNHGRPTFIKLKLSDIEKLFGR 594
            S QCNHGRPT+ +  L++I++ F R
Sbjct: 592 RSGQCNHGRPTWARFSLAEIDRWFLR 617


>gi|327482309|gb|AEA85619.1| DNA mismatch repair protein [Pseudomonas stutzeri DSM 4166]
          Length = 625

 Score =  421 bits (1082), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 222/618 (35%), Positives = 353/618 (57%), Gaps = 25/618 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R+E  +  GG    ++ D+G 
Sbjct: 6   RIQLLSPRLANQIAAGEVVERPASVIKELLENSLDSGAGRIEVDVEQGGVKLLRVRDDGC 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+A+ RH TSKI D  D   + + GFRGEAL SI +VS LTL SR    +   
Sbjct: 66  GIPPDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVSRLTLTSRTADASEAW 125

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G ++ + V+P A   GT VEVRDLFF  PAR  FL++E+ E + + +VI+R+A+A
Sbjct: 126 QVETEGREMEARVQPAAHPVGTSVEVRDLFFNTPARRKFLRTEKTEFDHLQEVIKRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++  + +     R++ V G  F+  A+ +  + N + L G+ G
Sbjct: 186 RFDVAFHLRHNGKGVLALHQANDDSARARRVAAVCGPAFLEQALPIEIERNGLRLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y ++NGR V+DK +   +R AY + +  GR+P  VL L++DP  VDVN
Sbjct: 246 LPTFSRSQADLQYFYVNGRMVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLDVDPAVVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAIN-----KKGISTSSVLSKKMISSFHQDN-APK 352
           VHP K  +RFR+  ++ +F+  ++ +A+       +  + +SV     +S       A +
Sbjct: 306 VHPTKHEVRFRDSRMVHDFLYGTLHRALGDVRPEDQLAAPASVAPMTQVSGLAAGEFAGQ 365

Query: 353 THLPKYATSLTNTQEK--------LFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHY 404
           + +   A+ L   Q +           Q  R ++          Y E   P+ ES A   
Sbjct: 366 SEMSLSASVLERPQGETSAWRGAGAGYQAPRPASAGYTAEAQGAYREFFTPLPESAAAPL 425

Query: 405 --------QLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQT 456
                    LG A AQ+   YI+++   G+V+VD HAAHER+ +E+++    S  +  Q 
Sbjct: 426 PASQDDVPPLGYALAQLKGVYILAENAQGMVLVDMHAAHERITYERLKTAMASEGLRGQP 485

Query: 457 LLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDI 516
           LL PE I L + E     EH +    LG + +R GP  +AIR+IP++L +    QL+RD+
Sbjct: 486 LLVPESIALSQREADCAEEHAQWFQMLGFELQRLGPETLAIRQIPSLLKQAEATQLVRDV 545

Query: 517 IDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHG 576
           + ++++  T+  +Q  +  +LATMAC+G++R+ R++   EMN LLR+ME    S QCNHG
Sbjct: 546 LADLLEYGTSDRIQAHLNELLATMACHGAVRANRRLTLPEMNALLRDMEHTERSGQCNHG 605

Query: 577 RPTFIKLKLSDIEKLFGR 594
           RPT+ +L + D++KLF R
Sbjct: 606 RPTWTQLGMDDLDKLFLR 623


>gi|88810490|ref|ZP_01125747.1| DNA mismatch repair protein [Nitrococcus mobilis Nb-231]
 gi|88792120|gb|EAR23230.1| DNA mismatch repair protein [Nitrococcus mobilis Nb-231]
          Length = 632

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 215/620 (34%), Positives = 356/620 (57%), Gaps = 28/620 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           +++++L  +++NQIAAGE+IERP+  +KEL+EN+LDA++ R+E V+ GGGK   ++ D+G
Sbjct: 13  IRVQRLPPQLVNQIAAGEVIERPAAVVKELVENALDADAGRIEIVVEGGGKRLIRVRDDG 72

Query: 61  FGMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            GM  E++  AV RH TSKI D  D   I + GFRGEALPSI +V+ LTL +R    + G
Sbjct: 73  VGMGREDLRSAVGRHATSKIRDLIDLERIASLGFRGEALPSIASVARLTLTTRSRAEDHG 132

Query: 119 AQIAI-SGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
            ++ +  GE +  V P    PGT V VRDLF  IPAR  FL+++Q E   I  +++R+A+
Sbjct: 133 WRLELNGGELLDEVAPAPHPPGTSVVVRDLFHNIPARRKFLRTDQTELRHIQGLVKRIAL 192

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           + P V F  +      Y++    T+     R+++++G +F+  ++ L+ ++  + L G+ 
Sbjct: 193 SRPDVGFELNCHGRCNYRLAPTGTSVEQEARLAELLGREFVGQSLVLDAEAAGLRLHGWI 252

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+P+  R   +  Y+++NGR ++D+     IR AYA+ +   ++PV VL L +DP +VDV
Sbjct: 253 GLPSAARAQTDLQYLYLNGRMIRDRLAGHAIRRAYADLLYKEKHPVYVLYLGMDPAEVDV 312

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSS----VLSKKMISSFHQDNAPKT 353
           NVHP+K  +RFR P ++ +F+   + +A+     +          K+      Q+  P  
Sbjct: 313 NVHPSKYEVRFREPRLVYDFLFHQLHRALAHPNGAAEGRRYRAAPKRTCVDSPQEQQPTC 372

Query: 354 HLPKYATSLT-----NTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQ--- 405
           H P + +S+       TQ      E R S  + + + + T+  + D +  S A       
Sbjct: 373 HSP-WQSSIAFPVAEATQLYAAAGEAR-SAGEPIGNGESTWGSEGDSLALSRALPQHPVP 430

Query: 406 -----------LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITS 454
                      LG A AQ+H  Y++S+   GL++VD HAAHER+++E+++ + +   +  
Sbjct: 431 AAGRGEEATPPLGYAVAQLHGVYVLSEDAAGLILVDMHAAHERIVYERLKDELDREGLAG 490

Query: 455 QTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLR 514
           Q LL P  + +   E     +      RL  + +R  P+ + +R IPA+L + +I  LLR
Sbjct: 491 QALLVPLRVGVTPAEADAAEDCAALFRRLEFEVDRAAPDVLVVRRIPALLGQIDITALLR 550

Query: 515 DIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCN 574
           D++  ++       L+  I  +LATMAC+GS+R+ R++   EMN LLR+ME+  N  QCN
Sbjct: 551 DVLSGLLIQGVGGQLEAVINQVLATMACHGSVRAQRRLTITEMNALLRDMERTRNIGQCN 610

Query: 575 HGRPTFIKLKLSDIEKLFGR 594
           HGRPT+ +L L+++++LF R
Sbjct: 611 HGRPTWTRLTLAELDRLFLR 630


>gi|146283982|ref|YP_001174135.1| DNA mismatch repair protein [Pseudomonas stutzeri A1501]
 gi|167017345|sp|A4VQP2|MUTL_PSEU5 RecName: Full=DNA mismatch repair protein mutL
 gi|145572187|gb|ABP81293.1| DNA mismatch repair protein MutL [Pseudomonas stutzeri A1501]
          Length = 625

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 222/618 (35%), Positives = 352/618 (56%), Gaps = 25/618 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R+E  +  GG    ++ D+G 
Sbjct: 6   RIQLLSPRLANQIAAGEVVERPASVIKELLENSLDSGAGRIEVDVEQGGVKLLRVRDDGC 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+A+ RH TSKI D  D   + + GFRGEAL SI +VS LTL SR    +   
Sbjct: 66  GIPPDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVSRLTLTSRTADASEAW 125

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G ++ + V+P A   GT VEVRDLFF  PAR  FL++E+ E + + +VI+R+A+A
Sbjct: 126 QVETEGREMEARVQPAAHPVGTSVEVRDLFFNTPARRKFLRTEKTEFDHLQEVIKRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++  + +     R++ V G  F+  A+ +  + N + L G+ G
Sbjct: 186 RFDVAFHLRHNGKGVLALHQANDDSARARRVAAVCGPAFLEQALPIEIERNGLRLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y ++NGR V+DK +   +R AY + +  GR+P  VL L++DP  VDVN
Sbjct: 246 LPTFSRSQADLQYFYVNGRMVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLDVDPAVVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAIN-----KKGISTSSVLSKKMISSFHQDN-APK 352
           VHP K  +RFR+  ++ +F+  ++ +A+       +  + +SV     +S       A +
Sbjct: 306 VHPTKHEVRFRDSRMVHDFLYGTLHRALGDVRPEDQLAAPASVAPMTQVSGLAAGEFAGQ 365

Query: 353 THLPKYATSLTNTQEK--------LFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHY 404
             +   A+ L   Q +           Q  R ++          Y E   P+ ES A   
Sbjct: 366 NEMSLSASVLERPQGETPAWRGAGAGYQAPRPASAGYTAEAQGAYREFFTPLPESAAAPL 425

Query: 405 --------QLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQT 456
                    LG A AQ+   YI+++   G+V+VD HAAHER+ +E+++    S  +  Q 
Sbjct: 426 PASQDDVPPLGYALAQLKGVYILAENAQGMVLVDMHAAHERITYERLKTAMASEGLRGQP 485

Query: 457 LLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDI 516
           LL PE I L + E     EH +    LG + +R GP  +AIR+IP++L +    QL+RD+
Sbjct: 486 LLVPESIALSQREADCAEEHAQWFQMLGFELQRLGPETLAIRQIPSLLKQAEATQLVRDV 545

Query: 517 IDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHG 576
           + ++++  T+  +Q  +  +LATMAC+G++R+ R++   EMN LLR+ME    S QCNHG
Sbjct: 546 LADLLEYGTSDRIQAHLNELLATMACHGAVRANRRLTLPEMNALLRDMEHTERSGQCNHG 605

Query: 577 RPTFIKLKLSDIEKLFGR 594
           RPT+ +L + D++KLF R
Sbjct: 606 RPTWTQLGMDDLDKLFLR 623


>gi|254448141|ref|ZP_05061604.1| 2-polyprenylphenol 6-hydroxylase [gamma proteobacterium HTCC5015]
 gi|198262267|gb|EDY86549.1| 2-polyprenylphenol 6-hydroxylase [gamma proteobacterium HTCC5015]
          Length = 615

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 218/619 (35%), Positives = 355/619 (57%), Gaps = 31/619 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M+I++L  K+INQIAAGE+IERP+  +KEL+ENS+DA ++ V   +  GG    +I DNG
Sbjct: 1   MRIQRLPNKLINQIAAGEVIERPASVVKELLENSIDAGATEVHIDLEQGGLKRIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            GM  EEIPMA++RH TSKI   +D  ++ + GFRGEALPS+ +VSHLT+ S       G
Sbjct: 61  CGMNREEIPMALERHATSKIGSLEDLESVRSMGFRGEALPSMASVSHLTVTSCAEGEEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
             ++   E   +++P A + GT +E+RDLFF +PAR  F+++E+ E      +++R+A+ 
Sbjct: 121 WCVSPETEG-GAMKPAAHSQGTTIELRDLFFNVPARRKFMRTERTEYKHTETLVKRIALG 179

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P +  T         ++          +R++++ G  F+   + +  ++  + LQG+ G
Sbjct: 180 APYLGLTLRHNGKVTCQLRPAGNRAEMEKRVAELCGSAFMEQCLYVEHEAAGLKLQGWVG 239

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y ++NGR V+DK +   ++  Y + +  GR+P  VL LE+DP+ VDVN
Sbjct: 240 LPTFSRSQADLQYFYVNGRIVRDKLVTHAVKQGYQDVLYHGRHPAYVLHLELDPKLVDVN 299

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI--NKKGISTSSVLSKKMISSFHQDNAPKTHLP 356
            HP K  +RFR+  ++ +F+ +++ + +   + G        +  I    Q  A +  L 
Sbjct: 300 AHPTKYEVRFRDGQLVHSFLFRTLHQVLADTRAGSYEGGAAQRDDIHRAGQ-GAEQGGLD 358

Query: 357 KYATSLTNTQEKLFLQENRLSTNDLL-----PSDD-----------PTY-----SEDNDP 395
            ++   T     L + +  +++N  L     PSD            P Y     S + D 
Sbjct: 359 AFS---TQAAMPLRVSDGEMASNAGLGAGAIPSDSRNGSVGGSVIPPEYYRTASSPNPDV 415

Query: 396 VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQ 455
           V E+E  H  LG A AQ+H  Y+++Q   GL+IVD HAAHER+ +EK++  +    I +Q
Sbjct: 416 VAETEQQH-PLGYALAQLHGLYVLAQNQSGLIIVDTHAAHERVTYEKLKAAYEQQGIQTQ 474

Query: 456 TLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRD 515
            LL P  I++ E E  +  EH  +  +LG +  R  P A+ IR++P +L++ +   L+RD
Sbjct: 475 PLLVPVSINVSEAEADMAEEHAAEFLKLGFELSRSAPEALRIRQVPVLLNQADAEALVRD 534

Query: 516 IIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNH 575
           ++ ++     +  +++ +  +L+TMAC+GS+R+ R +   EMN LLREME    S QCNH
Sbjct: 535 VLSDLTAHGHSERIREALNEVLSTMACHGSVRANRLLTLPEMNALLREMEATERSGQCNH 594

Query: 576 GRPTFIKLKLSDIEKLFGR 594
           GRPT+ +L +  ++KLF R
Sbjct: 595 GRPTWTQLTVDQLDKLFMR 613


>gi|90022314|ref|YP_528141.1| DNA mismatch repair protein [Saccharophagus degradans 2-40]
 gi|89951914|gb|ABD81929.1| DNA mismatch repair protein MutL [Saccharophagus degradans 2-40]
          Length = 630

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 223/629 (35%), Positives = 356/629 (56%), Gaps = 39/629 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+KLS ++ NQIAAGE++ERP+  IKEL+ENS+DA + +++  I  GG    ++ DNG 
Sbjct: 3   EIKKLSPRLANQIAAGEVVERPASVIKELVENSVDAGAKQLDVEIENGGVKLMRVRDNGC 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+   ++P+A+ RH TSKI   DD   + T GFRGEAL SI +V+ L L S   Q +T  
Sbjct: 63  GIGKNDLPLALSRHATSKIYHLDDLEAVGTLGFRGEALASISSVARLKLTSNDGQQDTAW 122

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
                G  + + + P A   GT VEVRDLFF  PAR  FL++E+ E + I D+++R+A++
Sbjct: 123 CAQAEGRDMEAELSPAAHPQGTTVEVRDLFFNTPARRKFLRTEKTEYSRIEDILKRIALS 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTN--GNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
             +    FS   + +   N++  N       R++Q+ G  F+ NAV ++     + L G+
Sbjct: 183 --RFELGFSLKNNGKVVHNWRPANSLAEQERRVAQICGPAFMENAVHVDINRTGLRLWGW 240

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
             +PTF+R  A+  + ++NGR ++D+ +   ++ AY + +  GR+P  VL LE+DP  VD
Sbjct: 241 VALPTFSRSQADLQHFYVNGRAIKDRLVAHAVKQAYQDVLYHGRHPAYVLYLELDPANVD 300

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAI----------------------------NK 328
           VNVHP K  +RFR+  ++ +F+  S+ KA+                            + 
Sbjct: 301 VNVHPTKHEVRFRDGRLVHDFLFSSLHKALADVRPSAEQPVTYQQPSIASLSQQQPVQSA 360

Query: 329 KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPT 388
            G++ +S  +     S+H  +           ++ N  E++  Q   L++    PS+   
Sbjct: 361 LGLAGTSNAASNGAGSYHSSSTANYSTAYSPANVGNVSEQI-TQYANLTSPTGSPSNLQY 419

Query: 389 YSEDNDPV---EESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQ 445
            +    PV   +E  A    LG A AQ+   YI+++  +GL++VD HAAHER+ +E+++Q
Sbjct: 420 TNSSQTPVNNLQEDNAEIPPLGYAIAQLKGIYILAENANGLIVVDMHAAHERITYERLKQ 479

Query: 446 DFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILS 505
            F+  ++ SQ LL P  + + E E AL  E      RLG   E  GP  I IR++P IL+
Sbjct: 480 QFDHEQLASQPLLVPLSMAVSEKEAALAEESASLFARLGFTVETAGPETILIRQVPVILN 539

Query: 506 KKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREME 565
           +  +  L+RD++ ++I+  T+  ++  I  IL+TMAC+GS+R+ RK+   EMN LLR+ME
Sbjct: 540 RATVEDLVRDVLADVIEYGTSSRIEHNINEILSTMACHGSVRANRKLTIPEMNSLLRDME 599

Query: 566 KNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
               S QCNHGRPT+ ++ L+ ++KLF R
Sbjct: 600 ATERSGQCNHGRPTWSQMTLAQLDKLFMR 628


>gi|254281638|ref|ZP_04956606.1| DNA mismatch repair protein MutL [gamma proteobacterium NOR51-B]
 gi|219677841|gb|EED34190.1| DNA mismatch repair protein MutL [gamma proteobacterium NOR51-B]
          Length = 605

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 219/611 (35%), Positives = 358/611 (58%), Gaps = 28/611 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR L  +I NQIAAGE+++RP+  +KE +ENSLDA + R++  I  GG    ++ D+G 
Sbjct: 3   RIRSLDPRIANQIAAGEVVDRPASVVKEALENSLDAGARRIDIDIEAGGSQLIRVRDDGL 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++ +A++RH TSKIS  +D   + T GFRGEAL SI +VS +TL S    + +  
Sbjct: 63  GIGRDDLTLALERHATSKISTIEDLEAVATLGFRGEALASIASVSRMTLTSNASDSVSDG 122

Query: 120 QIAIS-GEKIS-SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
             A++ G  +S ++RP     GT +EVRDLF+  PAR  FL++E+ E   I +V+RR A+
Sbjct: 123 CCAVAEGRDMSVTLRPAPHPRGTSLEVRDLFYNTPARRKFLRTEKTEFGHIDEVVRRQAL 182

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           +   VSFT          +     +G    R+S V GE F+   V +  ++  + LQG+ 
Sbjct: 183 SRSDVSFTLRHNNKVVRSLPAADDDGLLLRRLSGVCGEAFMAQCVSIEREAGALMLQGWV 242

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PTF+R  A+  Y F+NGR ++DK +   I+ AY + +  GR+P  VL L + P +VDV
Sbjct: 243 GLPTFSRSQADLQYFFVNGRVIRDKLVSHAIKQAYRDVLFHGRHPAYVLFLSLPPARVDV 302

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAIN--KKGISTSSVLSKKMISSFHQDNAPK--- 352
           NVHP K  +RFR+   + +F+  ++ +A+   + G S  SV +  ++++     AP+   
Sbjct: 303 NVHPTKHEVRFRDGREVHSFLFSTLHRALADIRPGESAPSV-APDIVAALSSGAAPQQAA 361

Query: 353 THLPKYAT---SLTNTQEK----LFLQENRLSTNDLLPSD--DPTYSEDNDPVEESEATH 403
            H+P  A     L   Q+     L+ +    +    LPS   +P   E+  P        
Sbjct: 362 MHIPTPAAVDPELVAAQQSALSALYARPMPAADRGALPSSIAEPDSGEEEVP-------- 413

Query: 404 YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEII 463
             LG A AQ+   YI+++   G+V+VD HAAHER+ +E+++Q    + I  Q LL P+ +
Sbjct: 414 -PLGFALAQLSGVYILAENAHGMVLVDMHAAHERITYERLKQRSADSGIRRQPLLVPQTL 472

Query: 464 DLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDS 523
            +   E  ++ EH   L  +G+  +  G   + +RE+PA+L+  N+ QL+RD++ ++++ 
Sbjct: 473 AVSPREARMVAEHQALLLEMGLVIDGVGEEQVVLRELPAVLAGSNVDQLVRDVLSDLVEY 532

Query: 524 STTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKL 583
            ++  ++   +++L+TMAC+GSIR+ R++   EMN LLR+ME    S QCNHGRPT+++L
Sbjct: 533 GSSERIRGHFDDVLSTMACHGSIRANRRLTITEMNALLRDMEHTERSGQCNHGRPTWVQL 592

Query: 584 KLSDIEKLFGR 594
            L++++KLF R
Sbjct: 593 TLAELDKLFLR 603


>gi|149377526|ref|ZP_01895267.1| DNA mismatch repair protein MutL [Marinobacter algicola DG893]
 gi|149358218|gb|EDM46699.1| DNA mismatch repair protein MutL [Marinobacter algicola DG893]
          Length = 636

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 222/634 (35%), Positives = 358/634 (56%), Gaps = 45/634 (7%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR L+ ++ NQIAAGE++ERP+  +KEL+EN+LDA + RV+  +  GG    ++ D+G G
Sbjct: 4   IRLLTPRLANQIAAGEVVERPASVVKELVENALDAGARRVDIEVEQGGVKLIRVRDDGMG 63

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +   ++P+A+ RH TSKI   +D   + + GFRGEAL SI +VS L L SR  +    ++
Sbjct: 64  IDETDLPLALSRHATSKIENLEDLEAVASLGFRGEALASISSVSRLALTSRTERQEAASR 123

Query: 121 IAISGEKI-SSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           + + G  + +S+ P A   GT VEVRDLFF  PAR  FL++E+ E N + + IRR A++ 
Sbjct: 124 VEVEGRDMDASISPAAHPVGTTVEVRDLFFNTPARRKFLRTEKTEFNHVEECIRRQALSR 183

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
               FT    +     +       +   RI  + G+ FI+NAV ++ ++  + L G+  +
Sbjct: 184 FDTGFTLRHNQRVVQSLRPAENPLDRERRIGSLCGQQFIDNAVVIDAEATGLKLWGWVAL 243

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF+R  A+  Y F+NGR ++D+ +   +R AY + +   R+P  VL LE+DP  VDVNV
Sbjct: 244 PTFSRSQADLQYFFVNGRVIRDRLVAHAVRQAYRDVLYNNRHPAFVLYLEVDPANVDVNV 303

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKT------ 353
           HP K  +RFR+  ++ +FI +++ KA+    +     L   +  S  ++    T      
Sbjct: 304 HPTKHEVRFRDGRLVHDFIFRTLHKALAD--VRPDDHLKGAVAQSHGREAGTATGGFGVQ 361

Query: 354 -------HLPK---YATSLTNTQEKLFLQENRLSTNDLLPSD----------------DP 387
                  H P    +A S  ++    F    R S ++    D                 P
Sbjct: 362 AAMPGVNHQPASEPFADSGGSSPHAGFSGAPRPSQHEWQARDQMAFYQSLNGGGGTGAQP 421

Query: 388 TYSEDND-------PVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIF 440
             ++  D       P ++S +    LG A AQ+H  YI++Q+  G+++VD HAAHER+ +
Sbjct: 422 AMADSGDLAVAAPTPPQDS-SDEPPLGYAIAQLHGIYILAQSRQGMIVVDMHAAHERITY 480

Query: 441 EKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREI 500
           E+M++   +  + SQ LL P  + + + E AL   H E+L +LG++ ER GP  +A+R++
Sbjct: 481 ERMKRALEAQDLKSQPLLVPVSLAVSQKEAALAETHSEELLQLGLRVERIGPETLAVRQV 540

Query: 501 PAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRL 560
           PA+L   +  QL+RD++ ++I++  +  ++  I  +L TMAC+GS+R+ R++   EMN L
Sbjct: 541 PALLRGADTEQLVRDVLSDLIENGESDRVEAVIHELLGTMACHGSVRANRQLTIPEMNTL 600

Query: 561 LREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LR+ME    S QCNHGRPT+  + LS+++KLF R
Sbjct: 601 LRDMEATERSGQCNHGRPTWTVVTLSELDKLFLR 634


>gi|192359923|ref|YP_001983535.1| DNA mismatch repair protein [Cellvibrio japonicus Ueda107]
 gi|238692427|sp|B3PDC3|MUTL_CELJU RecName: Full=DNA mismatch repair protein mutL
 gi|190686088|gb|ACE83766.1| DNA mismatch repair protein MutL [Cellvibrio japonicus Ueda107]
          Length = 626

 Score =  418 bits (1075), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 231/634 (36%), Positives = 349/634 (55%), Gaps = 56/634 (8%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI+ LS ++ NQIAAGE++ERPS  IKEL+ENSLDA ++R++  I  GG    ++ DNG 
Sbjct: 6   KIKLLSPRLANQIAAGEVVERPSSVIKELLENSLDAGATRLDIEIEDGGIKLMRVRDNGG 65

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+A+ RH TSKI   DD   + T GFRGEAL SI +V+ L L+S   +++ G 
Sbjct: 66  GIDKDDLPLALSRHATSKIYELDDLEAVATLGFRGEALASISSVARLALVSSTSEDSAGW 125

Query: 120 QIAISGEKI-SSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  + + + P     GT VEVRDLFF  PAR  FL+SE+ E   + DV++R+A++
Sbjct: 126 QVVAEGRDMETQISPAPHPRGTTVEVRDLFFNTPARRKFLRSEKTEYTHLEDVVKRLALS 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F         Y      +      R++QV G  F+ NAV +  +   + L G+  
Sbjct: 186 RFDVAFNLRHNGRAIYAWRAGDSQLEQERRVAQVCGPAFMENAVFIEMERGSLRLWGWVA 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            PTF+R  A+  + ++NGR ++DK +   +R AY + +  GR+P  VL LE+DP  VDVN
Sbjct: 246 QPTFSRSQADLQHFYVNGRAIRDKLVSHAVRQAYQDVLYHGRHPAFVLYLELDPSTVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------KGISTSSVLSKK 340
           VHP K  +RFR+   + +FI  S+  A+ K                   GI+  +V  + 
Sbjct: 306 VHPTKHEVRFRDNRTVHDFIYSSLHHALAKVRPEDTLARKAADLGEDTPGIAPYAVSPRP 365

Query: 341 MISSFHQDN---------APKT---HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDP- 387
           ++                AP T   + P Y +    T     ++E   +  +LL S +P 
Sbjct: 366 LVEGIAAGEFKGQGAMSFAPSTSGGYRPGYTSVSPGT-----IREQMHTYGELLASAEPV 420

Query: 388 -------TYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIF 440
                  T +ED  P          LG A AQ+   YI+++   GL++VD HAAHER+ +
Sbjct: 421 TARALPQTPTEDIPP----------LGYALAQLKGIYILAENAQGLIVVDMHAAHERITY 470

Query: 441 EKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREI 500
           E+M+  +    + +Q LL PE I + E E     +  +    LG + +R GP  + IR++
Sbjct: 471 ERMKAAYAHGGLQTQPLLVPESIAVSEKEADCAEQFADIFKTLGFELQRAGPETLLIRQL 530

Query: 501 PAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRL 560
           P IL++    QL+RD++ ++I+  T+  +Q  I  ILATMAC+GS+R+ RK+   EMN L
Sbjct: 531 PVILNRAQAEQLVRDVLSDLIEHGTSERIQHHINEILATMACHGSVRANRKLTIPEMNAL 590

Query: 561 LREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LR+ME    S QCNHGRPT+    L +++KLF R
Sbjct: 591 LRDMEATERSGQCNHGRPTWFLQSLDELDKLFMR 624


>gi|114775687|ref|ZP_01451255.1| DNA mismatch repair protein [Mariprofundus ferrooxydans PV-1]
 gi|114553798|gb|EAU56179.1| DNA mismatch repair protein [Mariprofundus ferrooxydans PV-1]
          Length = 611

 Score =  418 bits (1075), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 217/606 (35%), Positives = 348/606 (57%), Gaps = 25/606 (4%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I  LS ++ NQIAAGE++ERP+ A+KELIENS+DA ++RV   IAG GK   ++ DNG+G
Sbjct: 15  IHILSPQVANQIAAGEVVERPASAMKELIENSIDAGATRVVVRIAGAGKKRIEVDDNGYG 74

Query: 63  MTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           M++ +  +++QRH TSKI  S+D   I + GFRGEALPSI +VS   + +    +  G +
Sbjct: 75  MSAADAELSLQRHATSKIASSEDLHRIASHGFRGEALPSIASVSRFRMQT--ASDGEGVE 132

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + + G   + V+P A   GT +EV DLF   PARL+F+++++ E + I D  R +A+A P
Sbjct: 133 VRVDGGGETVVKPAAPRKGTRIEVLDLFLNTPARLHFMRTDKTEESAIVDTFRELALANP 192

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V+         R++   Q        R+  V+G+ F +N+VE   +   + +  + G+P
Sbjct: 193 GVAMRLELDARTRFEFALQDEQA----RVQAVMGQGFADNSVEQRIEHEGMQISAWLGLP 248

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TF+  ++ +    +NGR ++DK +++ +R  Y + +   RYPV V+ LEIDP  VDVNVH
Sbjct: 249 TFHHRDSTRMMFLVNGRVIRDKQLIAALRAGYRDVMFHDRYPVAVVRLEIDPADVDVNVH 308

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           PAK  +RF++P  +R  I+  ++  I + G S SS   +  + +  +     T LP +  
Sbjct: 309 PAKREVRFKSPQTVRAGIVACVRAGIERMGHSVSSTTGEPALQAMQR----STGLPAFNG 364

Query: 361 SLTNTQEKLFLQEN-RLSTNDLLPSD------DPTYSEDNDPVEESEATHYQLGIACAQI 413
                    F   + R +    +P++       P    ++  V ++ A    LG   AQI
Sbjct: 365 GQDGGGMPRFSSGDYRATGQQRMPAEMTRMLFSPPEVRESGQVYDATA-RLDLGYPLAQI 423

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
           H+ YI++QT  G+V++DQHAAHER+ +EK++       I +Q LLTPE + L     A +
Sbjct: 424 HRCYILAQTDSGVVLIDQHAAHERMTYEKLKAQLAGGDIATQMLLTPEALTLDGEAAAWL 483

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEI----IDSSTTYTL 529
            +H   LH  G+  E  G  +  IR +PA+L  + + +++ ++++      +D     + 
Sbjct: 484 HDHAVALHHFGVDIEAAGDQSFLIRSVPAMLGGEALVEMVTELVESCRLIGVDHEAGSSG 543

Query: 530 QDRI-ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDI 588
             R+ E  L   AC GSI+SGR++   E   LLREME+ PN +QCNHGRPT+++L L+++
Sbjct: 544 GARVLERWLGNRACKGSIKSGRRLSHEEQLSLLREMERTPNIAQCNHGRPTYVRLSLNEL 603

Query: 589 EKLFGR 594
           ++LFGR
Sbjct: 604 DRLFGR 609


>gi|89094654|ref|ZP_01167591.1| DNA mismatch repair protein [Oceanospirillum sp. MED92]
 gi|89081124|gb|EAR60359.1| DNA mismatch repair protein [Oceanospirillum sp. MED92]
          Length = 627

 Score =  418 bits (1075), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 222/630 (35%), Positives = 356/630 (56%), Gaps = 44/630 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKE++ENSLDA +++V+  +  GG    +I DNGF
Sbjct: 3   RIHLLSPRLANQIAAGEVVERPASVIKEILENSLDAGANKVDVDVEQGGVKLMRIRDNGF 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+A+ RH TSKI+  +D   + + GFRGEAL SI +VS LTL SR    +   
Sbjct: 63  GIEKDDLPLALSRHATSKITLLEDLEAVGSLGFRGEALASISSVSRLTLTSRQADQDNAW 122

Query: 120 QIAISGEKI-SSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  + + + P A   GT VEV+DLFF  PAR  FLK+E+ E   + +V++R+A++
Sbjct: 123 QVQTEGRDMEAQLEPAAHPTGTTVEVKDLFFNTPARRKFLKTEKTEFRHLDEVVKRLALS 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELN--EKSNEITLQGY 236
              V+F         ++++   +      R++ + G  FI+NAV+ +   +++ + L G+
Sbjct: 183 RFDVAFQLRHNGKVIHQLHQADSELEQERRVASICGSAFIDNAVKADVIAEASGLRLWGW 242

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
            G+PTF+R  A+  Y F+NGR ++DK +   +R AYA+ +  GR+P  VL LE+DP  VD
Sbjct: 243 VGLPTFSRSQADLQYFFVNGRMIRDKVVTHAVRQAYADVLYHGRHPAYVLYLELDPALVD 302

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAI------------------------------ 326
           VNVHP K  +RFR   ++ +F+ +++ + I                              
Sbjct: 303 VNVHPTKHEVRFRESRLVHDFLFRTLHRLIADMRPQDQMASPEQAEASVNLQPQVQPVQQ 362

Query: 327 --NKKGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPS 384
              +  I+ SS  +    + F+       + P  A S    +E++           L P 
Sbjct: 363 NYEQNRIAFSSAQNVSGNAGFNSSVRGGGYTPPSAPSGGQIREQIS------GYAALHPQ 416

Query: 385 DDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMR 444
            D     DN   + SE T   +G A AQ+H  YI+++   GLV+VD HAAHER+++E+M+
Sbjct: 417 SDVQSVSDNTAEQGSE-TCPPMGYAIAQLHGVYILAENEQGLVVVDMHAAHERIVYERMK 475

Query: 445 QDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAIL 504
           Q +    + SQ LL P  + +   E     E  E   RLG +  R G   + +R++P  L
Sbjct: 476 QSYEQDVVRSQPLLVPLSLAVSAREADCAEEQAETFKRLGFELARMGEETLVVRQVPVSL 535

Query: 505 SKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREM 564
           +K N+ QL+RD++ +++    +  ++  I  +LATMAC+G++R+ R++   EMN LLR+M
Sbjct: 536 AKGNVEQLIRDVLSDMLVYGESKRVEQHINELLATMACHGAVRANRQLTIPEMNALLRDM 595

Query: 565 EKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           E+   S QCNHGRPT+ ++ +SD++KLF R
Sbjct: 596 EQTERSGQCNHGRPTWSQMSMSDLDKLFMR 625


>gi|88704498|ref|ZP_01102212.1| DNA mismatch repair protein mutL [Congregibacter litoralis KT71]
 gi|88701549|gb|EAQ98654.1| DNA mismatch repair protein mutL [Congregibacter litoralis KT71]
          Length = 629

 Score =  418 bits (1075), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 226/627 (36%), Positives = 359/627 (57%), Gaps = 38/627 (6%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I++L  ++ NQIAAGE++ERP+  +KEL+ENSLDA + RV+  I   G    +I D+G G
Sbjct: 4   IKRLPPRLANQIAAGEVVERPASVVKELLENSLDAGARRVDLDIEAAGTKLIRIRDDGSG 63

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           + S+++P+A+ RH TSKI   DD   + +FGFRGEAL SIG+VSHL + S   +  +  Q
Sbjct: 64  IASDDLPLALDRHATSKIESLDDLEQVGSFGFRGEALASIGSVSHLVVTSNTAEAGSDGQ 123

Query: 121 IA-ISGEKIS-SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            A  SG  +  +++P A   GT VEVRDLFF  PAR  FL++E+ E N + DV++R+A++
Sbjct: 124 AASCSGRDMEVTLKPAAHPRGTTVEVRDLFFNTPARRKFLRTERTEFNHLDDVVKRIALS 183

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              VSF           +       +   R++ + G  F+ NAV ++  + ++ L G+  
Sbjct: 184 RFDVSFALRHNGRQLRDLRRCDNEADQLRRVASLCGPAFVENAVAIDRNAGDLRLHGWVA 243

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P+F+R  A+  + ++NGR ++DK ++  +R A+++ +  GR+P  VL LE+DP +VDVN
Sbjct: 244 QPSFSRSQADLQHFYVNGRYIRDKLVVHAVRQAFSDVLYQGRHPAFVLYLELDPAEVDVN 303

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RFR+   + +FI  ++ KA+     S S+V ++  +S     +A    L   
Sbjct: 304 VHPTKHEVRFRDGRSVHSFIYSTLHKALADIRPSDSAVPTQASMSPV---SASTGRLDLL 360

Query: 359 ATSLTNTQEKLFLQE--------------NRLSTNDL-----LPS--DDPT-------YS 390
              L   QE    ++              +R    D       P+  DD T       Y+
Sbjct: 361 TGELVRQQEMGLREQGAGRLTAANPGVFADRGDRGDFQGGRGAPAGFDDATAASYRQLYA 420

Query: 391 EDNDP--VEESEATHY-QLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDF 447
             + P  VEE +      LG A AQ+H  YI++Q  +G+V+VD HAAHER+ +E+++Q  
Sbjct: 421 SPDKPGSVEEGDGADIPPLGYALAQLHGIYILAQNREGMVLVDTHAAHERITYERLKQAR 480

Query: 448 NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKK 507
           +   I SQ LL P+ + +   E  L+ EH      LG++ +  G  ++ IREIP  L   
Sbjct: 481 DEQGIRSQPLLVPQSVSVSSREAILVEEHAALFESLGLRVDVAGEESLLIREIPVSLQGA 540

Query: 508 NIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKN 567
           ++ QLLRD++ ++++  ++  +    + +L+TMAC+GS+R+ R++   EMN LLR+ME  
Sbjct: 541 DVEQLLRDVLADLLEYGSSERIARHEDELLSTMACHGSVRANRRLTVPEMNALLRDMEVT 600

Query: 568 PNSSQCNHGRPTFIKLKLSDIEKLFGR 594
             S QCNHGRPT+  L + D+++LF R
Sbjct: 601 ERSGQCNHGRPTWTALSVQDLDRLFLR 627


>gi|94500524|ref|ZP_01307055.1| DNA mismatch repair protein [Oceanobacter sp. RED65]
 gi|94427314|gb|EAT12293.1| DNA mismatch repair protein [Oceanobacter sp. RED65]
          Length = 634

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 220/632 (34%), Positives = 360/632 (56%), Gaps = 41/632 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  +KEL+ENSLDA ++R+E     GG    +I DNG 
Sbjct: 3   RIHVLSPRLANQIAAGEVVERPANVVKELVENSLDAGATRIEVDAEQGGVKLIRIRDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+++ RH TSKI D  D  ++ + GFRGEAL SI +VS L+L S   ++    
Sbjct: 63  GIEKDDLPLSLSRHATSKIVDLDDLESVQSLGFRGEALASIASVSRLSLSSHEQESELAY 122

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  +++ V+P A   GT VE+RDLFF  PAR  FL++E+ E N + +V++RMA++
Sbjct: 123 QVTAEGRDMATEVKPCAHPVGTTVEMRDLFFNTPARRKFLRTEKTEFNHLEEVVKRMALS 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPE--RISQVIGEDFINNAVELNEKSNEITLQGY 236
              VSF      +N+   + +  +  F +  RI+ ++   F+  AV ++ ++  + L G+
Sbjct: 183 RYDVSFQLR--HNNKVIHSLRPCSSAFDQEKRIATLLSAQFMKEAVRIDMEAAGLKLWGW 240

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
            G+PTFNR  A+  Y F+NGR V+DK +   IR AY + +  GR+   VL LE+DP  VD
Sbjct: 241 VGLPTFNRSQADMQYFFVNGRIVRDKLVAHAIRQAYQDVLYHGRHSAFVLYLELDPALVD 300

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINK----------------------KGISTS 334
           VNVHP K  +RFR+  ++ +F+ +++ KA+ +                       GI   
Sbjct: 301 VNVHPTKHEVRFRDGRLVHDFLFRTLHKALGEVRPETPSTDHAIPGQLQGQSQVSGIEAG 360

Query: 335 SVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDND 394
               +  ++           L +      N  E   +QE   +  +L  +        N 
Sbjct: 361 EFAGQNAMALSQVQGQSSNALTQSQPWQANRPEPGQVQEQMAAYQNLYQAPPADSGLANQ 420

Query: 395 PVE------ESEATHYQ------LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEK 442
           P++      + +AT         LG A AQ+H  YI+SQ   GLV+VD HAAHER+ +E+
Sbjct: 421 PIQSNPFQTQPQATDENQQDIPPLGYAIAQLHGIYILSQNQHGLVVVDMHAAHERITYER 480

Query: 443 MRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPA 502
           ++  +++  I SQ LL PE I +   +  +  +H+ D+ +LG + +R GP ++ IR++P 
Sbjct: 481 LKMTYDAQGIQSQPLLVPETIHVSVEQADIAEQHEADIQKLGFQLQRLGPESLVIRQMPV 540

Query: 503 ILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLR 562
           +L   NI  L+  ++++   + ++  + +    IL++MAC+GS+R+ R++   EMN LLR
Sbjct: 541 LLKNANIEHLVVKVLEDYRTAGSSRHMTEFRNEILSSMACHGSVRANRQLTIAEMNGLLR 600

Query: 563 EMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +ME+   S QCNHGRPT+ +L +++++KLF R
Sbjct: 601 DMEQTERSGQCNHGRPTWTQLSMNELDKLFLR 632


>gi|330807229|ref|YP_004351691.1| DNA mismatch repair protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375337|gb|AEA66687.1| DNA mismatch repair protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 637

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 227/638 (35%), Positives = 350/638 (54%), Gaps = 58/638 (9%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +  GG    ++ D+G 
Sbjct: 11  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGAKRIDVDVEQGGVKLLRVRDDGG 70

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +VS LTL SR        
Sbjct: 71  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVSRLTLTSRTRDAEQAW 130

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++S V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+R+A+A
Sbjct: 131 QVETEGRDMASRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRLALA 190

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+  V G  F+  A+ +  + N + L G+ G
Sbjct: 191 RFDVAFHLRHNGKTILSLHEAHDDAARARRVGAVCGAGFLEQALPIEVERNGLHLWGWVG 250

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y ++NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 251 LPTFSRSQADLQYFYVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAVVDVN 310

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RFR+  ++ +F+  ++ +A+               +    Q  AP       
Sbjct: 311 VHPTKHEVRFRDGRMVHDFLYGTLHRALGD-------------VRPEDQLAAPAAVGGMV 357

Query: 359 ATSLTNTQEKLFLQENRLSTNDLL--PSDDPTYS------------------EDNDPVEE 398
             +     E     E RL+ N LL  P   P+Y+                  + N P  E
Sbjct: 358 RPTGLEAGEFGPQGEMRLAANALLEQPQPQPSYNTAGSGAGSGYQYQYTPRPQSNVPAAE 417

Query: 399 SEATHYQ----------------------LGIACAQIHQNYIISQTTDGLVIVDQHAAHE 436
           ++A + +                      LG A AQ+   YI+S+   GLV+VD HAAHE
Sbjct: 418 AQAAYREFFKPLPEAGAAAMPDGQGDIPPLGYALAQLKGIYILSENAQGLVLVDMHAAHE 477

Query: 437 RLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIA 496
           R+++E+++    S  ++ Q LL PE + + + E     EH     RLG + +R GP  +A
Sbjct: 478 RIMYERLKIAMASEGLSGQPLLVPESLAVSQREADCAEEHVAWFQRLGFELQRLGPETLA 537

Query: 497 IREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIE 556
           IR+IPA+L +    +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   E
Sbjct: 538 IRQIPALLKQAEANRLVSDVLADLMEYGTSDRIQAHLNELLGTMACHGAIRANRRLALPE 597

Query: 557 MNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           MN LLR+ME    S QCNHGRPT+ +L L D++KLF R
Sbjct: 598 MNGLLRDMENTERSGQCNHGRPTWTQLGLDDLDKLFLR 635


>gi|58698260|ref|ZP_00373179.1| mismatch repair protein MutL [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225631007|ref|YP_002727798.1| DNA mismatch repair protein MutL [Wolbachia sp. wRi]
 gi|254766185|sp|C0R515|MUTL_WOLWR RecName: Full=DNA mismatch repair protein mutL
 gi|58535232|gb|EAL59312.1| mismatch repair protein MutL [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225592988|gb|ACN96007.1| DNA mismatch repair protein MutL [Wolbachia sp. wRi]
          Length = 605

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 239/612 (39%), Positives = 356/612 (58%), Gaps = 26/612 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I  L  K IN+IAAGE+IERP+  +KEL+EN++DA S  +E  I  GG++   +TD+G
Sbjct: 1   MAIILLDTKTINRIAAGEVIERPASVVKELVENAIDAGSLEIEIKIESGGRNLIIVTDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            G+   ++ +A  RH TSK+SD +   I   GFRGEALPSI AVS + L S+  + +   
Sbjct: 61  NGVEKNDLELAFMRHATSKLSDSELIEIKHLGFRGEALPSIAAVSRIKLSSKAREASEAW 120

Query: 120 QIAI-SGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            I+   GEKI    P +++ GT +EVRDLFF  P RL FLK+E+ ET  I D++  +A+ 
Sbjct: 121 SISYEGGEKIGEQTPYSLSQGTHIEVRDLFFATPNRLKFLKTERAETQSIVDIVNNLAMI 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              + FT ++   N+  + +      F  R+ +V  E+F  +++E+NE+ + I L G+  
Sbjct: 181 NYHIGFTLTS--GNKKLLKYAKQTSLF-HRLCEV-EEEFQGSSLEINEEEDGIKLTGHIC 236

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            PT NRG + Q Y F+NGR ++D  ++  +R AY + IP  RYP   L LEI   QVDVN
Sbjct: 237 KPTVNRGKSTQIYTFVNGRPIKDNLLIGAVRYAYHDFIPSDRYPFAALHLEIPYDQVDVN 296

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD-NAPKTHLPK 357
           VHP KS +RF+N  +I   + + + KA++++ I T     +KM S+     + P     +
Sbjct: 297 VHPNKSEVRFQNKKLIYEIMTRGLIKALSRR-IGTFPAHDQKMDSTLPDPFDKPDVQNER 355

Query: 358 YATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEAT--------------H 403
             +   N   K F   N  +      S    Y+       ++EA                
Sbjct: 356 RPSPFENQLIKEFASPNEKAKGLSEQSKSFDYTGIQKFPAQAEAMVLEKKVLEQVDLIES 415

Query: 404 YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEII 463
           + LG A  Q++  YII++  D L+IVDQHAAHERL++E ++Q    + I  Q LL PE +
Sbjct: 416 HPLGFARCQVYNTYIIAEVRDKLIIVDQHAAHERLVYECLKQ---KSSIKRQKLLLPETV 472

Query: 464 DLL-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIID 522
           ++  +    +I  + + L  +G   E    N + ++EIPAIL   ++ ++L +IID + +
Sbjct: 473 EIKNQAGMEMIEIYKDKLFEMGFDIEIKSENKVIVKEIPAILGAIDVKEMLINIIDRLTE 532

Query: 523 SSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIK 582
              T  ++D++  ILAT+AC+GSIR+GRKM+  EMN LLR+MEK P S QCNHGRPT+I+
Sbjct: 533 IEDTLPVEDKVNKILATIACHGSIRAGRKMRLDEMNELLRQMEKTPYSGQCNHGRPTYIE 592

Query: 583 LKLSDIEKLFGR 594
           +KLSDIEKLF R
Sbjct: 593 MKLSDIEKLFER 604


>gi|254516807|ref|ZP_05128865.1| DNA mismatch repair protein MutL [gamma proteobacterium NOR5-3]
 gi|219674312|gb|EED30680.1| DNA mismatch repair protein MutL [gamma proteobacterium NOR5-3]
          Length = 624

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 218/626 (34%), Positives = 355/626 (56%), Gaps = 41/626 (6%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I++L  ++ NQIAAGE++ERP+  +KEL+ENSLDA + RV+  I   G    ++ DNGFG
Sbjct: 4   IKRLPARLANQIAAGEVVERPASVVKELLENSLDAGALRVDIDIEAAGTKLIRVRDNGFG 63

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +++E++P+A+ RH TSKI   DD   + +FGFRGEAL SIG+VSHL + S   +  + A 
Sbjct: 64  ISAEDLPLALDRHATSKIGSLDDLEQVGSFGFRGEALASIGSVSHLIVTSNTAEAGSEAH 123

Query: 121 IA-ISGEKIS-SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            A  SG  +  +++P A   GT VEVRDLFF  PAR  FL++E+ E N + DV++R+A++
Sbjct: 124 SASCSGRDMQVTLKPAAHPQGTTVEVRDLFFNTPARRKFLRTERTEFNHLDDVVKRLALS 183

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              VSF           +       +   R++ + G  F+ +AV ++  + E+ L G+  
Sbjct: 184 RFDVSFGLRHNGRQLQDLRRCDDEADRLRRVALLCGPGFVEHAVAIDRDATELRLHGWVA 243

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P+F+R  A+  + ++NGR ++DK +   +R A+++ +  GR+P  VL LE+DP +VDVN
Sbjct: 244 QPSFSRSQADLQHFYVNGRYIRDKLVAHAVRQAFSDVLYQGRHPAFVLYLELDPAEVDVN 303

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI-----------------------NKKGISTSS 335
           VHP K  +RFR+   + +FI  ++ KA+                        +  + T  
Sbjct: 304 VHPTKHEVRFRDGRSVHSFIYSTLHKALADIRPSDTSMPAQASSSPVSASAGRLDLLTGE 363

Query: 336 VLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTY------ 389
           ++ ++ +    Q         ++ +       +   Q  R S+     +   +Y      
Sbjct: 364 LVRQREMGLVEQGAGTTAVFSEHGS-------RGDFQSGRGSSTGFDAATAASYQQLYGS 416

Query: 390 SEDNDPVEESEATHY-QLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFN 448
           +E  + V E +A     LG A AQ+H  YI++Q  +GLV+VD HAAHER+ +E+++Q  +
Sbjct: 417 AEGRNGVAEGDAAEVPPLGYALAQLHGVYILAQNREGLVLVDMHAAHERITYERLKQARD 476

Query: 449 STKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKN 508
              I SQ LL P+ + +   E  L+ EH      LG++ +  G  ++ IREIP  L   N
Sbjct: 477 EQGIRSQPLLVPQSVSVSSREALLLEEHASLFQSLGLRVDIAGEESLIIREIPVSLQGAN 536

Query: 509 IPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNP 568
           + +LLRD++ ++++  T+  +    + +L+TMAC+GS+R+ R++   EMN LLR+ME   
Sbjct: 537 VEELLRDVLADLLEYGTSERIARHEDELLSTMACHGSVRANRRLTVPEMNALLRDMEITE 596

Query: 569 NSSQCNHGRPTFIKLKLSDIEKLFGR 594
            S QCNHGRPT+  L + ++++LF R
Sbjct: 597 RSGQCNHGRPTWTSLSVQELDRLFLR 622


>gi|146305668|ref|YP_001186133.1| DNA mismatch repair protein [Pseudomonas mendocina ymp]
 gi|145573869|gb|ABP83401.1| DNA mismatch repair protein MutL [Pseudomonas mendocina ymp]
          Length = 623

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 225/634 (35%), Positives = 351/634 (55%), Gaps = 56/634 (8%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+   KEL+ENSLD+ + R++  +  GG    ++ D+G 
Sbjct: 3   RIHLLSPRLANQIAAGEVVERPASVAKELLENSLDSGARRIDVEVEQGGVKLLKVRDDGG 62

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++++P+A+ RH TSKI +  D   + + GFRGEAL SI +VS LTL SR    +   
Sbjct: 63  GIAADDLPLALARHATSKIRELEDLEAVLSMGFRGEALASISSVSRLTLTSRTADADQAW 122

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  +   V+P A   GT VEVRDLFF  PAR  FL++E+ E + + +VI+R+A+A
Sbjct: 123 QVETEGRDMQPRVQPAAHPVGTSVEVRDLFFNTPARRKFLRAEKTEFDHLQEVIKRLALA 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F         + ++      +   R++ V G  F+  A+ +  +   + L G+ G
Sbjct: 183 RFDVAFHLRHNGKTVFALHEAGDEISRARRVAAVCGPAFLEQALPIEIERGGLRLWGWVG 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y ++NGR V+DK +   +R AY + +  GR+P  VL LEIDP  VDVN
Sbjct: 243 LPTFSRSQADLQYFYVNGRMVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLEIDPSTVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RFR+  ++ +F+  ++ +A+               +    Q  AP   +P  
Sbjct: 303 VHPTKHEVRFRDSRMVHDFLYGTLHRALAD-------------VRPEDQVAAPAAVMPMV 349

Query: 359 -ATSLT----NTQEKLFLQENRLSTNDLLPSDDPTY-----------SEDNDPVEESEAT 402
            AT L       Q ++ L  + L T    P   P +                PV E++A 
Sbjct: 350 RATGLAAGEFGPQGEMGLAASVLETPVANPQ--PAWRGAGAGYQQPAGSPGVPVAEAQAA 407

Query: 403 HYQ----------------------LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIF 440
           + +                      LG A AQ+   YI+++   G+V+VD HAAHER+ +
Sbjct: 408 YREYFAPLPGAQPAPLPQEQGDIPPLGYAVAQLKGVYILAENAQGMVVVDMHAAHERITY 467

Query: 441 EKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREI 500
           E+++Q   S  +  Q LL PE I L + E     EH E   RLG + +R G   +AIR+I
Sbjct: 468 ERLKQAMASEGLRGQPLLVPESIALSQREADCAEEHGEWFQRLGFELQRLGEETVAIRQI 527

Query: 501 PAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRL 560
           PA+L +    QL+RD++ ++++  T+  +Q  +  +LATMAC+G++R+ R++   EMN L
Sbjct: 528 PALLKQAEATQLVRDVLADLLEYGTSDRIQAHLNELLATMACHGAVRANRRLTLPEMNAL 587

Query: 561 LREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LR+ME+   S QCNHGRPT+ +L + D++KLF R
Sbjct: 588 LRDMEQTERSGQCNHGRPTWTQLGMDDLDKLFLR 621


>gi|296117465|ref|ZP_06836052.1| DNA mismatch repair protein MutL [Gluconacetobacter hansenii ATCC
           23769]
 gi|295975986|gb|EFG82777.1| DNA mismatch repair protein MutL [Gluconacetobacter hansenii ATCC
           23769]
          Length = 633

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 223/626 (35%), Positives = 358/626 (57%), Gaps = 40/626 (6%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+LSE+++N+IAAGE+IERP+ A+KEL+EN+LD+ + R+   +  GG    ++ D+G G
Sbjct: 13  IRRLSEQVVNRIAAGEVIERPAAALKELVENALDSGAQRISVALLHGGIERIEVIDDGCG 72

Query: 63  MTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT +++ +AV+RHCTSK+SD+    I T GFRGEALPSIGA + L + SR     T   I
Sbjct: 73  MTPDDLRLAVERHCTSKLSDETLVRIATLGFRGEALPSIGAAARLNVTSRTRGAPTAWSI 132

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            + G ++   RP A   GT V V DLFF  PAR  FLKS +VE+    + +RR+A++ P 
Sbjct: 133 RVEGGRVDEPRPCAGVVGTCVVVEDLFFATPARRKFLKSARVESGHAENTVRRLALSAPH 192

Query: 182 VSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPT 241
           V+F        R  ++  +   +   R + ++     +  + +  +  ++ L GY   P+
Sbjct: 193 VAFRLQF--DQRVVLDLPAQ--DMAARAAAILDAGQADGLIPVEAERGDLRLSGYICAPS 248

Query: 242 FNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHP 301
            +R  AN   + +NGR V D  + + +R AY   +  GR+ VV L L+I P QVDVNVHP
Sbjct: 249 VHRATANGQLLLVNGRPVVDPVLRTAVRVAYRNVMEHGRHAVVALSLQIPPEQVDVNVHP 308

Query: 302 AKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYATS 361
           AK+ +R+ +   +R  +I ++ +A+   G   + V    ++ S     A   + P+ A++
Sbjct: 309 AKTELRYADAAAVRALVIGALGRALG-IGAGVAGV-RPGLLQSRPAGGARIWYPPEPASA 366

Query: 362 --LTNTQEKLF-------------LQENRLSTNDLLPSDDPT--YSEDNDPVEESE---- 400
             ++  Q   F             + E RL   D+ P       +SE + P  +      
Sbjct: 367 PPVSPVQMSPFPPDGDDGPPMAEGVAERRLPLMDIAPGARQVVRWSEADIPAVQGAVSSP 426

Query: 401 ------ATHYQLGIACAQIHQNYIISQTTDG-LVIVDQHAAHERLIFEKMRQDFNSTKIT 453
                 A  + LG A AQ+   YI+++T  G LV+VDQHAAHERL  E++R  +   +I 
Sbjct: 427 APNPEPAADFPLGAAVAQVLGTYILAETARGELVLVDQHAAHERLTHERLRAQYLGGEIR 486

Query: 454 SQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLL 513
           +Q LL PE++++  G+  L+M   + L  LG++ + FG +A+ +R +PA+L   +   +L
Sbjct: 487 AQRLLLPEVVNMPRGQADLLMSFADTLSALGLEIDAFGGDAVMVRTVPALLGGGDAAAML 546

Query: 514 RDII-----DEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNP 568
           RD+      DE++  +    +  R++ I+A MAC+GS+R+GR++   EMN LLR+ME+ P
Sbjct: 547 RDLAEELAEDELLAPAQAQAVDGRLDAIIARMACHGSVRAGRRLTHEEMNALLRDMERTP 606

Query: 569 NSSQCNHGRPTFIKLKLSDIEKLFGR 594
            +  C+HGRPT++KL+  D+E++FGR
Sbjct: 607 RAGTCSHGRPTWLKLEKGDLERMFGR 632


>gi|331005105|ref|ZP_08328508.1| DNA mismatch repair protein MutL [gamma proteobacterium IMCC1989]
 gi|330421074|gb|EGG95337.1| DNA mismatch repair protein MutL [gamma proteobacterium IMCC1989]
          Length = 619

 Score =  415 bits (1066), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 223/615 (36%), Positives = 353/615 (57%), Gaps = 22/615 (3%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI+ L  ++ NQIAAGE++ERP+  IKE++ENSLDA +SR++  I  GG    +I DNG 
Sbjct: 3   KIKLLPPRLANQIAAGEVVERPASVIKEMLENSLDAGASRIDIDIENGGIKTMRIRDNGH 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++ +A+ RH TSKI   DD   + T GFRGEAL S+ +VS LTL S    +  G 
Sbjct: 63  GIDQDDLALALSRHATSKIYVLDDLEAVGTLGFRGEALASVSSVSRLTLTSSVNDSAQGW 122

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
                G+++S+ + P     GT VEVRDLFF  PAR  FL++E+ E N I +V++R+A+A
Sbjct: 123 AAKAEGQEMSTELTPAPHQQGTTVEVRDLFFNTPARRKFLRTEKTEFNRIEEVVKRLALA 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F     +   + +   ++      R++Q+ G  F+ NA+ ++ + + + L G+  
Sbjct: 183 NFDVTFELRHNQRTIHSLRAGTSEAEKNRRVAQICGPAFMENALTVDIERSGLRLWGWVA 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  + ++NGR ++D+ +   ++ AY++ +  GR+P  VL LEIDP  VDVN
Sbjct: 243 LPTFSRSQADLQHFYVNGRAIKDRLVSHAVKQAYSDVLYHGRHPAFVLYLEIDPATVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI-----NKKGISTSSVLSKKMI---SSFHQDNA 350
           VHP K  +RFR+   + +FI  S+  A+     + +  + SS+     I   +S  Q   
Sbjct: 303 VHPTKHEVRFRDGRNVHSFIYSSLHHALADVRPDDQLTTASSLAVAAGIGTDASQQQTIV 362

Query: 351 PKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDND---------PVEESEA 401
            +  +   A++L NT        +         +D P   E  +         P   +E 
Sbjct: 363 DQQSMSLAASTLVNTAGNPSPAYSSAPHYPPTDTDTPQIREALNFYGQAASLSPESATET 422

Query: 402 THY--QLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLT 459
           +H    LG A AQ+   YI+S+   GL++VD HAAHER+++E+M+  F+   + +Q LL 
Sbjct: 423 SHEVPPLGYAIAQLKGIYILSENAQGLIVVDMHAAHERVVYERMKSAFDQGNVQAQPLLV 482

Query: 460 PEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDE 519
           P+ + + E E A I  H E   +LG   E  GP ++ IR+IP  L   N+ QL+RD++ +
Sbjct: 483 PQTLAVSEKEVACIESHQEVFQQLGFVVETAGPESLLIRQIPVSLKNANVEQLVRDVLSD 542

Query: 520 IIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPT 579
           +I   ++  ++  I  +L+TMAC+GS+R+ R +   EMN LLR+ME    S QCNHGRPT
Sbjct: 543 LIQYGSSDRIKQHINELLSTMACHGSVRANRTLSVPEMNALLRDMEATERSGQCNHGRPT 602

Query: 580 FIKLKLSDIEKLFGR 594
           ++   L++I+K F R
Sbjct: 603 WMHFSLAEIDKWFMR 617


>gi|312958650|ref|ZP_07773170.1| DNA mismatch repair protein [Pseudomonas fluorescens WH6]
 gi|311287193|gb|EFQ65754.1| DNA mismatch repair protein [Pseudomonas fluorescens WH6]
          Length = 640

 Score =  415 bits (1066), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 220/641 (34%), Positives = 356/641 (55%), Gaps = 61/641 (9%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENS+D+ + R++  +  GG    ++ D+G 
Sbjct: 11  RIELLSPRLANQIAAGEVVERPASVIKELLENSIDSGAKRIDVDVEQGGVKLLRVRDDGS 70

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR        
Sbjct: 71  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRNAEQAW 130

Query: 120 QIAISGEKIS-SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++  V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+R+A+A
Sbjct: 131 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRLALA 190

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++          R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 191 RFDVAFHLRHNGKTILSLHEAHDEAARARRVSAICGAGFLEQALPIEIERNGLRLWGWVG 250

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 251 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAVVDVN 310

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RFR+  ++ +F+  ++ +A+    +     LS  ++++  + + P+      
Sbjct: 311 VHPTKHEVRFRDGRMVHDFLYGTLHRALGD--VRPDDQLSAPIVTAMVRPSGPE------ 362

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYS-------------------EDNDPVEES 399
                  Q ++ L  N L +    P+  P+YS                   +   PV E+
Sbjct: 363 -AGEFGPQGEMSLAGNLLQS----PAPQPSYSSTPGSGSGAGYQYQYTPRPQSTVPVAEA 417

Query: 400 EATHYQ--------------------------LGIACAQIHQNYIISQTTDGLVIVDQHA 433
           +A + +                          LG A AQ+   YI+++   GLV+VD HA
Sbjct: 418 QAAYREFFAXXXXXXXXXXAVSLPEGGGDIPPLGYALAQLKGIYILAENAHGLVLVDMHA 477

Query: 434 AHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPN 493
           AHER+++E+++    S  ++ Q LL PE + + + E     EH +   +LG + +R GP 
Sbjct: 478 AHERIMYERLKIAMASEGLSGQPLLVPESLAVSQREADCAEEHHDVFQKLGFELQRLGPE 537

Query: 494 AIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQ 553
            +AIR+IPA+L +    +L+ D++ ++++  T+  +Q  I  +L TMAC+G++R+ R++ 
Sbjct: 538 TLAIRQIPALLKQAEANRLVADVLADLMEYGTSDRIQAHINELLGTMACHGAVRANRRLA 597

Query: 554 SIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
             EMN LLR+ME    S QCNHGRPT+ ++ L D++KLF R
Sbjct: 598 LPEMNGLLRDMENTERSGQCNHGRPTWTQMGLDDLDKLFLR 638


>gi|229588073|ref|YP_002870192.1| DNA mismatch repair protein [Pseudomonas fluorescens SBW25]
 gi|259511148|sp|C3KDW1|MUTL_PSEFS RecName: Full=DNA mismatch repair protein mutL
 gi|229359939|emb|CAY46793.1| DNA mismatch repair protein [Pseudomonas fluorescens SBW25]
          Length = 633

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 219/639 (34%), Positives = 354/639 (55%), Gaps = 59/639 (9%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENS+D+ + R++  +  GG    ++ D+G 
Sbjct: 6   RIELLSPRLANQIAAGEVVERPASVIKELLENSIDSGAKRIDVDVEQGGVKLLRVRDDGS 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 66  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 125

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++  V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+R+A+A
Sbjct: 126 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 186 RFDVAFHLRHNGKTILSLHEAHDDAARARRVSAICGAGFLEQALPIEIERNGLRLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 246 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPSVVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RFR+  ++ +F+  ++ + +    +     LS  ++++  + + P+      
Sbjct: 306 VHPTKHEVRFRDGRMVHDFLYGTLHRTLGD--VRPDDQLSAPIVTAVVRPSGPE------ 357

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDND------------------PVEESE 400
                  Q ++ L  N L +    P   P+Y+                      PV E++
Sbjct: 358 -AGEFGPQGEMSLAANLLQS----PQPQPSYTAPGSGSGAGYQYQYTPRPQSAVPVAEAQ 412

Query: 401 ATHYQ-------------------------LGIACAQIHQNYIISQTTDGLVIVDQHAAH 435
           A + +                         LG A AQ+   YI+++   GLV+VD HAAH
Sbjct: 413 AAYREFFAPLPGAEPGAPVALPEGGGDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAH 472

Query: 436 ERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAI 495
           ER+++E+++    S  ++ Q LL PE + + + E     EH     +LG + +R GP  +
Sbjct: 473 ERIMYERLKIAMASEGLSGQPLLVPESLAVSQREADCAEEHHSVFQKLGFELQRLGPETL 532

Query: 496 AIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSI 555
           AIR+IPA+L +    +L+ D++ ++++  T+  +Q  I  +L TMAC+G+IR+ R++   
Sbjct: 533 AIRQIPALLKQAEANRLVADVLADLMEYGTSDRIQAHINELLGTMACHGAIRANRRLALP 592

Query: 556 EMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           EMN LLR+ME    S QCNHGRPT+ ++ L D++KLF R
Sbjct: 593 EMNGLLRDMENTERSGQCNHGRPTWTQMGLDDLDKLFLR 631


>gi|254787458|ref|YP_003074887.1| DNA mismatch repair protein [Teredinibacter turnerae T7901]
 gi|237684748|gb|ACR12012.1| DNA mismatch repair protein MutL [Teredinibacter turnerae T7901]
          Length = 613

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 224/615 (36%), Positives = 353/615 (57%), Gaps = 28/615 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI  LS ++ NQIAAGE++ERP+  IKEL+ENSLDA +++++  +  GG    ++ DNG 
Sbjct: 3   KIFTLSPRLANQIAAGEVVERPASVIKELVENSLDAGATQLDVEVEQGGVKLIRVRDNGH 62

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++ E++P+A+ RH TSKI   DD   + T GFRGEAL SI +V+ L L S   +  +G 
Sbjct: 63  GISKEDLPLALSRHATSKIINLDDLEAVVTLGFRGEALASISSVARLRLTSNTGEEESGW 122

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +   G  + + + P     GT VEVRDLFF  PAR  FL++E+ E   + DV++R+A++
Sbjct: 123 CVEAEGRDMEARLAPAGHPQGTSVEVRDLFFNTPARRKFLRTERTEYGRVEDVLKRLALS 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
                F+        +     +T      R++Q+ G  F+ NAV ++     + L G+  
Sbjct: 183 RFAQGFSLKNNGRVVHSWRPATTQPEQERRVAQICGPAFMENAVHVDIDRAGLRLWGWVA 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  + ++NGR ++DK +   IR AY + +  GR+P  VL LE+DP  VDVN
Sbjct: 243 LPTFSRSQADLQHFYVNGRAIRDKLVSHAIRQAYQDVLYHGRHPAFVLYLELDPGNVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RFR+  ++ +F+ +S+ KA+    +   +  S +       D A +    +Y
Sbjct: 303 VHPTKHEVRFRDSRLVHDFLFRSLHKALAD--VRPGNEPSAQEDIGAEADTASELSAQQY 360

Query: 359 ATSLTNTQEKLFLQENRL---STNDLLPSDDPTYSEDND----------------PVEES 399
           + +    Q  L     R    +  +  PS  PTY+                    P  ++
Sbjct: 361 SPT---EQPGLSFSAQRSEPSAVAERAPSWSPTYTSAGSATSKRPSMGSPASVMPPASDN 417

Query: 400 EATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLT 459
           E T   LG A AQ+   YI+++  DG+V+VD HAAHER+ +E+M++   + KI SQ LL 
Sbjct: 418 E-TVPPLGYAVAQLKGIYILAENADGMVVVDMHAAHERITYERMKEQQQAQKIQSQPLLV 476

Query: 460 PEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDE 519
           P+ + + E E     E  +    LG + ER GP ++ IR++P IL++ N+ QL+RD++ +
Sbjct: 477 PQAMAVSEKEADYADEFADIFVNLGFELERAGPESLLIRQLPVILNRANVEQLVRDVLSD 536

Query: 520 IIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPT 579
           +I+  ++  +Q  I  IL TMAC+GS+R+ R++   EMN LLR+ME    S QCNHGRPT
Sbjct: 537 LIEYGSSQRIQQNINEILGTMACHGSVRANRRLNIAEMNALLRDMEATERSGQCNHGRPT 596

Query: 580 FIKLKLSDIEKLFGR 594
           + ++ L++++KLF R
Sbjct: 597 WTQMSLAELDKLFMR 611


>gi|94429030|gb|ABF18946.1| DNA mismatch repair protein mutL [uncultured bacterium pFosLip]
          Length = 585

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 216/601 (35%), Positives = 336/601 (55%), Gaps = 25/601 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I++L   +INQIAAGE++ERP+  +KEL+ENSLDA +  V   I  GG    ++ D+G
Sbjct: 1   MPIQQLPNHLINQIAAGEVVERPASVVKELLENSLDAGAQAVHVDILAGGSKLIRVRDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+   E+ +A+ RH TSKIS  +D   + + GFRGEALPSI +V+ L+L SR    +  
Sbjct: 61  AGIPQGELSLALARHATSKISSLEDLEAVVSLGFRGEALPSIASVARLSLTSRSTGGDNA 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            Q+     +I   RP A   GT VEV DLF+  PAR  FLK+E+ E   I   +RR+A+A
Sbjct: 121 WQVEADNGEIGEARPAAHPGGTTVEVHDLFYNTPARRRFLKTERTEFGHIDKWVRRLALA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P V+F  +  +     +   +      +R++++ GE F   AV L  ++  I + G+ G
Sbjct: 181 RPDVAFVLTHNRRTVLDLRAATNREQQQQRLARICGEAFAEQAVYLQHETEGIAITGWIG 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTFNR   +  + F+NGR++ DK +    R AY + +  GR+P  VL L +DP  +D N
Sbjct: 241 LPTFNRSQPDLQFWFVNGRSISDKTLSHAARHAYRDVLFHGRFPAYVLGLTVDPATIDAN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINK-----KGISTSSVLSKKMISSFHQDNAPKT 353
            HPAK  IRFR+   I   + Q+++ A++       G++ + V S    S   QD     
Sbjct: 301 AHPAKHEIRFRDGRRIHGVVAQAVEVALSDTRPSGHGVAPAPVASG---SPIRQDGLRLP 357

Query: 354 HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQI 413
             P+ A           ++E+  + + L     P  + D D  E        +G A AQ+
Sbjct: 358 AAPRPAA----------VRESLATYSALAGGAPPVSASDRDAGELPP-----MGYAIAQL 402

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
              YI+++  +GLV+VD HAAHER+ +EK+++ F+   +  Q LL P  + + E E    
Sbjct: 403 GGVYILAENREGLVVVDMHAAHERITYEKLKKGFDDKALVRQPLLVPVTVAVAESEARHA 462

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRI 533
            E  E L  +G+  +R GP ++ +RE+PA+L   +   LLRD++ +I  +  +  ++D  
Sbjct: 463 EEASELLALVGLVVDRAGPTSLVVREVPALLRGADAEALLRDVLADIAQAGQSSRVEDEC 522

Query: 534 ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFG 593
              LATMAC+ S+R+ R++   EMN LLREME    + QCNHGRPT+  + ++++++LF 
Sbjct: 523 HEFLATMACHHSVRANRQLTLEEMNALLREMETTERADQCNHGRPTWTAISMAELDRLFL 582

Query: 594 R 594
           R
Sbjct: 583 R 583


>gi|28872058|ref|NP_794677.1| DNA mismatch repair protein MutL [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|37999555|sp|Q87VJ2|MUTL_PSESM RecName: Full=DNA mismatch repair protein mutL
 gi|28855311|gb|AAO58372.1| DNA mismatch repair protein MutL [Pseudomonas syringae pv. tomato
           str. DC3000]
          Length = 645

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 222/622 (35%), Positives = 350/622 (56%), Gaps = 29/622 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDIDVEQAGIKLLKVRDDGG 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  + + V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMDARVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLHEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTARARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S  +    +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPENQLGGSVPAAAEPRPTGPDAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQ------------ENRLSTNDLLPSDDPTYSEDNDP----- 395
             +      L   Q + F +              R +T   +      Y E   P     
Sbjct: 382 GEMRLANNVLEQPQGEPFARPAGGGSGSGYQYSPRPTTGVPVAEAQSAYREFFAPLPGTT 441

Query: 396 ---VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
              + ES +    LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    +  +
Sbjct: 442 PSALPESPSDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMANEGL 501

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
           + Q LL PE I + + E     EH     RLG + +R GP  +AIR+IPA+L +    +L
Sbjct: 502 SGQPLLVPESIAVSQREADCAEEHITTFQRLGFELQRLGPETLAIRQIPALLKQAEANRL 561

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           + D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    S Q
Sbjct: 562 VSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTERSGQ 621

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT+ ++ LSD++KLF R
Sbjct: 622 CNHGRPTWTQMGLSDLDKLFLR 643


>gi|237798277|ref|ZP_04586738.1| DNA mismatch repair protein [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331021129|gb|EGI01186.1| DNA mismatch repair protein [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 647

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 218/624 (34%), Positives = 347/624 (55%), Gaps = 31/624 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDIDVEQAGIKLLKVRDDGG 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++  V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTARARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S       K       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPENQVGGSVPVAAEPKPTGPDAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQ------- 405
             +      L   Q + F +     +                PV E+++ + +       
Sbjct: 382 GEMRLANNVLEQPQGEAFARPAGGGSGSGYQYQYSPRPASALPVAEAQSAYREFFAPLPS 441

Query: 406 ---------------LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST 450
                          LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    + 
Sbjct: 442 AAPSALPESPSDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMANE 501

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
            ++ Q LL PE + + + E     EH     RLG + +R GP  +AIR+IPA+L +    
Sbjct: 502 GLSGQPLLVPESLAVSQREADCAEEHIATFQRLGFELQRLGPETLAIRQIPALLKQAEAN 561

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
           +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    S
Sbjct: 562 RLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTERS 621

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
            QCNHGRPT+ ++ LSD++KLF R
Sbjct: 622 GQCNHGRPTWTQMGLSDLDKLFLR 645


>gi|254480864|ref|ZP_05094110.1| DNA mismatch repair protein MutL [marine gamma proteobacterium
           HTCC2148]
 gi|214038659|gb|EEB79320.1| DNA mismatch repair protein MutL [marine gamma proteobacterium
           HTCC2148]
          Length = 624

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 222/620 (35%), Positives = 360/620 (58%), Gaps = 27/620 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI++LS ++ NQIAAGE++ERP+  +KE++ENSLDA ++RV+  +  GG    +I DNG 
Sbjct: 3   KIQRLSTRLANQIAAGEVVERPASVVKEVLENSLDAGATRVDVDVESGGVKLIRIRDNGN 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPP-QNNTG 118
           G+  +++P+A+ RH TSKI+  +D   + + GFRGEAL SIG+VS LTL S    Q + G
Sbjct: 63  GIDPDDLPLAMARHATSKITSLEDLEAVGSLGFRGEALASIGSVSRLTLTSNASEQGSEG 122

Query: 119 AQIAISGEKIS-SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           +  A  G  +   V+P     GT VEVRDLFF  PAR  FL++E+ E N + +V++R+A+
Sbjct: 123 SSAACEGRDMEVQVKPAPHPQGTTVEVRDLFFNTPARRKFLRTEKTEFNHLEEVVKRLAL 182

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           +   V+F+        +++   +       R++ V G  F++ A+ +   ++   L G+ 
Sbjct: 183 SRFDVAFSLRHNGRGIHQLKAGTGQVEQQRRVATVCGPAFMDQAIYVENAASGFKLWGWV 242

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PTF+R  A+  Y F+NGR ++DK I   ++ AY + +  GR+P  VL LE+DP QVDV
Sbjct: 243 GLPTFSRSQADLQYFFVNGRVIRDKLIAHAVKQAYRDVLYHGRHPAFVLYLEVDPAQVDV 302

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKA---INKKGISTSSVLSKKMISSFH-------- 346
           NVHP K  +RFR+   + NFI  S+ +A   +     + +  L   M+S+          
Sbjct: 303 NVHPTKHEVRFRDGRSVHNFIFSSLHRALADVRPTADNPADPLPANMLSTGDGMAINTQT 362

Query: 347 QDNAPKTHLPKYATSLTNTQEKLFLQE------NRLSTNDLLPSDD----PTYSEDND-- 394
            + + +  L   A   +   +     +      +R + N + P+        Y + +   
Sbjct: 363 GEISAQGGLAWGAGQGSAVADAPLQTQPGGGFGSRFAPNTVAPAQGSAQLAAYQQLHPQL 422

Query: 395 PVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITS 454
           P + S      LG A AQ+   YI+++   GLV+VD HAAHER+ +E+++   +   I S
Sbjct: 423 PTQGSAEDVPPLGYALAQLKGIYILAENVAGLVLVDMHAAHERITYERLKTARDEEGIRS 482

Query: 455 QTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLR 514
           Q LL P+ I + + E  +  E+++   RLG+     G  A+ IREIP  L   ++ QLLR
Sbjct: 483 QPLLVPQPIAVSQREVQVASENEDLFKRLGLSVGVAGEEALVIREIPVALRDSDVEQLLR 542

Query: 515 DIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCN 574
           D++ ++I+  ++  ++  ++ IL+TMAC+GS+R+ R++   EMN LLR+ME+   S QCN
Sbjct: 543 DVLADLIEFGSSERVEAHMDEILSTMACHGSVRANRRLTIPEMNALLRDMEETERSGQCN 602

Query: 575 HGRPTFIKLKLSDIEKLFGR 594
           HGRPT+ +++L +++KLF R
Sbjct: 603 HGRPTWTQMRLDELDKLFLR 622


>gi|119502790|ref|ZP_01624875.1| DNA mismatch repair protein [marine gamma proteobacterium HTCC2080]
 gi|119461136|gb|EAW42226.1| DNA mismatch repair protein [marine gamma proteobacterium HTCC2080]
          Length = 614

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 224/612 (36%), Positives = 348/612 (56%), Gaps = 23/612 (3%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I +L+ ++ NQIAAGE++ERP+  IKE IENSLDA +SR++  +  GG    ++ DNG 
Sbjct: 5   RIHRLATRLANQIAAGEVVERPASVIKEAIENSLDAGASRIDIELESGGVQLMRVRDNGQ 64

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+++E++ +A+ RH TSKI   DD   + T GFRGEAL SI +VS L+L S   +     
Sbjct: 65  GISAEDLILALARHATSKIDSIDDLEAVGTLGFRGEALASIASVSRLSLTSNASEQGAAG 124

Query: 120 QIAIS-GEKIS-SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
            IA S G  ++ SV P     GT +EVRDLF+  PAR  FL++E+ E   I +V +R A+
Sbjct: 125 MIAQSEGRDMTVSVSPAPHPRGTTLEVRDLFYNTPARRKFLRTEKTELGHIDEVFKRQAL 184

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           A   V+F+        + +N          RI+ V G  F+  +V L  ++  ++L G+ 
Sbjct: 185 ARSDVAFSLRHNGKTLHSLNCADDQAGRERRIATVCGAAFMEQSVALAREAGRLSLHGWV 244

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PTF+R  A+  Y F+NGR ++DK +   I+ AY + +  GR+P  VL LE+DP  VDV
Sbjct: 245 GLPTFSRSQADLQYFFVNGRVIRDKLVTHAIKQAYRDVLFHGRHPAYVLFLEVDPAVVDV 304

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAIN--KKGISTSSVLSKKMISSFHQDNAPKTHL 355
           NVHP K  +RFR    + +FI  ++ +A+   + G   ++  S +      Q+    +  
Sbjct: 305 NVHPTKHEVRFREGREVHSFIFSTLHRALGDLRPGDGGAADASGEDA----QEGVGWSTT 360

Query: 356 PKYA-TSLTNTQEKLFLQENRLSTNDLLP----SDDPTYSE--------DNDPVEESEAT 402
           P+ A   L       +  E +  T DL         PT++         +  P  + E+ 
Sbjct: 361 PQQAPMGLLTPPGGHWQPEAQAGTADLDALSRLYKSPTFNRGGHGTPIMEQSPRGDDESE 420

Query: 403 HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEI 462
              LG A AQ+H  +I+++  +GLV+VD HAAHER+ +E+++Q  + + I +Q LL P+ 
Sbjct: 421 VPPLGFALAQLHGVFILAENAEGLVLVDMHAAHERITYERLKQMRDDSGIRTQPLLVPQT 480

Query: 463 IDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIID 522
           I L   E A  +E  E L  LG+  +  G   + IRE+P  L    I  L+RD++ +++ 
Sbjct: 481 ITLSSREVAAAVEMSEALIALGLVLDATGDEQLVIREVPIALIGGGIEALVRDVLSDMLA 540

Query: 523 SSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIK 582
             T+  +    + +L+TMAC+GS+R+ R++   EMN LLR+ME    S QCNHGRPT+++
Sbjct: 541 FGTSDRIAAHEDELLSTMACHGSVRANRRLTVPEMNALLRDMEMTERSGQCNHGRPTWVQ 600

Query: 583 LKLSDIEKLFGR 594
           L + D++KLF R
Sbjct: 601 LGMQDLDKLFLR 612


>gi|330873787|gb|EGH07936.1| DNA mismatch repair protein [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
 gi|330965979|gb|EGH66239.1| DNA mismatch repair protein [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 647

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 222/624 (35%), Positives = 350/624 (56%), Gaps = 31/624 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDIDVEQAGIKLLKVRDDGS 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  + + V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMDARVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLHEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTARARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S       ++      +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPENQLGGSVPVAAEPRLTGPDAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQ--------------ENRLSTNDLLPSDDPTYSEDNDP--- 395
             +      L   Q + F +                R +T   +      Y E   P   
Sbjct: 382 GEMRLANNVLEQPQGEPFARPAGSGSGSGYQYQYSPRPTTGVPVAEAQSAYREFFAPLPG 441

Query: 396 -----VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST 450
                + ES +    LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    + 
Sbjct: 442 TTPSALPESPSDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMANE 501

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
            ++ Q LL PE I + + E     EH     RLG + +R GP  +AIR+IPA+L +    
Sbjct: 502 GLSGQPLLVPESIAVSQREADCAEEHITTFQRLGFELQRLGPETLAIRQIPALLKQAEAN 561

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
           +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    S
Sbjct: 562 RLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTERS 621

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
            QCNHGRPT+ ++ LSD++KLF R
Sbjct: 622 GQCNHGRPTWTQMGLSDLDKLFLR 645


>gi|330501621|ref|YP_004378490.1| DNA mismatch repair protein [Pseudomonas mendocina NK-01]
 gi|328915907|gb|AEB56738.1| DNA mismatch repair protein [Pseudomonas mendocina NK-01]
          Length = 623

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 219/629 (34%), Positives = 350/629 (55%), Gaps = 46/629 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+   KEL+ENSLD+ + R++  +  GG    ++ D+G 
Sbjct: 3   RIHLLSPRLANQIAAGEVVERPASVAKELLENSLDSGARRIDVEVEQGGVKLLKVRDDGG 62

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ + ++P+A+ RH TSKI +  D   + + GFRGEAL SI +VS LTL SR    +   
Sbjct: 63  GIAAGDLPLALARHATSKIRELEDLEAVLSMGFRGEALASISSVSRLTLTSRTADADQAW 122

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  +   V+P A   GT VEVRDLFF  PAR  FL++E+ E + + +VI+R+A+A
Sbjct: 123 QVETEGRDMEPRVQPAAHPVGTSVEVRDLFFNTPARRKFLRAEKTEFDHLQEVIKRLALA 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V F         + ++  +   +   R++ V G  F+  A+ +  +   + L G+ G
Sbjct: 183 RFDVGFHLRHNGKTVFSLHEAADEISRARRVASVCGPAFLEQALPIEIERGGLRLWGWVG 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y ++NGR V+DK +   +R AY + +  GR+P  VL LEIDP  VDVN
Sbjct: 243 LPTFSRSQADLQYFYVNGRMVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLEIDPATVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RFR+  ++ +F+  ++ +A+       + V  +  +++     +P       
Sbjct: 303 VHPTKHEVRFRDSRMVHDFLYGTLHRAL-------ADVRPEDQVAA-PAAVSPMLRPTGL 354

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTY-----------SEDNDPVEESEATHYQ-- 405
           A      Q ++ L  + L T   +P   P +                P  E++A + +  
Sbjct: 355 AAGEFGPQGEMGLAASVLETPVAIPQ--PAWRGAGAGYQQPVGNPGVPAAEAQAAYREYF 412

Query: 406 --------------------LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQ 445
                               LG A AQ+   YI+++   G+V+VD HAAHER+ +E+++Q
Sbjct: 413 SPLPTAQAQSVPQEQGDIPPLGYAVAQLKGVYILAENAQGMVVVDMHAAHERITYERLKQ 472

Query: 446 DFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILS 505
              S  +  Q LL PE I L + E     EH E   RLG + +R G  ++AIR+IPA+L 
Sbjct: 473 AMASEGLRGQPLLVPESIALSQREADCAEEHGEWFQRLGFELQRLGEESVAIRQIPALLK 532

Query: 506 KKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREME 565
           +    QL+RD++ ++++  T+  +Q  +  +LATMAC+G++R+ R++   EMN LLR+ME
Sbjct: 533 QAEATQLVRDVLADLLEYGTSDRIQAHLNELLATMACHGAVRANRRLTIPEMNGLLRDME 592

Query: 566 KNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +   S QCNHGRPT+ +L +  ++KLF R
Sbjct: 593 QTERSGQCNHGRPTWTQLSMDQLDKLFMR 621


>gi|41582282|gb|AAS07896.1| DNA mismatch repair protein mutL [uncultured marine bacterium 463]
          Length = 624

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 222/620 (35%), Positives = 360/620 (58%), Gaps = 27/620 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI++LS ++ NQIAAGE++ERP+  +KE++ENSLDA ++RV+  +  GG    +I DNG 
Sbjct: 3   KIQRLSTRLANQIAAGEVVERPASVVKEVLENSLDAGATRVDVDVESGGVKLIRIRDNGN 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPP-QNNTG 118
           G+  +++P+A+ RH TSKI+  +D   + + GFRGEAL SIG+VS LTL S    Q + G
Sbjct: 63  GIDPDDLPLAMARHATSKITSLEDLEAVGSLGFRGEALASIGSVSRLTLTSNASEQGSEG 122

Query: 119 AQIAISGEKIS-SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           +  A  G  +   V+P     GT VEVRDLFF  PAR  FL++E+ E N + +V++R+A+
Sbjct: 123 SSAACEGRDMEVQVKPAPHPQGTTVEVRDLFFNTPARRKFLRTEKTEFNHLEEVVKRLAL 182

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           +   V+F+        +++   +       R++ V G  F++ A+ +   ++   L G+ 
Sbjct: 183 SRFDVAFSLRHNGRGIHQLKAGTGQVEQQRRVATVCGPAFMDQAIYIENAASGFKLWGWV 242

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PTF+R  A+  Y F+NGR ++DK I   ++ AY + +  GR+P  VL LE+DP QVDV
Sbjct: 243 GLPTFSRSQADLQYFFVNGRVIRDKLIAHAVKQAYRDVLYHGRHPAFVLYLEVDPAQVDV 302

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKA---INKKGISTSSVLSKKMISSFH-------- 346
           NVHP K  +RFR+   + NFI  S+ +A   +     + +  L   M+S+          
Sbjct: 303 NVHPTKHEVRFRDGRSVHNFIFSSLHRALADVRPTADNPADPLPANMLSTGDGMAINTQT 362

Query: 347 QDNAPKTHLPKYATSLTNTQEKLFLQE------NRLSTNDLLPSDD----PTYSEDND-- 394
            + + +  L   A   +   +     +      +R + N + P+        Y + +   
Sbjct: 363 GEISAQGGLAWGAGQGSAVADAPLQTQPGGGFGSRFAPNTVAPAQGSAQLAAYQQLHPQL 422

Query: 395 PVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITS 454
           P + S      LG A AQ+   YI+++   GLV+VD HAAHER+ +E+++   +   I S
Sbjct: 423 PTQGSAEDVPPLGYALAQLKGIYILAENVAGLVLVDMHAAHERITYERLKTARDEEGIRS 482

Query: 455 QTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLR 514
           Q LL P+ I + + E  +  E+++   RLG+     G  A+ IREIP  L   ++ QLLR
Sbjct: 483 QPLLVPQPIAVSQREVQVASENEDLFKRLGLSVGVAGEEALVIREIPVALRDSDVEQLLR 542

Query: 515 DIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCN 574
           D++ ++I+  ++  ++  ++ IL+TMAC+GS+R+ R++   EMN LLR+ME+   S QCN
Sbjct: 543 DVLADLIEFGSSERVEAHMDEILSTMACHGSVRANRRLTIPEMNALLRDMEETERSGQCN 602

Query: 575 HGRPTFIKLKLSDIEKLFGR 594
           HGRPT+ +++L +++KLF R
Sbjct: 603 HGRPTWTQMRLDELDKLFLR 622


>gi|213967922|ref|ZP_03396068.1| DNA mismatch repair protein MutL [Pseudomonas syringae pv. tomato
           T1]
 gi|301384442|ref|ZP_07232860.1| DNA mismatch repair protein [Pseudomonas syringae pv. tomato Max13]
 gi|302064109|ref|ZP_07255650.1| DNA mismatch repair protein [Pseudomonas syringae pv. tomato K40]
 gi|302132270|ref|ZP_07258260.1| DNA mismatch repair protein [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|213927265|gb|EEB60814.1| DNA mismatch repair protein MutL [Pseudomonas syringae pv. tomato
           T1]
          Length = 645

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 222/622 (35%), Positives = 349/622 (56%), Gaps = 29/622 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDIDVEQAGIKLLKVRDDGG 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  + + V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMDARVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLHEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTARARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S       +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPENQLGGSVPVAAEPRPTGPDAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQ------------ENRLSTNDLLPSDDPTYSEDNDP----- 395
             +      L   Q + F +              R +T   +      Y E   P     
Sbjct: 382 GEMRLANNVLEQPQGEPFARPAGGGSGSGYQYSPRPTTGVPVAEAQSAYREFFAPLPGTT 441

Query: 396 ---VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
              + ES +    LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    +  +
Sbjct: 442 PSALPESPSDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMANEGL 501

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
           + Q LL PE I + + E     EH     RLG + +R GP  +AIR+IPA+L +    +L
Sbjct: 502 SGQPLLVPESIAVSQREADCAEEHITTFQRLGFELQRLGPETLAIRQIPALLKQAEANRL 561

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           + D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    S Q
Sbjct: 562 VSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTERSGQ 621

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT+ ++ LSD++KLF R
Sbjct: 622 CNHGRPTWTQMGLSDLDKLFLR 643


>gi|330960091|gb|EGH60351.1| DNA mismatch repair protein [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 647

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 221/624 (35%), Positives = 350/624 (56%), Gaps = 31/624 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL++NSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLKNSLDSGARRIDVDVEQAGIKLLKVRDDGG 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++  V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     RIS + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTAKARRISAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S    +  +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPENQLGGSVPVAVEPRPTGPEAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQ--------------ENRLSTNDLLPSDDPTYSEDNDPVEE 398
             +      L   Q + F +                R +T   +      Y E   P+  
Sbjct: 382 GEMRLANNVLEQPQGEAFARPAGGGAGSGYQYQYSPRPTTGVPVAEAQSAYREFFAPLPS 441

Query: 399 --------SEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST 450
                   SE+    LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    + 
Sbjct: 442 AAPSSLPGSESDIPPLGYALAQLKGIYILAENAQGLVLVDMHAAHERIMYERLKIAMANE 501

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
            ++ Q LL PE + + + E     EH     RLG + +R GP  +AIR+IPA+L +    
Sbjct: 502 GLSGQPLLVPESLAVSQREADCAEEHIATFQRLGFELQRLGPETLAIRQIPALLKQAEAN 561

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
           +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    S
Sbjct: 562 RLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNALLRDMENTERS 621

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
            QCNHGRPT+ ++ LSD++KLF R
Sbjct: 622 GQCNHGRPTWTQMGLSDLDKLFLR 645


>gi|331014608|gb|EGH94664.1| DNA mismatch repair protein [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 647

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 218/624 (34%), Positives = 347/624 (55%), Gaps = 31/624 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDIDVEQAGIKLLKVRDDGG 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  + + V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMDARVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLHEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTARARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S       +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPENQLGGSVPVAAEPRPTGPDAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQ------- 405
             +      L   Q + F +     +                PV E+++ + +       
Sbjct: 382 GEMRLANNVLEQPQGEPFARPAGGGSGSGYQYQYSPRPTTGVPVAEAQSAYREFFAPLPG 441

Query: 406 ---------------LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST 450
                          LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    + 
Sbjct: 442 TTPSALPESPSDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMANE 501

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
            ++ Q LL PE I + + E     EH     RLG + +R GP  +AIR+IPA+L +    
Sbjct: 502 GLSGQPLLVPESIAVSQREADCAEEHITTFQRLGFELQRLGPETLAIRQIPALLKQAEAN 561

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
           +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    S
Sbjct: 562 RLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTERS 621

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
            QCNHGRPT+ ++ LSD++KLF R
Sbjct: 622 GQCNHGRPTWTQMGLSDLDKLFLR 645


>gi|104783874|ref|YP_610372.1| DNA mismatch repair protein [Pseudomonas entomophila L48]
 gi|122985730|sp|Q1I447|MUTL_PSEE4 RecName: Full=DNA mismatch repair protein mutL
 gi|95112861|emb|CAK17589.1| DNA mismatch repair protein MutL [Pseudomonas entomophila L48]
          Length = 632

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 220/625 (35%), Positives = 351/625 (56%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLD+ + R+E  +  GG    ++ DNG 
Sbjct: 6   RIQLLSPRLANQIAAGEVVERPASVAKELLENSLDSGARRIEVEVEQGGVKLLRVRDNGG 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+A+ RH TSKI +  D   + + GFRGEAL SI +V+ LTL SR        
Sbjct: 66  GIAPDDLPLALARHATSKIRELEDLEGVLSLGFRGEALASISSVARLTLTSRTADAGEAW 125

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++  V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VIRR+A+A
Sbjct: 126 QVETEGRDMTPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIRRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V F         + ++  +       R+  + G  F+  A+ ++ + N + L G+ G
Sbjct: 186 RFDVGFHLRHNGKTIFSLHEATDEMARARRVGTICGPGFLEQALPIDVERNGLRLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL LE DP  VDVN
Sbjct: 246 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLECDPTGVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAIN----KKGISTSSVLSKKMISSFHQ--DNAPK 352
           VHP K  +RFR   ++ +F+  ++ +A+     +  ++  +  S+ +  S  Q  +  P+
Sbjct: 306 VHPTKHEVRFREGRMVHDFLYGTLHRALADVRPEDQLAAPAAASEIVRPSGQQVGEFGPQ 365

Query: 353 THLPKYATSLTNTQEK---------------LFLQENRLSTNDLLPSDDPTYSEDNDPVE 397
             +   +  L   Q +                +    R S    +      Y E   P++
Sbjct: 366 GEMRLASPVLEQPQAEPRQSFTPGSGAGSGYQYQYTPRPSQPLPVAETQAVYREFYAPLD 425

Query: 398 --------ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                   ES+     LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    S
Sbjct: 426 GTAPASLPESQGDIPPLGYALAQLKGIYILAENAVGLVLVDMHAAHERIMYERLKVAMAS 485

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE + L + E     EH +   RLG + +R GP  +AIR+IPA+L +   
Sbjct: 486 EGLSGQPLLVPESLALSQREADCAEEHAQWFQRLGFELQRLGPETVAIRQIPALLKQAEA 545

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L++D++ ++++  T+  +Q  +  +L TMAC+G++R+ R++   EMN LLR+ME    
Sbjct: 546 NRLVQDVLADLMEYGTSDRIQAHLNELLGTMACHGAVRANRRLAIPEMNALLRDMENTER 605

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L D++KLF R
Sbjct: 606 SGQCNHGRPTWTQMGLDDLDKLFLR 630


>gi|119474825|ref|ZP_01615178.1| DNA mismatch repair protein [marine gamma proteobacterium HTCC2143]
 gi|119451028|gb|EAW32261.1| DNA mismatch repair protein [marine gamma proteobacterium HTCC2143]
          Length = 617

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 217/617 (35%), Positives = 348/617 (56%), Gaps = 28/617 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I++LS ++ NQIAAGE++ERP+  IKEL+ENS+DA +SR++  I  GG    ++ DNG 
Sbjct: 3   QIKRLSPRLANQIAAGEVVERPASVIKELVENSMDAGASRIDIDIEAGGVKLMRVRDNGV 62

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  E++P+A+ RH TSKI   DD  N+ T GFRGEAL SI +VS LT+MS   +   G 
Sbjct: 63  GIEQEDMPLALSRHATSKIIELDDLENVRTLGFRGEALASISSVSRLTIMSNTEEQGAGW 122

Query: 120 QIAISGEKIS-SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           +    G  +   V P     GT VEVRDLFF  PAR  FL++E+ E N + +V++R +++
Sbjct: 123 KAQTEGRDMGVEVSPTPHLRGTSVEVRDLFFNTPARRKFLRTEKTEFNHLEEVVKRQSLS 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V F  +      + +   ++      R++ V G  F+ NA+ ++ ++  + L G+  
Sbjct: 183 RFDVGFYLNHNGRAIHALKPCASQLERERRVASVCGPAFMQNALHIDTEAAGLKLWGWVA 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  ++  + F+NGR ++DK +   +R AY + +  GR+P  VL LE++P  VDVN
Sbjct: 243 LPTFSRSQSDLQHFFVNGRVIRDKLVTHAVRQAYRDVLFHGRHPAFVLYLEVNPSIVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSK 339
           VHP K  +RFR+   + +F+ +S+ + +                    + GI+      +
Sbjct: 303 VHPTKHEVRFRDGRTVHDFLFRSLHRLLAEVRPEDQLAPASINSAEGQQGGIAAGEFQQQ 362

Query: 340 KMISSFHQDNAPK--THLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVE 397
           + I ++  D  P+     P            L+ +   + ++    +          P E
Sbjct: 363 QTI-AWRADTTPQRPGQSPASFREQAAGYSALYGRGENVGSHG-RSAGALGSGATMAPQE 420

Query: 398 ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTL 457
           + E     LG A AQ+   YI+++   GLV+VD HAAHER+ +E+M+       I SQ L
Sbjct: 421 DGEVP--PLGYAIAQLKGIYILAEGEHGLVLVDMHAAHERITYERMKTARQGVGIQSQPL 478

Query: 458 LTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDII 517
           L PE + + + E     E       LG+  ER GP ++ +REIP IL   N+ QL+RD++
Sbjct: 479 LVPESMAVSQREADCAEESSNVFRDLGVGIERAGPESLVVREIPVILQDSNVEQLVRDVL 538

Query: 518 DEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGR 577
            ++I+  ++  ++  I+ IL+TMAC+GS+R+ R++   EMN LLR+ME+   S QCNHGR
Sbjct: 539 SDLIEHGSSDRIEAHIDEILSTMACHGSVRANRRLTIPEMNALLRDMEETERSGQCNHGR 598

Query: 578 PTFIKLKLSDIEKLFGR 594
           PT+ +L L ++++LF R
Sbjct: 599 PTWTQLSLDELDRLFMR 615


>gi|58039705|ref|YP_191669.1| DNA mismatch repair protein MutL [Gluconobacter oxydans 621H]
 gi|58002119|gb|AAW61013.1| DNA mismatch repair protein MutL [Gluconobacter oxydans 621H]
          Length = 619

 Score =  409 bits (1050), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 229/624 (36%), Positives = 348/624 (55%), Gaps = 50/624 (8%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+LS  +I+ IAAGE+IERP+ A+KEL+EN++DA ++R+   +  GG     +TDNG G
Sbjct: 12  IRRLSGHVIDLIAAGEVIERPAAALKELVENAIDAGATRIVVALRAGGTDRIDVTDNGCG 71

Query: 63  MTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT  E+ +AV+RHCTSK+ D+    I T GFRGEALPSIGA + L++ SR P+++T   I
Sbjct: 72  MTPGELELAVERHCTSKLQDERLVQIRTLGFRGEALPSIGASARLSITSRTPESDTAWCI 131

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            + G  I+  +P +   GT + V DLFF  PAR  FLKS +VE++    V+RR+A++ P 
Sbjct: 132 RVDGGVITPPQPASGPVGTRIVVTDLFFATPARRKFLKSARVESSHAESVMRRLALSAPH 191

Query: 182 VSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPT 241
            +          + +  QS       R++ V+ +   +  + L+E+   + L G+   P 
Sbjct: 192 CAMRVLLDDKVLFDLPEQSPIA----RVASVL-DTTPDTLIPLDEQRGAVRLSGFACGPA 246

Query: 242 FNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHP 301
             R   +  ++ +N R V D  + + IR AY   I  GR+PV+ L L +   ++DVNVHP
Sbjct: 247 RTRATGSGQFILVNNRPVTDPMLRTAIRVAYRPVIERGRFPVMALHLTVPLERLDVNVHP 306

Query: 302 AKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSV-----------------------LS 338
           AK+ +RF +   IR+ +I  + +A+         +                        S
Sbjct: 307 AKTELRFADEAEIRSLVIGGLGRALGHGSNGGGGIHASFGSRPSIVYPPRPPEPREAPAS 366

Query: 339 KKMISSFHQDNAPKTH-LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVE 397
             +  S     AP++  LP    SL       F + +            P   E  DP  
Sbjct: 367 IPLQGSLPTGYAPRSSPLPGATPSLARPG---FAETDPAFAPAARAPQQP---EALDPA- 419

Query: 398 ESEATHYQLGIACAQIHQNYIISQTTDG-LVIVDQHAAHERLIFEKMRQDF-NSTKITSQ 455
                 + LG A AQ+   YI++   DG LV+VDQHAAHERL  E++R+ + N   + SQ
Sbjct: 420 ------FPLGAAIAQVFDTYILALAPDGDLVLVDQHAAHERLTHERLREQYANGGTLRSQ 473

Query: 456 TLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRD 515
            LL PE++DL   E   +M   EDL +LGI  E FGP ++ +R +PA+L  ++I  LL+D
Sbjct: 474 ALLLPEVVDLPRREAEALMARAEDLSKLGIDLESFGPGSVLLRSVPALLGAQDIQGLLKD 533

Query: 516 IIDEI-----IDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
           I DE+     +D+++T +    ++ ILA MAC+GSIR+GR+++  EM+ LLREME  P +
Sbjct: 534 IADELASDPDLDAASTGSFSHHLDAILARMACHGSIRAGRRLKPEEMDALLREMELTPRA 593

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
           + C+HGRPT++KL   ++E+LFGR
Sbjct: 594 NTCSHGRPTWLKLTRRELERLFGR 617


>gi|152996647|ref|YP_001341482.1| DNA mismatch repair protein [Marinomonas sp. MWYL1]
 gi|150837571|gb|ABR71547.1| DNA mismatch repair protein MutL [Marinomonas sp. MWYL1]
          Length = 641

 Score =  409 bits (1050), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 223/637 (35%), Positives = 360/637 (56%), Gaps = 44/637 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  +KEL+ENSLDA +S+++  +  GG    +I DNG 
Sbjct: 3   RINLLSPRLANQIAAGEVVERPASVVKELLENSLDAGASQLDIDVEQGGVRRIKIRDNGT 62

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++ +A+ RH TSKI   DD   + T GFRGEAL SI +VS + L S+        
Sbjct: 63  GIMKDDLSLALSRHATSKIITLDDLEAVRTLGFRGEALASISSVSRMHLTSQAESEVEAW 122

Query: 120 QIAISGEKIS-SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           ++   G+ ++ ++RP +   GT +EVRDLFF  PAR  FL++E+ E   + +V++R+A++
Sbjct: 123 RVEAEGKDMATAIRPASHPQGTTIEVRDLFFNTPARRKFLRTEKTEFAHLEEVVKRLALS 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
             +  F  S      Y +   +   +   R++ ++G+ FI N++ L+ ++  + L G+ G
Sbjct: 183 RYETGFRLSHNGKQVYDLRPVTDQLHAEHRLATLLGKKFIENSLTLDVEAAGLRLWGWIG 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL LE+DP  VDVN
Sbjct: 243 LPTFSRSQADLQYFFVNGRVVKDKLVAHAVRQAYRDVLYNGRHPTFVLYLELDPSTVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSV------LSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+   I KAI      + S        S     S+  +   +
Sbjct: 303 VHPTKHEVRFRDGRLVHDFLFSRIHKAIADVRPESESAPTGMNDTSSNEPVSYGSNITEQ 362

Query: 353 THLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDP------------TYSEDNDP----- 395
           + LP    S + + + +    N L ++++    D             + +E+ DP     
Sbjct: 363 SALPLSNRSGSTSMDWMRSTSNSLGSSEVRGQLDGMGRMAGYAQEYVSKTEEIDPETGEI 422

Query: 396 --------VEESE------ATHYQ----LGIACAQIHQNYIISQTTDGLVIVDQHAAHER 437
                   + +SE         YQ    LG A AQ+H  YI+S++  GL++VD HAAHER
Sbjct: 423 REIAPASTLGQSENPLVGREDDYQAVPPLGFAVAQLHGVYILSESEQGLILVDMHAAHER 482

Query: 438 LIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAI 497
           +++E+M+  F    I+SQ LL P  I + + E  L+ E  E     G + ER G  +  +
Sbjct: 483 IVYERMKAAFYQKNISSQPLLVPINIAVSQSEADLVEESGEVFEAFGFRVERTGLESAMV 542

Query: 498 REIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEM 557
           RE+P IL + ++  L+RD+I ++  +  +  ++ R   ++A+MAC+G++R+ RK+   EM
Sbjct: 543 REVPVILIRGDVEGLVRDVISDLSTNGVSDLMESRANELMASMACHGAVRANRKLTIAEM 602

Query: 558 NRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           N LLR+ME    S QCNHGRPT+  L +SD++KLF R
Sbjct: 603 NSLLRDMEMTERSGQCNHGRPTWAHLSMSDLDKLFLR 639


>gi|257482413|ref|ZP_05636454.1| DNA mismatch repair protein [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|331009762|gb|EGH89818.1| DNA mismatch repair protein [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 648

 Score =  408 bits (1049), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 219/625 (35%), Positives = 351/625 (56%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDVDVEQAGIKLLKVRDDGG 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++  V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    + +   R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTSRARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S    +  +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPENQLGGSVPVAVEPRPTGPEAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQEN---------------RLSTNDLLPSDDPTYSEDNDP-- 395
             +      L + Q + F +                 R ++   +      Y E   P  
Sbjct: 382 GEMRLANNVLEHPQGEPFARPAAGGGAGSGYQYQYTPRPTSGVPVAEAQSAYREFFAPLP 441

Query: 396 ------VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                 + ES      LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    +
Sbjct: 442 STAPSSLPESPGDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMAN 501

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE + + + E     EH     RLG + +R GP  +AIR+IPA+L +   
Sbjct: 502 EGLSGQPLLVPESLAVSQREADCAEEHIATFQRLGFELQRLGPETLAIRQIPALLKQAEA 561

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    
Sbjct: 562 NRLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTER 621

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L+D++KLF R
Sbjct: 622 SGQCNHGRPTWTQMGLNDLDKLFLR 646


>gi|114327127|ref|YP_744284.1| DNA mismatch repair protein mutL [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315301|gb|ABI61361.1| DNA mismatch repair protein mutL [Granulibacter bethesdensis
           CGDNIH1]
          Length = 619

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 227/615 (36%), Positives = 351/615 (57%), Gaps = 30/615 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR LS+  IN+IAAGE+IERP+  +KEL+EN+LDA ++R+   + GGG +  ++ D+G 
Sbjct: 12  RIRLLSDTTINRIAAGEVIERPAAVVKELVENALDAGATRIVVALEGGGITRIEVRDDGS 71

Query: 62  GMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           GMT EE+ +A+QRH TSK++DD    I T GFRGEALPSIGA   L++ SR    +    
Sbjct: 72  GMTEEELALAIQRHATSKLTDDSLIRIATLGFRGEALPSIGAAGRLSITSRTAACDHAHS 131

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I + G ++ +V P +   GT + VRDLFF  PAR  FLK+ + E +     +RR+A + P
Sbjct: 132 ITVEGGRVGAVIPASGPQGTRIVVRDLFFATPARRKFLKTPRSEADQAEIAVRRLAFSAP 191

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V+F         + +   +       RI+ ++GE+     + ++ + + + L G+   P
Sbjct: 192 HVAFRCEIDGREIFDLPAATPQA----RIAALLGEEAAAAILPVSAERDTLLLGGFICAP 247

Query: 241 TFNRG-NANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           T  R   A+Q +V +NGR V D  + + +R AY + IP GR+PVV L L + P  VDVNV
Sbjct: 248 TLTRATGASQSFV-VNGRPVTDPMLRTALRVAYRDVIPYGRHPVVALELTVPPEDVDVNV 306

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------NKKGISTSSVLSKKMISSFH 346
           HPAK+ +RFR+   +R  II +I + +               K  ST S+   ++  +  
Sbjct: 307 HPAKTELRFRDAAAVRGLIIGAISRTLAAGVGGPVGQTENGGKASSTLSIPPPRL--NIS 364

Query: 347 QDNAPKTHLPKYATS------LTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESE 400
           + +   T    YA +          + +L LQ+   +    + S   T  + + P     
Sbjct: 365 RPSYTPTRGGGYAAAPPVRPHFGFAEAQLPLQDAP-AARGAMSSAPETVQDRSAPAPPLP 423

Query: 401 ATHYQLGIACAQIHQNYIISQTTDG-LVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLT 459
              Y LG A AQ+   Y+I+   DG LV+VDQHAAHERL  E +R       + SQ LL 
Sbjct: 424 DPAYPLGAAVAQVLDTYVIAVAADGALVLVDQHAAHERLTHEALRSALLDGTVNSQALLL 483

Query: 460 PEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDE 519
           PE++++   E   +++    L +LG+  E FGP A+ +R +PA+L  +++  LLRDI +E
Sbjct: 484 PEVVEMPPREATHLLDAASSLAKLGLDIEAFGPGAVLVRALPALLKPQSVSALLRDIAEE 543

Query: 520 IIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPT 579
           + +   +  L+ R++ ++A MAC+GSIR+GR++   EMN LLR+ME  P ++ C+HGRPT
Sbjct: 544 LAELGASIALESRLDAVIARMACHGSIRAGRRLTVPEMNALLRQMEATPRAATCSHGRPT 603

Query: 580 FIKLKLSDIEKLFGR 594
            ++L  ++IE LFGR
Sbjct: 604 VLRLSKAEIESLFGR 618


>gi|302189791|ref|ZP_07266464.1| DNA mismatch repair protein [Pseudomonas syringae pv. syringae 642]
          Length = 648

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 221/625 (35%), Positives = 349/625 (55%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDVDVEQAGIKLLKVRDDGG 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++  V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTARARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S   V   +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLYRALGDVRPENQLGGSVPVVAETRPSGPEAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQEN---------------RLSTNDLLPSDDPTYSEDNDP-- 395
             +      L   Q + F +                 R ++   +      Y E   P  
Sbjct: 382 GEMRLANNVLEQPQGEPFARPAAAGGTGSGYQYQYTPRPTSGVPVAEAQSAYREFFAPLP 441

Query: 396 ------VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                 + ES      LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    +
Sbjct: 442 SAAPASLPESPGDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMAN 501

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE I + + E     EH     RLG + +R GP  +AIR+IPA+L +   
Sbjct: 502 EGLSGQPLLVPESIAVSQREADCAEEHLATFQRLGFELQRLGPETLAIRQIPALLKQAEA 561

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    
Sbjct: 562 NRLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTER 621

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L+D++KLF R
Sbjct: 622 SGQCNHGRPTWTQMGLNDLDKLFLR 646


>gi|330984562|gb|EGH82665.1| DNA mismatch repair protein [Pseudomonas syringae pv. lachrymans
           str. M301315]
          Length = 648

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 219/625 (35%), Positives = 350/625 (56%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDVDVEQAGIKLLKVRDDGG 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++  V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    + +   R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTSRARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S    +  +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPENQLGGSVPVAVEPRPTGPEAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQEN---------------RLSTNDLLPSDDPTYSEDNDP-- 395
             +      L   Q + F +                 R ++   +      Y E   P  
Sbjct: 382 GEMRLANNVLEQPQGEPFARPAAGGGAGSGYQYQYTPRPTSGVPVAEAQSAYREFFAPLP 441

Query: 396 ------VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                 + ES      LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    +
Sbjct: 442 STAPSSLPESPGDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMAN 501

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE + + + E     EH     RLG + +R GP  +AIR+IPA+L +   
Sbjct: 502 EGLSGQPLLVPESLAVSQREADCAEEHIATFQRLGFELQRLGPETLAIRQIPALLKQAEA 561

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    
Sbjct: 562 NRLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTER 621

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L+D++KLF R
Sbjct: 622 SGQCNHGRPTWTQMGLNDLDKLFLR 646


>gi|30249702|ref|NP_841772.1| mutL; DNA mismatch repair protein [Nitrosomonas europaea ATCC
           19718]
 gi|30180739|emb|CAD85653.1| mutL; DNA mismatch repair protein [Nitrosomonas europaea ATCC
           19718]
          Length = 604

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 228/605 (37%), Positives = 347/605 (57%), Gaps = 19/605 (3%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L + +I+QIAAGE+IERP+  +KEL+EN++DA ++ +   IA GG    ++TDNG G
Sbjct: 4   IKLLPDGLISQIAAGEVIERPASVLKELLENAIDAGTTDISVNIAQGGLKLIRVTDNGGG 63

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           ++ EE+P+A+ RH TSKI+  +D   I + GFRGE L SI +VS+L L+S  P      Q
Sbjct: 64  ISGEELPLALTRHATSKIASQEDLYRITSLGFRGEGLASIASVSNLLLISHQPGGKHAWQ 123

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I   G ++    P +   GT VEVRDLFF +PAR  FLK+E  E     ++IRRMA+++ 
Sbjct: 124 IRSEGIRVMQPEPSSHAAGTTVEVRDLFFNLPARRKFLKTEATEFAHCEEIIRRMALSHA 183

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            ++FT     +   + ++QS       RI  V+GE+F  +A  ++E+S  I LQG   +P
Sbjct: 184 GIAFTLR--HNGNLRGHWQSAEAAV--RIKTVLGEEFTRSAAWIDERSAGIGLQGMLALP 239

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
            ++R   +  Y F+NGR V+DK I   +R AY + + L R+   VL L+IDP QVDVNVH
Sbjct: 240 AYSRAARDMQYFFVNGRFVRDKLITHALREAYRDVLHLDRHAAFVLYLDIDPEQVDVNVH 299

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAIN--KKGI----STSSVLSKKMISSFHQ--DNAPK 352
           P K+ IRFR    I  FI   + KA++  + G     S+S +++  ++    +    AP 
Sbjct: 300 PTKTEIRFREARAIHQFIYHGVSKALSLPRSGTELSQSSSQLMADDIVPPAEKRVPAAPM 359

Query: 353 THLPKYATSLTN---TQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIA 409
            + P+  T L +    Q   F Q    S +D   + +P          E  A    LG A
Sbjct: 360 LNYPRQ-TGLPSEMIAQPFNFYQVLSGSESDSTATQNPFRQTGAGESNEHPALP-PLGFA 417

Query: 410 CAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGE 469
             Q+H  YI++Q   GLVIVD HAAHER+++E+++   +   +++Q LL P        +
Sbjct: 418 LGQLHGVYILAQNWKGLVIVDMHAAHERIVYEQLKLQMDEQTLSAQRLLIPVTFHADSLD 477

Query: 470 CALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTL 529
            A   E+   L +LG +        +A+R +PAIL   +  +L+ +++DEI +      L
Sbjct: 478 IATAEENQSLLQQLGFEVTVLTATTLAVRAVPAILQDADTEKLVCNVLDEIRNGDPGQLL 537

Query: 530 QDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIE 589
             R   +LATMAC+G++R+ R +  IEMN LLR+ME    S QCNHGRPT+ ++ L++++
Sbjct: 538 AARRNELLATMACHGAVRANRPLTLIEMNELLRKMEVTERSDQCNHGRPTWFEISLAELD 597

Query: 590 KLFGR 594
           K+F R
Sbjct: 598 KMFMR 602


>gi|330971552|gb|EGH71618.1| DNA mismatch repair protein [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 648

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 221/625 (35%), Positives = 348/625 (55%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDVDVEQAGIKLLKVRDDGS 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++  V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTARARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S   V   +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLYRALGDVRPENQLGGSVPVVAETRPSGPEAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQEN---------------RLSTNDLLPSDDPTYSEDNDP-- 395
             +      L   Q + F +                 R +    +      Y E   P  
Sbjct: 382 GEMRLANNMLEQPQGEPFARPAAGGGAGSGYQYQYTPRPTAGVPVAEAQSAYREFFAPLP 441

Query: 396 ------VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                 + ES      LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    +
Sbjct: 442 SAAPASLPESPGDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMAN 501

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE I + + E     EH     RLG + +R GP  +AIR+IPA+L +   
Sbjct: 502 EGLSGQPLLVPESIAVSQREADCAEEHLATFQRLGFELQRLGPETLAIRQIPALLKQAEA 561

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    
Sbjct: 562 NRLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTER 621

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L+D++KLF R
Sbjct: 622 SGQCNHGRPTWTQMGLNDLDKLFLR 646


>gi|66043837|ref|YP_233678.1| DNA mismatch repair protein [Pseudomonas syringae pv. syringae
           B728a]
 gi|63254544|gb|AAY35640.1| DNA mismatch repair protein [Pseudomonas syringae pv. syringae
           B728a]
          Length = 648

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 221/625 (35%), Positives = 348/625 (55%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDVDVEQAGIKLLKVRDDGS 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++  V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTARARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S   V   +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLYRALGDVRPENQLGGSVPVVAEARPSGPEAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQEN---------------RLSTNDLLPSDDPTYSEDNDP-- 395
             +      L   Q + F +                 R +    +      Y E   P  
Sbjct: 382 GEMRLANNVLEQPQGEPFARPAAGGGAGSGYQYQYTPRPTAGVPVAEAQSAYREFFAPLP 441

Query: 396 ------VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                 + ES      LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    +
Sbjct: 442 SAASASLPESPGDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMAN 501

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE I + + E     EH     RLG + +R GP  +AIR+IPA+L +   
Sbjct: 502 EGLSGQPLLVPESIAVSQREADCAEEHLATFQRLGFELQRLGPETLAIRQIPALLKQAEA 561

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    
Sbjct: 562 NRLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTER 621

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L+D++KLF R
Sbjct: 622 SGQCNHGRPTWTQMGLNDLDKLFLR 646


>gi|330951472|gb|EGH51732.1| DNA mismatch repair protein [Pseudomonas syringae Cit 7]
          Length = 648

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 221/625 (35%), Positives = 348/625 (55%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDVDVEQAGIKLLKVRDDGS 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++  V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTARARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S   V   +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLYRALGDVRPENQLGGSVPVVAETRPSGPEAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQEN---------------RLSTNDLLPSDDPTYSEDNDP-- 395
             +      L   Q + F +                 R +    +      Y E   P  
Sbjct: 382 GEMRLANNVLEQPQGESFARPAAGGGAGSGYQYQYTPRPTAGVPVAEAQSAYREFFAPLP 441

Query: 396 ------VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                 + ES      LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    +
Sbjct: 442 SAAPASLPESPGDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMAN 501

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE I + + E     EH     RLG + +R GP  +AIR+IPA+L +   
Sbjct: 502 EGLSGQPLLVPESIAVSQREADCAEEHLATFQRLGFELQRLGPETLAIRQIPALLKQAEA 561

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    
Sbjct: 562 NRLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTER 621

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L+D++KLF R
Sbjct: 622 SGQCNHGRPTWTQMGLNDLDKLFLR 646


>gi|77456749|ref|YP_346254.1| DNA mismatch repair protein [Pseudomonas fluorescens Pf0-1]
 gi|77380752|gb|ABA72265.1| DNA mismatch repair protein [Pseudomonas fluorescens Pf0-1]
          Length = 635

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 224/645 (34%), Positives = 352/645 (54%), Gaps = 72/645 (11%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +  GG    ++ D+G 
Sbjct: 9   RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGAKRIDVDVEQGGVKLLRVRDDGS 68

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++++++P+A+ RH TSKI   +D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 69  GISADDLPLALARHATSKIRNLEDLEQVMSLGFRGEALASISSVARLTLTSRTRDADQAW 128

Query: 120 QIAISGEKIS-SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++  V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+R+A+A
Sbjct: 129 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKTEKTEFDHLQEVIKRLALA 188

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R++ + G  F+  A+ +  + N + L G+ G
Sbjct: 189 RFDVAFHLRHNGKTILSLHEAHDDAARARRVAAICGSGFLEQALPIEIERNGLHLWGWVG 248

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTFNR  A+  Y F+NGR V+DK +   +R AY + +  GR+P   L  E+DP  VDVN
Sbjct: 249 LPTFNRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFALFFEVDPAAVDVN 308

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RFR+  ++ +F+  ++ +A+                     D  P+  L   
Sbjct: 309 VHPTKHEVRFRDGRMVHDFLYGTLHRALG--------------------DVRPEDQLAGS 348

Query: 359 ATSL----TNTQEKLF--LQENRLSTNDLL--PSDDPTYS-------------------E 391
            T+     T  +   F    E RL+ N LL  P   P ++                   +
Sbjct: 349 VTTAIVRPTGLEAGEFGPQGEMRLAANALLEQPQAQPAFNTASGASAGGAYQYQYTPRPQ 408

Query: 392 DNDPVEESEATHYQ----------------------LGIACAQIHQNYIISQTTDGLVIV 429
              PV E++A + +                      LG A AQ+   YI+S+   GLV+V
Sbjct: 409 STVPVAEAQAAYREFFAPLPEANANALPAGQEDIPPLGYALAQLKGIYILSENAQGLVLV 468

Query: 430 DQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAER 489
           D HAAHER+++E+++    S  ++ Q LL PE + + + E     EH     RLG + +R
Sbjct: 469 DMHAAHERIMYERLKIAMASEGLSGQPLLVPESLAVSQREADCAEEHAAWFQRLGFELQR 528

Query: 490 FGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSG 549
            GP  +AIR+IPA+L +    +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ 
Sbjct: 529 LGPETLAIRQIPALLKQAEANRLVGDVLSDLMEYGTSDRIQAHLNELLGTMACHGAIRAN 588

Query: 550 RKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           R++   EMN LLR+ME    S QCNHGRPT+ +L L D++KLF R
Sbjct: 589 RRLALPEMNGLLRDMENTERSGQCNHGRPTWTQLGLDDLDKLFLR 633


>gi|289623754|ref|ZP_06456708.1| DNA mismatch repair protein [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289648629|ref|ZP_06479972.1| DNA mismatch repair protein [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|320321886|gb|EFW77982.1| DNA mismatch repair protein [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320331009|gb|EFW86983.1| DNA mismatch repair protein [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330865892|gb|EGH00601.1| DNA mismatch repair protein [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 648

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 219/625 (35%), Positives = 349/625 (55%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDVDVEQAGIKLLKVRDDGG 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++  V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    + +   R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTSRARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S       +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPENQLGGSVPVAAEPRPTGPEAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQEN---------------RLSTNDLLPSDDPTYSEDNDP-- 395
             +      L   Q + F +                 R ++   +      Y E   P  
Sbjct: 382 GEMRLANNVLEQPQGEPFARPAAGGGAGSGYQYQYTPRPTSGVPVAEAQSAYREFFAPLP 441

Query: 396 ------VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                 + ES      LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    +
Sbjct: 442 STAPSSLPESPGDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMAN 501

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE + + + E     EH     RLG + +R GP  +AIR+IPA+L +   
Sbjct: 502 EGLSGQPLLVPESLAVSQREADCAEEHIATFQRLGFELQRLGPETLAIRQIPALLKQAEA 561

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    
Sbjct: 562 NRLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTER 621

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L+D++KLF R
Sbjct: 622 SGQCNHGRPTWTQMGLNDLDKLFLR 646


>gi|71738065|ref|YP_272865.1| DNA mismatch repair protein [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|298484916|ref|ZP_07003015.1| DNA mismatch repair protein MutL [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|71558618|gb|AAZ37829.1| DNA mismatch repair protein MutL [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|298160603|gb|EFI01625.1| DNA mismatch repair protein MutL [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 648

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 219/625 (35%), Positives = 348/625 (55%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDVDVEQAGIKLLKVRDDGG 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++  V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTMLSLHEAHDDTARARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S       +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPENQLGGSVPVAAEPRPTGPEAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQEN---------------RLSTNDLLPSDDPTYSEDNDP-- 395
             +      L   Q + F +                 R ++   +      Y E   P  
Sbjct: 382 GEMRLANNVLEQPQGEPFARPAAGGGAGSGYQYQYTPRPTSGVPVAEAQSAYREFFAPLP 441

Query: 396 ------VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                 + ES      LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    +
Sbjct: 442 SAASSSLPESPGDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMAN 501

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE + + + E     EH     RLG + +R GP  +AIR+IPA+L +   
Sbjct: 502 EGLSGQPLLVPESLAVSQREADCAEEHIATFQRLGFELQRLGPETLAIRQIPALLKQAEA 561

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    
Sbjct: 562 NRLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTER 621

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L+D++KLF R
Sbjct: 622 SGQCNHGRPTWTQMGLNDLDKLFLR 646


>gi|313500875|gb|ADR62241.1| MutL [Pseudomonas putida BIRD-1]
          Length = 632

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 218/625 (34%), Positives = 356/625 (56%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLD+ + R++  +  GG    ++ D+G 
Sbjct: 6   RIQLLSPRLANQIAAGEVVERPASVAKELLENSLDSGARRIDVEVEQGGVKLLKVRDDGS 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++++++P+A+ RH TSKI +  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 66  GISADDLPLALARHATSKIRELEDLEGVLSLGFRGEALASISSVARLTLTSRTASASEAW 125

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++  V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VIRR+A+A
Sbjct: 126 QVETEGRDMTPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIRRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V F       +   ++          R+  + G  F+  A+ ++ + N + L G+ G
Sbjct: 186 RFDVGFHLRHNGKSILSLHEAHDETARARRVGAICGPGFMEQALPIDVERNGLRLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL LE++P  VDVN
Sbjct: 246 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLELEPNGVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAIN----KKGISTSSVLSKKMISSFHQDN----- 349
           VHP K  +RFR    + +F+  ++ +A+     +  ++  + + + +  +  Q       
Sbjct: 306 VHPTKHEVRFREGRSVHDFLYGTLHRALADVRPEDQLAAPAAVPELVRPTGQQAGEFGPQ 365

Query: 350 ------APKTHLPKYA-TSLTNTQEKLFLQ-ENRLSTNDLLPSDD--PTYSEDNDPVE-- 397
                 +P    P+    S +N+      Q +     +  LP+ +    Y E   P+E  
Sbjct: 366 GEMRLASPVLEQPRAPQQSFSNSGSGAGYQYQYTPRPSQPLPAAEAQAVYREFYKPLEGG 425

Query: 398 --------ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                   ES+     LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    S
Sbjct: 426 AAPATALPESKGDIPPLGYALAQLKGIYILAENAVGLVLVDMHAAHERIMYERLKVAMAS 485

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE + L + E     EH +   RLG + +R GP  +AIR+IPA+L +   
Sbjct: 486 EGLSGQPLLVPETLALSQREADCAEEHSQWFQRLGFELQRLGPETLAIRQIPALLKQAEA 545

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L++D++ ++++  T+  +Q  +  +L TMAC+G++R+ R++   EMN LLR+ME    
Sbjct: 546 NRLVQDVLADLMEYGTSDRIQAHLNELLGTMACHGAVRANRRLAIPEMNALLRDMENTER 605

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L D++KLF R
Sbjct: 606 SGQCNHGRPTWTQMGLDDLDKLFLR 630


>gi|289207679|ref|YP_003459745.1| DNA mismatch repair protein MutL [Thioalkalivibrio sp. K90mix]
 gi|288943310|gb|ADC71009.1| DNA mismatch repair protein MutL [Thioalkalivibrio sp. K90mix]
          Length = 626

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 230/629 (36%), Positives = 360/629 (57%), Gaps = 40/629 (6%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I KLSE++INQIAAGE++ERP+  +KEL+EN+LDA S+R+E  +  GG    QI+DNG
Sbjct: 1   MSIEKLSEQLINQIAAGEVVERPASVVKELVENALDAGSTRIEVRLEQGGIRLIQISDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  +E+P+A+ RH TSKI   +D   +HT GFRGEALPSI +VS L++ S       G
Sbjct: 61  CGIHRDELPLALSRHATSKIRSMEDLEALHTLGFRGEALPSIASVSRLSMTSAVEGERNG 120

Query: 119 AQIAISGEKI-SSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
            ++   G  +     P A   GT VEVRDLFF +PAR  F+++E+ E N    VIR  A 
Sbjct: 121 WRLTGDGSDVFREAAPAAHPVGTTVEVRDLFFNVPARRKFVRTERTEFNHCETVIRTQAA 180

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           A P+V+FT     ++R  ++  +   +  +R+  ++GE F+  A  + E+   + L G+ 
Sbjct: 181 ACPEVAFTLR--HNDRVVLDLPAA-ADPAQRVRALLGEAFMGAATPVGEQRAGLKLSGWL 237

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G PT +R   +Q + F+NGR ++D+ + + +R AY + +  GR+P+ VL LE+DP QVDV
Sbjct: 238 GAPTQSRAQPDQQFFFVNGRAIRDRVLAAAVRKAYQDVLYHGRHPMFVLELELDPVQVDV 297

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAI-----NKKGI--------STSSVLSKKMISS 344
           N HP K  +RFR   ++ +FI  ++ KA+        G+         ++    ++ I +
Sbjct: 298 NAHPTKQEVRFRESRMVHDFIFHALHKALADVRPGDGGMPGYLPADTGSAPAPQERAIPA 357

Query: 345 FHQDNA-PKTHLPKYA----------------TSLTNTQEKLFLQENRLSTNDLLPSDDP 387
           F ++ A      P+Y                  S T++       E R       P+  P
Sbjct: 358 FPRERALSGLGAPEYRAEARSPAAGSGDRREYASGTSSDYAAAWAEFRGPAAVAEPA--P 415

Query: 388 TYSEDNDPVEESEATHYQ--LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQ 445
              E      ES+       LG A  Q+ + +I+++   GL++VD HAAHER+ +E++++
Sbjct: 416 RSFEAAGGASESDDAEGMPPLGFALGQVAETFILAENASGLIVVDMHAAHERITYERLKR 475

Query: 446 DFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILS 505
           ++ S  ITSQ LL PE +D+   E AL  EH   L  LG + +R GP  +A+R  PA+L 
Sbjct: 476 EWGSQGITSQPLLVPETLDVTPAEAALAEEHAGVLGALGFELDRAGPETLALRAAPALLR 535

Query: 506 KKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREME 565
            ++  QL+RD++ ++     ++  +  +  +L TMAC+GS+R+GR++   EMN+LLR+ME
Sbjct: 536 GRDTAQLVRDVLADLAAVGYSHRAEGEMNAVLGTMACHGSVRAGRRLTLPEMNQLLRDME 595

Query: 566 KNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
               S QCNHGRPT+++L    +++LF R
Sbjct: 596 ATERSGQCNHGRPTWVELDHHALDRLFLR 624


>gi|88798917|ref|ZP_01114499.1| DNA mismatch repair protein [Reinekea sp. MED297]
 gi|88778397|gb|EAR09590.1| DNA mismatch repair protein [Reinekea sp. MED297]
          Length = 632

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 215/616 (34%), Positives = 349/616 (56%), Gaps = 28/616 (4%)

Query: 6   LSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTS 65
           LS ++ NQIAAGE++ERP+  +KELIENSLDA ++R+E  I  GG    ++ DNG G+  
Sbjct: 16  LSPRLANQIAAGEVVERPASVVKELIENSLDAGATRIEIEIEQGGVKLIRVRDNGRGIPQ 75

Query: 66  EEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAI 123
           +++ +A+ RH TSK+   D+   + + GFRGEAL S+ +VS LTL S+P   +   Q+  
Sbjct: 76  DDLALALARHATSKVYSLDELEALGSLGFRGEALASVASVSRLTLTSKPANQSEAWQVQS 135

Query: 124 SGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKV 182
            G  +++ + P A   GT VEVRDLFF  PAR  FL++E+ E N + +V++R A++   V
Sbjct: 136 HGRDMATELAPAAHTDGTTVEVRDLFFNTPARRKFLRTEKTEFNHLEEVVKRQALSRFDV 195

Query: 183 SFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTF 242
           +F+        + +    T      RI+Q++  +F+ NA+ +  +   + + G+ G+PTF
Sbjct: 196 AFSLRHNNRTIHSLRAAHTQAEQQRRIAQLLKPEFMTNALVVETERAGLRMTGWVGLPTF 255

Query: 243 NRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPA 302
           +R   +  Y F+NGR V+DK I   ++ AY + +  GR+P  VL LE+D   VDVNVHP 
Sbjct: 256 SRSMPDMQYFFVNGRVVKDKVIGHAVKQAYRDVLYHGRHPCFVLFLELDSSGVDVNVHPT 315

Query: 303 KSYIRFRNPTIIRNFIIQSIQKAI------NKKGIS------------TSSVLSKKMISS 344
           K  +RFR+  ++ +F+   + +A+      N  G S             S + + +    
Sbjct: 316 KHEVRFRDQRLVHDFLFSQLHRALADVRPENDVGSSFDNPMTAPPQPRVSGLEAGEFRGQ 375

Query: 345 FHQDNAPKTHLPKYATSLTNT------QEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE 398
            H D  P    P    S + T      ++  F Q+ +   ++   ++     +   P  E
Sbjct: 376 NHLDMRPSGSGPMVDASASGTSSLGVSEQVSFYQQLQQPGSEAGAANAGFTPQPQLPQSE 435

Query: 399 SEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLL 458
           +      LG A AQ+H  YI+S++  GL+IVD HAAHER+ +E+M+Q ++   + +Q LL
Sbjct: 436 T-PDMPPLGFAVAQLHGIYILSESEQGLIIVDMHAAHERITYERMKQQYDHQGVQAQPLL 494

Query: 459 TPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIID 518
            P  + + E E     E    L + G++ +R GP  + +R++P  L + ++  L+R ++ 
Sbjct: 495 VPLALSVSEKEADAAEEFSALLQQFGLELQRSGPEKMTVRQVPVYLQQADVEPLVRSVLA 554

Query: 519 EIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRP 578
           ++I   T+  +Q     IL+TMAC+GS+R+ R++   EMN LLR+ME+   S QCNHGRP
Sbjct: 555 DVIQHETSDAIQAHRNEILSTMACHGSVRANRRLTVPEMNALLRDMERTERSGQCNHGRP 614

Query: 579 TFIKLKLSDIEKLFGR 594
           T+ +L  S+++KLF R
Sbjct: 615 TWTQLTQSELDKLFLR 630


>gi|325983238|ref|YP_004295640.1| DNA mismatch repair protein MutL [Nitrosomonas sp. AL212]
 gi|325532757|gb|ADZ27478.1| DNA mismatch repair protein MutL [Nitrosomonas sp. AL212]
          Length = 597

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 229/609 (37%), Positives = 339/609 (55%), Gaps = 34/609 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L E +INQIAAGE++ERP+ A+KE++ENS+DA + ++   +  GG    ++ D+G G
Sbjct: 4   IKPLPELLINQIAAGEVVERPAAALKEILENSVDAGAKKINVQLQQGGVKQIRVADDGIG 63

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +T +E+ +A+ RH TSKIS  +D   I + GFRGEAL SI A+S LTL SR    +   Q
Sbjct: 64  ITKDELQLALTRHSTSKISTLEDLHQITSLGFRGEALASIAAISRLTLASREAAQSHAWQ 123

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I + G+ +S   P ++  GT ++V DL+F IPAR  FLKSE  E     +  +R+A++  
Sbjct: 124 ILVEGKSVSQPMPASLAQGTTLDVNDLYFNIPARRKFLKSEATEFAHCDETFKRIALSQS 183

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            + F       +  K+      G+  +RI+ V+G++F   A  ++E+S E+ L G   +P
Sbjct: 184 GIEFVLQ----HNGKVRRHLRAGDPAQRIASVLGDEFKQTAAWIDEQSAEMHLHGMVALP 239

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
            + R + +  Y F+N R V DK I   +R AY + + L R+P  VL L+I P  VDVNVH
Sbjct: 240 AYARSSRDTQYFFVNHRFVNDKLISHALREAYRDVLHLERHPAFVLFLDIHPGSVDVNVH 299

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           P K+ +RFR P  +  FI  +I KA++     +SS     +   +     PKT  P    
Sbjct: 300 PTKTEVRFREPRALHQFIFHAINKALSSGQKESSSGEPVSIARPY--PIYPKTG-PAQGG 356

Query: 361 SLTNTQE---KLFLQENR------LSTNDLLPSDDPTYS------EDNDPVEESEATHYQ 405
           +++        LF  E R      ++     P+  P  S      +DN P          
Sbjct: 357 TVSQPASFYGTLFGTEARSIPTIPVNIAPAAPAIKPDKSIAIGNNQDNHP---------- 406

Query: 406 LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDL 465
           LG A  Q+H  YI++Q   GL++VD HAAHER+++EK++Q  +  +I  Q LL P     
Sbjct: 407 LGFALGQLHGIYILAQNARGLIVVDMHAAHERILYEKLKQALDQHEIPMQPLLIPVTFYA 466

Query: 466 LEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSST 525
              E A I E+   L +LG +     P  +A+R +PA L   +I QL RDI+ EI +   
Sbjct: 467 EHLEIAAIEENQTILDQLGFEIAVLSPTTVAVRAVPATLQHADIAQLARDILREIREYGA 526

Query: 526 TYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKL 585
           +  L  +   ILATMAC+G+IR+ RK+   EMN LLREME    + QCNHGRPT+ +  L
Sbjct: 527 SQILTAKRNEILATMACHGAIRANRKLTLEEMNALLREMEMTERADQCNHGRPTWFETSL 586

Query: 586 SDIEKLFGR 594
           +D++KLF R
Sbjct: 587 ADLDKLFMR 595


>gi|126666949|ref|ZP_01737925.1| DNA mismatch repair protein [Marinobacter sp. ELB17]
 gi|126628665|gb|EAZ99286.1| DNA mismatch repair protein [Marinobacter sp. ELB17]
          Length = 630

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 219/635 (34%), Positives = 353/635 (55%), Gaps = 53/635 (8%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I  L  ++ NQIAAGE++ERP+  +KELIEN+LDA +SRV+  I  GG    ++ D+G G
Sbjct: 4   IHLLPPRLANQIAAGEVVERPASVVKELIENALDAGASRVDVDIEQGGVKLIRVRDDGCG 63

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           + +E++ +A+ RH TSKI+  DD   + + GFRGEAL SI +VS L+L SR       ++
Sbjct: 64  IAAEDLSLALSRHATSKITSLDDLEAVTSLGFRGEALASISSVSRLSLTSRTENQEAASK 123

Query: 121 IAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           + + G  + + V P A   G+ VEVRDLFF  PAR  FL++E+ E   + + +RR A++ 
Sbjct: 124 VEVEGRDMDAHVSPAAHPVGSTVEVRDLFFNTPARRKFLRTEKTEFGHVEECVRRQALSC 183

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
               F     +     +    +  +   RI+ + G+ FI+NAV ++ ++  + L G+  +
Sbjct: 184 FDTGFNLRHNQRAVQSLRPALSELDKERRIASLCGQQFIDNAVVISAEATGLKLWGWVAL 243

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF+R   +  Y F+NGR ++D+ +   +R AY + +   R+   VL LE+DP  VDVNV
Sbjct: 244 PTFSRSQTDLQYFFVNGRVIRDRLVAHAVRQAYRDVLYNNRHAAFVLYLEVDPGSVDVNV 303

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HP K  +RFR+  ++ +F+ +++ KA+    +     L   +  S  ++NA         
Sbjct: 304 HPTKHEVRFRDGRLVHDFLFRTLHKALAD--VRPDDHLRGAVAQSLGRENA--------F 353

Query: 360 TSLTNTQEKLFLQENRLSTNDL-LPSD---DPTYSEDNDPVEESEATH----YQ------ 405
            ++T + E L    +  S + L  P      P     +DP  + +A+     YQ      
Sbjct: 354 AAVTGSAEGLPSPGSAASESALGYPGGIERTPGQVTHSDPQHQWQASDQLGFYQALNAGG 413

Query: 406 --------------------------LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLI 439
                                     LG A AQ+H  YI++Q+  GL++VD HAAHER+ 
Sbjct: 414 GVSAGRQASVAAHPPQMLEDSEQEPPLGYAIAQLHGIYILAQSRTGLIMVDMHAAHERIT 473

Query: 440 FEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIRE 499
           +E+M+Q      + SQ LL P  + + + E  L+  H ++L +LG+  ER GP  +A+R+
Sbjct: 474 YERMKQALAQQDLKSQPLLVPLSLAVSQKEAGLVETHGDELQQLGLVIERIGPETLAVRQ 533

Query: 500 IPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNR 559
           IPA+L   +  QL+RD++ ++I+   +  +Q   + +L TMAC+GS+R+ R++   EMN 
Sbjct: 534 IPALLRGADGEQLVRDVLSDLIEHGQSDRVQAVTQELLGTMACHGSVRANRQLTIPEMNS 593

Query: 560 LLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LLR+ME    S QCNHGRPT+  + L++++KLF R
Sbjct: 594 LLRDMEATERSGQCNHGRPTWTVMTLAELDKLFLR 628


>gi|15600139|ref|NP_253633.1| DNA mismatch repair protein [Pseudomonas aeruginosa PAO1]
 gi|218894041|ref|YP_002442910.1| DNA mismatch repair protein [Pseudomonas aeruginosa LESB58]
 gi|254238339|ref|ZP_04931662.1| DNA mismatch repair protein MutL [Pseudomonas aeruginosa C3719]
 gi|20455148|sp|Q9HUL8|MUTL_PSEAE RecName: Full=DNA mismatch repair protein mutL
 gi|226723040|sp|B7V209|MUTL_PSEA8 RecName: Full=DNA mismatch repair protein mutL
 gi|9951226|gb|AAG08331.1|AE004907_9 DNA mismatch repair protein MutL [Pseudomonas aeruginosa PAO1]
 gi|126170270|gb|EAZ55781.1| DNA mismatch repair protein MutL [Pseudomonas aeruginosa C3719]
 gi|218774269|emb|CAW30086.1| DNA mismatch repair protein MutL [Pseudomonas aeruginosa LESB58]
          Length = 633

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 215/626 (34%), Positives = 347/626 (55%), Gaps = 33/626 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLDA S R++  +  GG    ++ D+G 
Sbjct: 6   RIQLLSPRLANQIAAGEVVERPASVAKELLENSLDAGSRRIDVEVEQGGIKLLRVRDDGR 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++++P+A+ RH TSKI +  D   + + GFRGEAL SI +V+ LT+ SR        
Sbjct: 66  GIPADDLPLALARHATSKIRELEDLERVMSLGFRGEALASISSVARLTMTSRTADAGEAW 125

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  +   V+P A   GT VEVRDLFF  PAR  FL++E+ E + + +VI+R+A+A
Sbjct: 126 QVETEGRDMQPRVQPAAHPVGTSVEVRDLFFNTPARRKFLRAEKTEFDHLQEVIKRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F         + ++          R+  V G+ F+  A+ +  + N + L G+ G
Sbjct: 186 RFDVAFHLRHNGKTIFALHEARDELARARRVGAVCGQAFLEQALPIEVERNGLHLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R   +  Y ++NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 246 LPTFSRSQPDLQYFYVNGRMVRDKLVAHAVRQAYRDVLYNGRHPTFVLFFEVDPAVVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINK-------KGISTSSVLSKKMISSFHQDNAP 351
           VHP K  +RFR+  ++ +F+  ++ +A+ +            +S+   +   +   +  P
Sbjct: 306 VHPTKHEVRFRDSRMVHDFLYGTLHRALGEVRPDDQLAPPGATSLTEPRPTGAAAGEFGP 365

Query: 352 KTHLPKYATSLTNTQEKLFLQENRLSTNDLL-------PSDDPTYSEDND---------P 395
           +  +    + L +   ++       ++           P   P+ +E            P
Sbjct: 366 QGEMRLAESVLESPAARVGWSGGSSASGGSSGYSAYTRPEAPPSLAEAGGAYKAYFAPLP 425

Query: 396 VEESEATHYQ-------LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFN 448
             E+ A   +       LG A AQ+   YI+++   GLV+VD HAAHER+ +E+++    
Sbjct: 426 AGEAPAALPESAQDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERITYERLKVAMA 485

Query: 449 STKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKN 508
           S  +  Q LL PE I + E E     EH     RLG + +R GP ++AIR+IPA+L +  
Sbjct: 486 SEGLRGQPLLVPESIAVSEREADCAEEHSSWFQRLGFELQRLGPESLAIRQIPALLKQAE 545

Query: 509 IPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNP 568
             QL+RD+I ++++  T+  +Q  +  +L TMAC+G++R+ R++   EMN LLR+ME   
Sbjct: 546 ATQLVRDVIADLLEYGTSDRIQAHLNELLGTMACHGAVRANRRLTLPEMNALLRDMEITE 605

Query: 569 NSSQCNHGRPTFIKLKLSDIEKLFGR 594
            S QCNHGRPT+ +L L +++KLF R
Sbjct: 606 RSGQCNHGRPTWTQLGLDELDKLFLR 631


>gi|296391786|ref|ZP_06881261.1| DNA mismatch repair protein [Pseudomonas aeruginosa PAb1]
          Length = 633

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 215/626 (34%), Positives = 347/626 (55%), Gaps = 33/626 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLDA S R++  +  GG    ++ D+G 
Sbjct: 6   RIQLLSPRLANQIAAGEVVERPASVAKELLENSLDAGSRRIDVEVEQGGIKLLRVRDDGR 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++++P+A+ RH TSKI +  D   + + GFRGEAL SI +V+ LT+ SR        
Sbjct: 66  GIPADDLPLALARHATSKIRELEDLERVMSLGFRGEALASISSVARLTMTSRTADAGEAW 125

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  +   V+P A   GT VEVRDLFF  PAR  FL++E+ E + + +VI+R+A+A
Sbjct: 126 QVETEGRDMQPRVQPAAHPVGTSVEVRDLFFNTPARRKFLRAEKTEFDHLQEVIKRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F         + ++          R+  V G+ F+  A+ +  + N + L G+ G
Sbjct: 186 RFDVAFHLRHNGKTIFALHEARDELARARRVGAVCGQAFLEQALPIEVERNGLHLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R   +  Y ++NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 246 LPTFSRSQPDLQYFYVNGRMVRDKLVAHAVRQAYRDVLYNGRHPTFVLFFEVDPAVVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINK-------KGISTSSVLSKKMISSFHQDNAP 351
           VHP K  +RFR+  ++ +F+  ++ +A+ +            +S+   +   +   +  P
Sbjct: 306 VHPTKHEVRFRDSRMVHDFLYGTLHRALGEVRPDDQLAPPGATSLTEPRPTGAAAGEFGP 365

Query: 352 KTHLPKYATSLTNTQEKLFLQENRLSTNDLL-------PSDDPTYSEDND---------P 395
           +  +    + L +   ++       ++           P   P+ +E            P
Sbjct: 366 QGEMRLAESVLESPAARVGWSGGSSASGGSSGYSAYTRPETPPSLAEAGGAYKAYFAPLP 425

Query: 396 VEESEATHYQ-------LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFN 448
             E+ A   +       LG A AQ+   YI+++   GLV+VD HAAHER+ +E+++    
Sbjct: 426 AGEAPAALPESAQDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERITYERLKVAMA 485

Query: 449 STKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKN 508
           S  +  Q LL PE I + E E     EH     RLG + +R GP ++AIR+IPA+L +  
Sbjct: 486 SEGLRGQPLLVPESIAVSEREADCAEEHSSWFQRLGFELQRLGPESLAIRQIPALLKQAE 545

Query: 509 IPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNP 568
             QL+RD+I ++++  T+  +Q  +  +L TMAC+G++R+ R++   EMN LLR+ME   
Sbjct: 546 ATQLVRDVIADLLEYGTSDRIQAHLNELLGTMACHGAVRANRRLTLPEMNALLRDMEITE 605

Query: 569 NSSQCNHGRPTFIKLKLSDIEKLFGR 594
            S QCNHGRPT+ +L L +++KLF R
Sbjct: 606 RSGQCNHGRPTWTQLGLDELDKLFLR 631


>gi|107104045|ref|ZP_01367963.1| hypothetical protein PaerPA_01005118 [Pseudomonas aeruginosa PACS2]
 gi|116053095|ref|YP_793414.1| DNA mismatch repair protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|313109947|ref|ZP_07795875.1| DNA mismatch repair protein MutL [Pseudomonas aeruginosa 39016]
 gi|122256892|sp|Q02F72|MUTL_PSEAB RecName: Full=DNA mismatch repair protein mutL
 gi|115588316|gb|ABJ14331.1| DNA mismatch repair protein MutL [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|310882377|gb|EFQ40971.1| DNA mismatch repair protein MutL [Pseudomonas aeruginosa 39016]
          Length = 633

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 215/626 (34%), Positives = 347/626 (55%), Gaps = 33/626 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLDA S R++  +  GG    ++ D+G 
Sbjct: 6   RIQLLSPRLANQIAAGEVVERPASVAKELLENSLDAGSRRIDVEVEQGGIKLLRVRDDGR 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++++P+A+ RH TSKI +  D   + + GFRGEAL SI +V+ LT+ SR        
Sbjct: 66  GIPADDLPLALARHATSKIRELEDLERVMSLGFRGEALASISSVARLTMTSRTADAGEAW 125

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  +   V+P A   GT VEVRDLFF  PAR  FL++E+ E + + +VI+R+A+A
Sbjct: 126 QVETEGRDMQPRVQPAAHPVGTSVEVRDLFFNTPARRKFLRAEKTEFDHLQEVIKRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F         + ++          R+  V G+ F+  A+ +  + N + L G+ G
Sbjct: 186 RFDVAFHLRHNGKTIFALHEARDELARARRVGAVCGQAFLEQALPIEVERNGLHLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R   +  Y ++NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 246 LPTFSRSQPDLQYFYVNGRMVRDKLVAHAVRQAYRDVLYNGRHPTFVLFFEVDPAVVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINK-------KGISTSSVLSKKMISSFHQDNAP 351
           VHP K  +RFR+  ++ +F+  ++ +A+ +            +S+   +   +   +  P
Sbjct: 306 VHPTKHEVRFRDSRMVHDFLYGTLHRALGEVRPDDQLAPPGATSLTEPRPTGAAAGEFGP 365

Query: 352 KTHLPKYATSLTNTQEKLFLQENRLSTNDLL-------PSDDPTYSEDND---------P 395
           +  +    + L +   ++       ++           P   P+ +E            P
Sbjct: 366 QGEMRLAESVLESPAARVGWSGGSSASGGSSGYSAYTRPEAPPSLAEAGGAYKAYFAPLP 425

Query: 396 VEESEATHYQ-------LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFN 448
             E+ A   +       LG A AQ+   YI+++   GLV+VD HAAHER+ +E+++    
Sbjct: 426 AGEAPAALPESAQDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERITYERLKVAMA 485

Query: 449 STKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKN 508
           S  +  Q LL PE I + E E     EH     RLG + +R GP ++AIR+IPA+L +  
Sbjct: 486 SEGLRGQPLLVPESIAVSEREADCAEEHSSWFQRLGFELQRLGPESLAIRQIPALLKQAE 545

Query: 509 IPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNP 568
             QL+RD+I ++++  T+  +Q  +  +L TMAC+G++R+ R++   EMN LLR+ME   
Sbjct: 546 ATQLVRDVIADLLEYGTSDRIQAHLNELLGTMACHGAVRANRRLTLPEMNALLRDMEITE 605

Query: 569 NSSQCNHGRPTFIKLKLSDIEKLFGR 594
            S QCNHGRPT+ +L L +++KLF R
Sbjct: 606 RSGQCNHGRPTWTQLGLDELDKLFLR 631


>gi|190570725|ref|YP_001975083.1| DNA mismatch repair protein MutL [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|190356997|emb|CAQ54386.1| DNA mismatch repair protein MutL [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
          Length = 602

 Score =  405 bits (1040), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 234/621 (37%), Positives = 359/621 (57%), Gaps = 47/621 (7%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I  L  K IN+IAAGE+IERP+  +KEL+EN++DA SS +E  I  GG++   +TDNG
Sbjct: 1   MAIILLDTKTINRIAAGEVIERPASVVKELVENAIDAGSSEIEIKIESGGRNLITVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            G+  E++ +A  RH TSK+SD +   I   GFRGEALPSI AVS + L S+     +GA
Sbjct: 61  NGIEKEDLELAFMRHATSKLSDGELIEIRHLGFRGEALPSIAAVSRMKLSSKA----SGA 116

Query: 120 QIAIS-----GEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRR 174
           + A S     GEK+  + P ++  GT +EVRDLFF  P RL FLK+E+ ET  I D++  
Sbjct: 117 KEAWSIRYEGGEKVREITPCSLLQGTYIEVRDLFFATPNRLKFLKTERAETQSIVDIVNN 176

Query: 175 MAIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQ 234
           +A+    + FT ++      K   Q++  N   R+ + I ++F +N++E+ E+   I L+
Sbjct: 177 LAMINYSIGFTLTSGNKKLLKYVKQTSLFN---RLCE-IEKEFQSNSLEVKEEEEGIKLK 232

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           G+   P  NRGN+ Q Y F+NGR ++D  ++  IR AY + IP  RYP  VL LE+   Q
Sbjct: 233 GHICKPNVNRGNSTQIYTFVNGRPMKDNLLVGAIRYAYHDFIPNNRYPFAVLHLEVPYDQ 292

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMI-----SSFHQDN 349
           VDVNVHP KS +RF+N  +I   + + I K ++ +  +    + +++I     S    D+
Sbjct: 293 VDVNVHPNKSEVRFQNKRLIYEIVRRGIIKTLSTRFAAGDQGIEEELIFNDSKSQEQIDS 352

Query: 350 APKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDD-----PTYSEDNDPVEESEA--- 401
             K    ++       +++  L ENRL      P +       T+     P ++      
Sbjct: 353 QEKKDQKEF------YEKRPSLLENRLMKEFNAPDERRQSLPETFKYGESPPQKGTMVLE 406

Query: 402 -------THYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITS 454
                    + LG A  Q++  YII++    L+IVDQHAAHERLI+E +      T I  
Sbjct: 407 RKQIDLIADHPLGYARCQVYNTYIIAEAKGKLIIVDQHAAHERLIYECL------TSIKR 460

Query: 455 QTLLTPEIIDLL-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLL 513
           Q  L PE +++  +    ++  + + L  +G   E    + + ++EIPAIL   N+ +++
Sbjct: 461 QKFLLPETVEIKNQAGMEMVGMYKDRLFEMGFGIEIESEDKVRVKEIPAILGTINVKEMV 520

Query: 514 RDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQC 573
            +I+D +++   T  +++++  ILAT+AC+GSIR+GR M+  EMN L+R+ME+ P + QC
Sbjct: 521 MNIVDRLMEIGDTLPIEEKVNKILATIACHGSIRAGRAMKLEEMNELMRQMEETPYAGQC 580

Query: 574 NHGRPTFIKLKLSDIEKLFGR 594
           NHGRPT+I++KLSDIEKLF R
Sbjct: 581 NHGRPTYIEMKLSDIEKLFER 601


>gi|329895360|ref|ZP_08270985.1| DNA mismatch repair protein MutL [gamma proteobacterium IMCC3088]
 gi|328922373|gb|EGG29717.1| DNA mismatch repair protein MutL [gamma proteobacterium IMCC3088]
          Length = 606

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 224/618 (36%), Positives = 353/618 (57%), Gaps = 41/618 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  +KE++ENSLDA ++R++  + GGG    ++ DNG 
Sbjct: 3   RIHSLSPQLANQIAAGEVVERPASVVKEVVENSLDAGATRIDIEVEGGGVKRIRVRDNGQ 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ S+++P+A+ RH TSKI   DD   + + GFRGEAL SI +VS L L +    + +  
Sbjct: 63  GIESDDLPLALARHATSKIVSLDDLEAVSSLGFRGEALASIASVSRLALSTNASSDASAG 122

Query: 120 QIAISG--EKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
            +A S   +++ +VRP     GT V+VRDLFF  PAR  FL++E+ E N + +V++R+A+
Sbjct: 123 VLAESEGRDQVVAVRPTPHPQGTTVDVRDLFFNTPARRKFLRTEKTEFNHLEEVVKRLAL 182

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPE--RISQVIGEDFINNAVELNEKSNEITLQG 235
           A   V+F+ S   + R  +N    +    +  R++ + G  FI+  V ++ + + + L G
Sbjct: 183 ARFDVAFSLS--HNGRVVLNLPVADSTAAQQRRVATICGPAFIDQVVHIDSERSGLGLSG 240

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           + G+PTF+R  A+  Y F+NGR ++DK +   I+ AY + +  GR+P  VL L I+P  V
Sbjct: 241 WVGLPTFSRSQADLQYFFVNGRVIRDKLVAHAIKQAYRDVLYHGRHPAFVLYLTINPALV 300

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKK---MISSFHQDN--- 349
           DVNVHP K  +RFR+   + NF+  ++ +A+     +   V S++   +    H D    
Sbjct: 301 DVNVHPTKHEVRFRDSREVHNFLFSTLHRALADVRPADQLVSSERFQPLAEGGHLDTHTG 360

Query: 350 ---------APKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESE 400
                       +H P   +S  N    L +Q    S   L P   P  S        SE
Sbjct: 361 EVSQGALSWGGMSHRPDVGSS--NRPSPLAVQSQMSSYGRLHPVPLPEQS--------SE 410

Query: 401 ATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTP 460
                LG A AQ+   YI+S+   GLV+VD HAAHER+ +E++++   S  + SQ LL P
Sbjct: 411 EEAPPLGYALAQLQGIYILSENAQGLVLVDMHAAHERITYERLKEADASEGVRSQPLLVP 470

Query: 461 EIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEI 520
           + I + + E  L  EH+     LG++ E     ++ IR +P +L   ++ QL+RD++ ++
Sbjct: 471 QAIAVSQKEVELAREHEAVFVGLGLQLEPASEESLLIRSVPTLLRSADMEQLVRDVLSDL 530

Query: 521 IDSSTTYTLQDRI----ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHG 576
            +    Y   DRI    E IL+TMAC+GS+R+ R +   EMN LLR++E    + QCNHG
Sbjct: 531 AE----YGQSDRIAAEREAILSTMACHGSVRANRSLTIPEMNALLRDIEATERAGQCNHG 586

Query: 577 RPTFIKLKLSDIEKLFGR 594
           RPT+ +L L++++KLF R
Sbjct: 587 RPTWTQLSLTELDKLFLR 604


>gi|220934074|ref|YP_002512973.1| DNA mismatch repair protein MutL [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995384|gb|ACL71986.1| DNA mismatch repair protein MutL [Thioalkalivibrio sp. HL-EbGR7]
          Length = 611

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 205/595 (34%), Positives = 347/595 (58%), Gaps = 11/595 (1%)

Query: 9   KIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTSEEI 68
           ++INQIAAGE++ERP+  +KEL+ENSLDA + R++  +  GG    +I D+G G+  +E+
Sbjct: 17  QLINQIAAGEVVERPASVVKELLENSLDAGARRIQVDVEQGGVRRIRIRDDGTGIPPDEL 76

Query: 69  PMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI-AISG 125
            +A+ RH TSKI+  +D   + + GFRGEALPSI +VS LTL S  P+ ++G  I    G
Sbjct: 77  SLALSRHATSKIASLEDLERVASLGFRGEALPSIASVSRLTLTSATPEADSGWTIQGDGG 136

Query: 126 EKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVSFT 185
           ++  +  P A   GT V+V+DLFF +PAR  FL++E+ E   + +V+RR+A++   V F 
Sbjct: 137 DRFEAPMPAAHPQGTTVDVKDLFFNVPARRKFLRAERTEFGHLEEVVRRIALSRFGVGFE 196

Query: 186 FSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNRG 245
            +  +    ++   S      +R++ + GE F   AV ++ ++  + L G+ G+PT++R 
Sbjct: 197 LTHNQKPGLRLPPASDEAGQLDRVAAICGEAFATQAVRIDHEAAGLRLSGWLGLPTYSRS 256

Query: 246 NANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSY 305
            A+  Y ++NGR V+D+ I   +R AY + +  GR+P  VL LE+DP  VDVN HPAK  
Sbjct: 257 QADLQYFYVNGRMVRDRLISHAVRQAYQDVLFHGRHPAFVLYLELDPALVDVNAHPAKHE 316

Query: 306 IRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTN- 364
           +RFR   ++ +F+ +S+ + + +  +     ++   + +  ++ A ++            
Sbjct: 317 VRFRESRLVHDFLFRSLHRVLAE--LRPGQAVAPARLETPGREPAAESRAGGDWGGAGWR 374

Query: 365 -TQEKLFLQ-ENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQ---LGIACAQIHQNYII 419
            +Q  L L+    + T   L +     +    PV   E    +   LG A AQ+H  YI+
Sbjct: 375 PSQSGLGLRVAEVMETYASLHTPAAPAAMPMSPVMAFERQAEELPPLGYALAQLHGVYIL 434

Query: 420 SQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDED 479
           +Q  +GLV+VD HAAHER+ +E++++ +    + SQ LL P  +++   E   +    E 
Sbjct: 435 AQNAEGLVLVDMHAAHERITYERLKRGYWGEGLKSQPLLVPATLNVSAREADRVETDAEA 494

Query: 480 LHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILAT 539
             R G + ER GP  + +R +P +L++ +   L+RD++ +++    +  +++ +  +LA 
Sbjct: 495 FSRFGFELERIGPEQLRVRAVPTLLARADTETLVRDVLADLLAHGESSRVEETVNELLAG 554

Query: 540 MACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           MAC+GS+R+ R++   EMN LLR+ME    S QCNHGRPT+++L +  ++KLF R
Sbjct: 555 MACHGSVRANRQLTVPEMNALLRDMEATERSGQCNHGRPTWVQLSMGQLDKLFMR 609


>gi|224826520|ref|ZP_03699621.1| DNA mismatch repair protein MutL [Lutiella nitroferrum 2002]
 gi|224601121|gb|EEG07303.1| DNA mismatch repair protein MutL [Lutiella nitroferrum 2002]
          Length = 629

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 225/630 (35%), Positives = 339/630 (53%), Gaps = 42/630 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENSLDA + R+   +A GG    ++TDNG 
Sbjct: 3   RIHALPDHLVNQIAAGEVVERPASALKEMLENSLDAGADRITVDLAQGGIKLIRVTDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+A+ RH TSKI+   D  ++ T GFRGE L SI +VS LTL+SRP +     
Sbjct: 63  GIVPDDLPLALDRHATSKIASLADLESVATLGFRGEGLASIASVSRLTLISRPHEEAHAY 122

Query: 120 QI-AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           QI AI G  + SV P A  PGT VEV DL+F  PAR  FLKSE  E         R+A+A
Sbjct: 123 QIIAIDG-ALHSVEPAAHAPGTSVEVVDLYFNTPARRKFLKSENTEYAHCAATFERIALA 181

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +P+V F         +++  QS      ER+  ++G+DF+  A+ L   +  + L G+  
Sbjct: 182 HPQVEFLLRHNGKVVWRLPAQS----LAERVGALLGKDFVEAALPLETAAGGLQLAGFVA 237

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            PT+++ + +  Y ++NGR V+DK     +R AY + +   R+P   L L IDP  VDVN
Sbjct: 238 SPTYSKASRDAQYFYVNGRFVRDKTAQHALRQAYRDVLHHDRHPAYALFLTIDPAGVDVN 297

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQK------------AINKKGISTSSVLSKKMIS--- 343
           VHP K  +RFR    I  F+  S+ K                +G++T S  +    S   
Sbjct: 298 VHPTKIEVRFRESQAIHQFLFHSVNKALAATTAGAAPAVALAEGVATPSSANLSGASPAP 357

Query: 344 ----SFHQDNAPKTHLPKY-----------ATSLTNTQEKLFL----QENRLSTNDLLPS 384
               +  Q    +T +  Y           A       + +F     +E +  T    P 
Sbjct: 358 AGLFATSQTGNGRTPVQSYRYEQQSIPLGVAREAIGVYDAMFSGLREEERQADTRPAGPL 417

Query: 385 DDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMR 444
             P  +     + +S+     LG A AQ+H  YI+SQ  +GL++VD HAAHER+++E+++
Sbjct: 418 PSPLPAATLATLPDSDDGIPPLGFALAQLHGVYILSQCQEGLIVVDMHAAHERIVYERLK 477

Query: 445 QDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAIL 504
               +  I  Q LL P        E A + EH E++ RLG++     P  IA+R +P  L
Sbjct: 478 NALEADSIPMQPLLLPVSFAADRMEAATVHEHGEEMKRLGVELAPLSPTQIAVRGVPVWL 537

Query: 505 SKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREM 564
              N  +L R ++ ++ +   T  L +R   +LATMAC+G++R+ R++   EMN LLR+M
Sbjct: 538 KDGNPVELARAVLKDVREFGLTRVLTERRNELLATMACHGAVRANRQLTLAEMNALLRDM 597

Query: 565 EKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           E    S QCNHGRPT+ +L + D++ LF R
Sbjct: 598 EATERSGQCNHGRPTWSRLTMKDLDNLFMR 627


>gi|26991574|ref|NP_746999.1| DNA mismatch repair protein [Pseudomonas putida KT2440]
 gi|37999611|sp|Q88DD1|MUTL_PSEPK RecName: Full=DNA mismatch repair protein mutL
 gi|24986662|gb|AAN70463.1|AE016688_2 DNA mismatch repair protein MutL [Pseudomonas putida KT2440]
          Length = 632

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 218/625 (34%), Positives = 355/625 (56%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLD+ + R++  +  GG    ++ D+G 
Sbjct: 6   RIQLLSPRLANQIAAGEVVERPASVAKELLENSLDSGARRIDIEVEQGGVKLLKVRDDGS 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++++++P+A+ RH TSKI +  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 66  GISADDLPLALARHATSKIRELEDLEGVLSLGFRGEALASISSVARLTLTSRTASASEAW 125

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++  V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VIRR+A+A
Sbjct: 126 QVETEGRDMTPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIRRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V F       +   ++          R+  + G  F+  A+ ++ + N + L G+ G
Sbjct: 186 RFDVGFHLRHNGKSILSLHEAHDEIARARRVGAICGPGFMEQALPIDVERNGLRLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL LE++P  VDVN
Sbjct: 246 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLELEPNGVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAIN----KKGISTSSVLSKKMISSFHQDN----- 349
           VHP K  +RFR    + +F+  ++ +A+     +  ++  + + + +  +  Q       
Sbjct: 306 VHPTKHEVRFREGRSVHDFLYGTLHRALADVRPEDQLAAPAAVPELVRPTGQQAGEFGPQ 365

Query: 350 ------APKTHLPKYA-TSLTNTQEKLFLQ-ENRLSTNDLLPSDD--PTYSEDNDPVE-- 397
                 +P    P+    S +N       Q +     +  LP+ +    Y E   P+E  
Sbjct: 366 GEMRLASPVLEQPRAPQQSFSNGGSGAGYQYQYTPRPSQPLPAAEAQAVYREFYKPLETG 425

Query: 398 --------ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                   ES+     LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    S
Sbjct: 426 AAPATALPESQGDIPPLGYALAQLKGIYILAENAVGLVLVDMHAAHERIMYERLKVAMAS 485

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE + L + E     EH +   RLG + +R GP  +AIR+IPA+L +   
Sbjct: 486 EGLSGQPLLVPETLALSQREADCAEEHAQWFQRLGFELQRLGPETLAIRQIPALLKQAEA 545

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L++D++ ++++  T+  +Q  +  +L TMAC+G++R+ R++   EMN LLR+ME    
Sbjct: 546 NRLVQDVLADLMEYGTSDRIQAHLNELLGTMACHGAVRANRRLAIPEMNALLRDMENTER 605

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L D++KLF R
Sbjct: 606 SGQCNHGRPTWTQMGLDDLDKLFLR 630


>gi|152988751|ref|YP_001350994.1| DNA mismatch repair protein [Pseudomonas aeruginosa PA7]
 gi|166232101|sp|A6VD59|MUTL_PSEA7 RecName: Full=DNA mismatch repair protein mutL
 gi|150963909|gb|ABR85934.1| DNA mismatch repair protein MutL [Pseudomonas aeruginosa PA7]
          Length = 633

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 215/626 (34%), Positives = 346/626 (55%), Gaps = 33/626 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLDA + R++  +  GG    ++ D+G 
Sbjct: 6   RIQLLSPRLANQIAAGEVVERPASVAKELLENSLDAGARRIDVEVEQGGVKLLRVRDDGR 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++++P+A+ RH TSKI +  D   + + GFRGEAL SI +V+ LT+ SR        
Sbjct: 66  GIPADDLPLALARHATSKIRELEDLERVMSLGFRGEALASISSVARLTMTSRTADAGEAW 125

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  +   V+P A   GT VEVRDLFF  PAR  FL++E+ E + + +VI+R+A+A
Sbjct: 126 QVETEGRDMQPRVQPAAHPVGTSVEVRDLFFNTPARRKFLRAEKTEFDHLQEVIKRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F         + ++          R+  V G+ F+  A+ +  + N + L G+ G
Sbjct: 186 RFDVAFHLRHNGKTIFALHEARDELARARRVGAVCGQAFLEQALPIEVERNGLHLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R   +  Y ++NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 246 LPTFSRSQPDLQYFYVNGRMVRDKLVAHAVRQAYRDVLYNGRHPTFVLFFEVDPAVVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINK-------KGISTSSVLSKKMISSFHQDNAP 351
           VHP K  +RFR+  ++ +F+  ++ +A+ +            +S+   +   +   +  P
Sbjct: 306 VHPTKHEVRFRDSRMVHDFLYGTLHRALGEVRPDDQLAPPGATSLTEPRPTGAAAGEFGP 365

Query: 352 KTHLPKYATSLTNTQEKLFLQENRLSTNDLL-------PSDDPTYSEDND---------P 395
           +  +    + L +   ++       S+           P   P+ +E            P
Sbjct: 366 QGEMRLAESVLESPAARVGWSGGASSSGASSGYSAYTRPEAPPSLAEAGGAYKAYFAPLP 425

Query: 396 VEESEATHYQ-------LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFN 448
             E+ A   +       LG A AQ+   YI+++   GLV+VD HAAHER+ +E+++    
Sbjct: 426 AGEAPAALPESAQDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERITYERLKVAMA 485

Query: 449 STKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKN 508
           S  +  Q LL PE I + E E     EH     RLG + +R GP  +AIR+IPA+L +  
Sbjct: 486 SEGLRGQPLLVPESIAVSEREADCAEEHSGWFQRLGFELQRLGPETLAIRQIPALLKQAE 545

Query: 509 IPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNP 568
             QL+RD+I ++++  T+  +Q  +  +L TMAC+G++R+ R++   EMN LLR+ME   
Sbjct: 546 ATQLVRDVIADLLEYGTSDRIQAHLNELLGTMACHGAVRANRRLTLPEMNALLRDMEITE 605

Query: 569 NSSQCNHGRPTFIKLKLSDIEKLFGR 594
            S QCNHGRPT+ +L L +++KLF R
Sbjct: 606 RSGQCNHGRPTWTQLGLDELDKLFLR 631


>gi|170723845|ref|YP_001751533.1| DNA mismatch repair protein [Pseudomonas putida W619]
 gi|229486326|sp|B1JAD6|MUTL_PSEPW RecName: Full=DNA mismatch repair protein mutL
 gi|169761848|gb|ACA75164.1| DNA mismatch repair protein MutL [Pseudomonas putida W619]
          Length = 633

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 222/646 (34%), Positives = 351/646 (54%), Gaps = 73/646 (11%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLD+ + R++  +  GG    ++ D+G 
Sbjct: 6   RIQLLSPRLTNQIAAGEVVERPASVAKELLENSLDSGARRIDVEVEQGGVKLLRVRDDGS 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++++++P+A+ RH TSKI +  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 66  GISADDLPLALARHATSKIRELEDLEGVLSLGFRGEALASISSVARLTLTSRTASASEAW 125

Query: 120 QIAISGEKIS-SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++  V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VIRR+A+A
Sbjct: 126 QVETEGRDMTPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIRRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F       +   ++          R+  + G  F+  A+ ++ + N + L G+ G
Sbjct: 186 RFDVAFHLRHNGKSILSLHEAHDETARARRVGAICGGGFMEQALPIDVERNGLRLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL LE++P  VDVN
Sbjct: 246 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLELEPNGVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RFR    + +F+  ++ +A+                     D  P+ HL   
Sbjct: 306 VHPTKHEVRFREGRSVHDFLYGTLHRAL--------------------ADVRPEDHLASA 345

Query: 359 A------TSLTNTQEKLF--LQENRLSTNDLLPSDDPTYSEDND---------------- 394
                  T  T  Q   F    E RL++  L     P +S  N                 
Sbjct: 346 PAAAAEITRPTGQQAGEFGPQGEMRLASPVLEQPQVPQHSISNGGSGAGYQYQYTPRPSQ 405

Query: 395 --PVEESEATHYQ------------------------LGIACAQIHQNYIISQTTDGLVI 428
             P  E++A + +                        LG A AQ+   YI+++   GLV+
Sbjct: 406 PLPAAEAQAVYREFYKPLNDDAAGPATLPQSQGDIPPLGYALAQLKGIYILAENAAGLVL 465

Query: 429 VDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAE 488
           VD HAAHER+++E+++    S  ++ Q LL PE + L + E     EH +   RLG + +
Sbjct: 466 VDMHAAHERIMYERLKVAMASEGLSGQPLLVPESLALSQREADCAEEHAQWFQRLGFELQ 525

Query: 489 RFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRS 548
           R GP  +AIR+IPA+L +    +L++D++ ++++  T+  +Q  +  +L TMAC+G++R+
Sbjct: 526 RLGPETLAIRQIPALLKQAEANRLVQDVLADLMEYGTSDRIQAHLNELLGTMACHGAVRA 585

Query: 549 GRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            R++   EMN LLR+ME    S QCNHGRPT+ ++ L D++KLF R
Sbjct: 586 NRRLAIPEMNALLRDMENTERSGQCNHGRPTWTQMGLDDLDKLFLR 631


>gi|148549974|ref|YP_001270076.1| DNA mismatch repair protein [Pseudomonas putida F1]
 gi|148514032|gb|ABQ80892.1| DNA mismatch repair protein MutL [Pseudomonas putida F1]
          Length = 633

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 217/625 (34%), Positives = 355/625 (56%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLD+ + R++  +  GG    ++ D+G 
Sbjct: 7   RIQLLSPRLANQIAAGEVVERPASVAKELLENSLDSGARRIDIEVEQGGVKLLKVRDDGS 66

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++++++P+A+ RH TSKI +  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 67  GISADDLPLALARHATSKIRELEDLEGVLSLGFRGEALASISSVARLTLTSRTASASEAW 126

Query: 120 QIAISGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++  V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VIRR+A+A
Sbjct: 127 QVETEGRDMTPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIRRLALA 186

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V F       +   ++          R+  + G  F+  A+ ++ + N + L G+ G
Sbjct: 187 RFDVGFHLRHNGKSILSLHEAHDETARARRVGAICGPGFMEQALPIDVERNGLRLWGWVG 246

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL LE++P  VDVN
Sbjct: 247 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLELEPNGVDVN 306

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAIN----KKGISTSSVLSKKMISSFHQDN----- 349
           VHP K  +RFR    + +F+  ++ +A+     +  ++  + + + +  +  Q       
Sbjct: 307 VHPTKHEVRFREGRSVHDFLYGTLHRALADVRPEDQLAAPAAVPELVRPTGQQAGEFGPQ 366

Query: 350 ------APKTHLPKYA-TSLTNTQEKLFLQ-ENRLSTNDLLPSDD--PTYSEDNDPVE-- 397
                 +P    P+    S +N       Q +     +  LP+ +    Y E   P++  
Sbjct: 367 GEMRLASPVLEQPRAPQQSFSNGGSGAGYQYQYTPRPSQPLPAAEAQAVYREFYKPLDTG 426

Query: 398 --------ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                   ES+     LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    S
Sbjct: 427 AAPATALPESQGDIPPLGYALAQLKGIYILAENAVGLVLVDMHAAHERIMYERLKVAMAS 486

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE + L + E     EH +   RLG + +R GP  +AIR+IPA+L +   
Sbjct: 487 EGLSGQPLLVPETLALSQREADCAEEHAQWFQRLGFELQRLGPETLAIRQIPALLKQAEA 546

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L++D++ ++++  T+  +Q  +  +L TMAC+G++R+ R++   EMN LLR+ME    
Sbjct: 547 NRLVQDVLADLMEYGTSDRIQAHLNELLGTMACHGAVRANRRLAIPEMNALLRDMENTER 606

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L D++KLF R
Sbjct: 607 SGQCNHGRPTWTQMGLDDLDKLFLR 631


>gi|167035937|ref|YP_001671168.1| DNA mismatch repair protein [Pseudomonas putida GB-1]
 gi|189030406|sp|B0KKZ7|MUTL_PSEPG RecName: Full=DNA mismatch repair protein mutL
 gi|166862425|gb|ABZ00833.1| DNA mismatch repair protein MutL [Pseudomonas putida GB-1]
          Length = 632

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 215/625 (34%), Positives = 354/625 (56%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLD+ + R++  +  GG    ++ D+G 
Sbjct: 6   RIQLLSPRLANQIAAGEVVERPASVAKELLENSLDSGARRIDVEVEQGGVKLLKVRDDGS 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++++++P+A+ RH TSKI +  D   + + GFRGEAL SI +V+ LT+ SR    +   
Sbjct: 66  GISADDLPLALARHATSKIRELEDLEGVMSLGFRGEALASISSVARLTMTSRTASASEAW 125

Query: 120 QIAISGEKIS-SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++  V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VIRR+A+A
Sbjct: 126 QVETEGRDMTPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIRRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V F       +   ++          R+  + G  F+  A+ ++ + N + L G+ G
Sbjct: 186 RFDVGFHLRHNGKSILSLHEAHDETARARRVGAICGPGFMEQALPIDVERNGLRLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL LE++P  VDVN
Sbjct: 246 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLELEPNGVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAIN----KKGISTSSVLSKKMISSFHQDN----- 349
           VHP K  +RFR    + +F+  ++ +A+     +  ++  + + +    +  Q       
Sbjct: 306 VHPTKHEVRFREGRSVHDFLYGTLHRALADVRPEDQLAAPAAVPELARPTGQQAGEFGPQ 365

Query: 350 ------APKTHLPKYA-TSLTNTQEKLFLQ-ENRLSTNDLLPSDD--PTYSEDNDPVE-- 397
                 +P    P+    S +N       Q +     +  LP+ +    Y E   P++  
Sbjct: 366 GEMRLASPVLEQPRAPQQSFSNGGSGAGYQYQYTPRPSQPLPAAEAQAVYREFYKPLDNG 425

Query: 398 --------ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                   ES+     LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    S
Sbjct: 426 AAAATALPESQGDIPPLGYALAQLKGIYILAENAVGLVLVDMHAAHERIMYERLKVAMAS 485

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE + L + E     EH +   RLG + +R GP  +A+R+IPA+L +   
Sbjct: 486 EGLSGQPLLVPETLALSQREADCAEEHAQWFQRLGFELQRLGPETLAVRQIPALLKQAEA 545

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L++D++ ++++  T+  +Q  +  +L TMAC+G++R+ R++   EMN LLR+ME    
Sbjct: 546 NRLVQDVLADLMEYGTSDRIQAHLNELLGTMACHGAVRANRRLAIPEMNALLRDMENTER 605

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L D++KLF R
Sbjct: 606 SGQCNHGRPTWTQMGLDDLDKLFLR 630


>gi|254427517|ref|ZP_05041224.1| DNA mismatch repair protein MutL [Alcanivorax sp. DG881]
 gi|196193686|gb|EDX88645.1| DNA mismatch repair protein MutL [Alcanivorax sp. DG881]
          Length = 622

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 213/626 (34%), Positives = 347/626 (55%), Gaps = 41/626 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI+ L  ++ NQIAAGE++ERP+  +KEL+EN+LDA S  +   +  GG    ++ DNG 
Sbjct: 3   KIQLLDSRLANQIAAGEVVERPASVLKELLENALDAGSESISVDVEQGGVKLVRVRDNGN 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+A+ RH TSKI   DD   I T GFRGEAL +I +VS L+L S       G 
Sbjct: 63  GIERDDLPLALSRHATSKIRGLDDLEAIGTLGFRGEALAAISSVSRLSLASNVEGEAEGW 122

Query: 120 QIAISGEKIS-SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+ + G  ++ +V P     GT V +RDLFF  PAR  FL++E+ E N + +V RR+A++
Sbjct: 123 QVTVEGRDMAPTVAPAGHPRGTTVTMRDLFFNTPARRRFLRTEKTEFNHLEEVFRRIALS 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
               +F  +  +   +++     +     R++++ G+ F+  AV ++ + + + L G+ G
Sbjct: 183 EFNTAFRLTHNQKVIHQLPAGLDDTLRAARVAKLCGKGFMEQAVAVDVERDGLRLHGWMG 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y ++NGR ++DK +   +R AYA+ +  GR+P  VL LE+DP  VDVN
Sbjct: 243 LPTFSRSQADLQYFYVNGRVIRDKVVSHAVRQAYADVLYHGRHPAYVLFLELDPAMVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------------------NKKGISTSSVLSKK 340
           VHP K  +RFR   ++  F+  S+ +AI                     G+ T+   S+ 
Sbjct: 303 VHPTKHEVRFREQRMVHGFLYSSLHRAIAGVRPGQELAGSVVDEGATAAGMDTAMAPSQG 362

Query: 341 MISSFHQDNAPKTHLPKYATSL--TNTQEKLFLQENRLS----------TNDLLPSDDPT 388
            +S      A  + L + A            + Q  R +           ++  PS  P 
Sbjct: 363 NMSLTSPAGAGMSSLSRPAGQAYPPTGGSAFYGQGARQADAYGALVGQQVSESAPSMMPP 422

Query: 389 YSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFN 448
            SED         T   LG A AQ+H  +I+++   G+V+VD HAAHER+ +E+++Q + 
Sbjct: 423 ASEDE--------TVPPLGYAVAQLHGIFILAENQQGMVVVDMHAAHERITYERLKQSWA 474

Query: 449 STKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKN 508
             K+ SQ LL P  + +   E     +  E   RLG   ER GP  + +RE+PA+L   +
Sbjct: 475 DDKVRSQPLLVPVSLAVSSREADFAEQQPEVFSRLGFGVERAGPETLVVREVPALLRNGD 534

Query: 509 IPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNP 568
              ++RD++ +++   ++  +  +++ +L+TMAC+GS+R+ R++   EMN LLR+ME   
Sbjct: 535 SESMVRDVLSDLLAQGSSERIAQKLDELLSTMACHGSVRANRRLTIPEMNALLRDMEATE 594

Query: 569 NSSQCNHGRPTFIKLKLSDIEKLFGR 594
            S QCNHGRPT+ ++ + D+++LF R
Sbjct: 595 RSGQCNHGRPTWTQMSIKDLDRLFMR 620


>gi|294669657|ref|ZP_06734724.1| hypothetical protein NEIELOOT_01558 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291308570|gb|EFE49813.1| hypothetical protein NEIELOOT_01558 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 638

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 227/638 (35%), Positives = 344/638 (53%), Gaps = 49/638 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ +E  + GGG     + DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGAAEIEVELDGGGIKRLLVRDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++++P+A+ RH TSKI+   D  ++ + GFRGE L SI +VS LTL SR P +    
Sbjct: 63  GIHADDLPLALSRHATSKIASLTDLEHVSSMGFRGEGLASIASVSRLTLTSRTPGSAHAH 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +I      +S V   A   GT VEV DLFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 EIRAEDGILSPVAAAAHPEGTTVEVADLFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P+ +F+      + +K   QS      ER + ++G DF   ++ +      + L G    
Sbjct: 183 PETAFSLKRDGKSVFKYPPQS----LEERAAAILGSDFQTASLPVEGGGGSMRLYGLIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G   Q Y F+N R V+DK +L  ++ AY + +     P  VL LE+ P  VDVNV
Sbjct: 239 PTFAKGKTGQQYCFVNRRFVRDKVMLHAVKQAYRDVLHQALAPAFVLFLELPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQ---DNA 350
           HP K+ IRFRN   +   +  ++ KA+        + +  +  +  KM+    +   +N 
Sbjct: 299 HPTKTEIRFRNSQAVHQLVFHTLDKALAGTRADRTESVGNAGEVLHKMMGLAEERPSENH 358

Query: 351 PKTHLP-------------KYATSLTNTQEKLFLQENRLSTN---DLLPSDDP------- 387
             +H P              Y+ +    Q  L L E+R + +   +L   DD        
Sbjct: 359 GGSHAPFSDGLQAGKTAPVSYSAARVPQQRSLSLNESRRAIDTYAELYRRDDELAQLEHE 418

Query: 388 ---------TYSEDNDPVEESEATH-YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHER 437
                      S+  D        + Y LG A AQ+   YI++Q  D L++VD HAA ER
Sbjct: 419 RFGGAIAQTAVSDGRDEAHGGGGGNAYPLGFAIAQLLGIYILAQAEDSLLLVDMHAAAER 478

Query: 438 LIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIA 496
           + +EKM RQ     ++ SQ+LL P       GE A + +  ++L R G+     G N IA
Sbjct: 479 VNYEKMKRQRGEQGRLNSQSLLIPVTFSAGHGEIAALADFGDELRRFGLDLSPIGENRIA 538

Query: 497 IREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIE 556
           +R +P +L K ++ QL RD++ E  +   +  ++ R   ILATM+C+GSIR+GRK+   E
Sbjct: 539 VRAVPQMLGKSDVEQLARDMLREFAEVGASQAVEARENRILATMSCHGSIRAGRKLTLPE 598

Query: 557 MNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           MN LLR+ME+ P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 MNALLRDMEQTPRSNQCNHGRPTWVKLTLKELDALFLR 636


>gi|308389547|gb|ADO31867.1| DNA mismatch repair protein [Neisseria meningitidis alpha710]
          Length = 658

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 229/659 (34%), Positives = 360/659 (54%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIGLALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E    T ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCTTMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS     PERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPTQS----LPERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI--NKKGISTS------------SVLSKKM---- 341
           HP K+ IRFR+   +   +  ++ KA+   +  ++ S             V+S  M    
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRANLTESVGNAGEVLHDITGVVSTPMPSEN 358

Query: 342 --------ISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
                    S +   N P          KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DSENLFDSASDYPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMNTYAE 418

Query: 380 --------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
                   DL            +PS+ P    D  P+ +   S++    LG A AQ+   
Sbjct: 419 LYKKTDDIDLELNRLEQARFGNMPSETPIPKTDT-PLSDGLPSQSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM RQ   + K+ SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKRQRRENGKLQSQRLLIPSTFAASHEECAALAD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           H E L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++    
Sbjct: 538 HAEALAGFGLELSDMGGNTLAVRTVPAMLGKADVVSLAKDVLGELAQVGSSQTIEEHENR 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSVRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|325271237|ref|ZP_08137782.1| DNA mismatch repair protein [Pseudomonas sp. TJI-51]
 gi|324103640|gb|EGC00942.1| DNA mismatch repair protein [Pseudomonas sp. TJI-51]
          Length = 632

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 214/625 (34%), Positives = 350/625 (56%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLD+ + R++  +  GG    ++ D+G 
Sbjct: 6   RIQLLSPRLANQIAAGEVVERPASVAKELLENSLDSGARRIDVEVEQGGVKLLKVRDDGS 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++++++P+A+ RH TSKI +  D   + + GFRGEAL SI +V+ LTL SR        
Sbjct: 66  GISADDLPLALARHATSKIRELEDLEGVLSLGFRGEALASISSVARLTLTSRTASATEAW 125

Query: 120 QIAISG-EKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G + +  V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VIRR+A+A
Sbjct: 126 QVETEGRDMLPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIRRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V F       +   ++          R+  + G  F+  A+ ++ + N + L G+ G
Sbjct: 186 RFDVGFHLRHNGKSILSLHEAHDEVARARRVGAICGPGFMEQALPIDVERNGLRLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL LE++P  VDVN
Sbjct: 246 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLELEPNGVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR    + +F+  ++ +A+      ++     +   + +       +  P+
Sbjct: 306 VHPTKHEVRFREGRSVHDFLYGTLHRALADVRPEDQLAAPAAVPEAVRATGQQAGEFGPQ 365

Query: 353 THL------------PKYATSLTNTQEKLFLQENRLSTNDLLPSD-DPTYSEDNDPVE-- 397
             +            P++  S   +      Q     +  L  ++    Y E   P++  
Sbjct: 366 GEMRLASPVLEQPRAPQHTASNGGSGAGYQYQYTPRPSPPLPAAEAQAVYREFYKPLDNG 425

Query: 398 --------ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                   ES+     LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    S
Sbjct: 426 AAPAATLPESQGDIPPLGYALAQLKGIYILAENAVGLVLVDMHAAHERIMYERLKVAMAS 485

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE + L + E     EH +   RLG + +R GP  +AIR+IPA+L +   
Sbjct: 486 EGLSGQPLLVPETLALSQREADCAEEHAQWFQRLGFELQRLGPETLAIRQIPALLKQAEA 545

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L++D++ ++++  T+  +Q  +  +L TMAC+G++R+ R++   EMN LLR+ME    
Sbjct: 546 NRLVQDVLADLMEYGTSDRIQAHLNELLGTMACHGAVRANRRLAIPEMNALLRDMENTER 605

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L D++KLF R
Sbjct: 606 SGQCNHGRPTWTQMGLDDLDKLFLR 630


>gi|302878544|ref|YP_003847108.1| DNA mismatch repair protein MutL [Gallionella capsiferriformans
           ES-2]
 gi|302581333|gb|ADL55344.1| DNA mismatch repair protein MutL [Gallionella capsiferriformans
           ES-2]
          Length = 629

 Score =  402 bits (1032), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 221/631 (35%), Positives = 344/631 (54%), Gaps = 47/631 (7%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR L E +INQIAAGE+IERP+ A+KEL+ENSLDA ++ +   +  GG    +I DNG G
Sbjct: 5   IRVLPELLINQIAAGEVIERPAAALKELLENSLDAGATDITVQLDNGGIKLLRIRDNGRG 64

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  +E+ +A+ RH TSKI+  DD  ++ + GFRGEAL S+ AV+ LTL SR   +  G  
Sbjct: 65  IVRDELALALMRHATSKIASLDDLQSVESMGFRGEALASMAAVAQLTLSSRTAHDTHGWM 124

Query: 121 I-AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           + AI G +IS   P +  PGT +E+R+L+F  PAR  FLKSE  E     +  +R+A++ 
Sbjct: 125 VEAIDG-RISEAAPASHPPGTTIELRELYFNTPARRKFLKSEATEFAHCEEAFKRIALSR 183

Query: 180 PKVSFTFSTIKSNRYKMN----------FQSTNGNFPE-----RISQVIGEDFINNAVEL 224
           P V F+        +++N              +G + +     R++ ++G +F N AV +
Sbjct: 184 PDVGFSLQHNGRTVWQLNPGLRIEDRGLRGEDDGGWMQNAALKRVAALLGAEFGNAAVPV 243

Query: 225 NEKSNEITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVV 284
           +  +  +TL G   +P ++RGN +  Y F+NGR V+DK     +R AY + +   R+P  
Sbjct: 244 SGSAANLTLHGLAALPAYSRGNRDAQYFFVNGRFVRDKVASHALRQAYQDILHHQRHPAF 303

Query: 285 VLLLEIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISS 344
           VL LE+   QVDVNVHPAKS +RFR    I  FI  ++Q+A+    +S ++   + +   
Sbjct: 304 VLFLELPAEQVDVNVHPAKSEVRFREGQGIHQFIFHTLQQALAAPALSGAATQERAI--- 360

Query: 345 FHQDNAP---KTHLPKYATSLTNTQEKLFLQ----------------ENRLSTNDLLPSD 385
                AP   +  +P  A  L  T +    Q                E ++ +    P++
Sbjct: 361 ----QAPIPTQQRIPLAAAQLNATYQVWEAQTGSGKWGVKSGEAASGEWKVESGQTAPAE 416

Query: 386 DPTYSEDNDPVEESE--ATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKM 443
             +      P       +T + LG A AQ+   YI++Q   GL++VD HAAHER+++EK+
Sbjct: 417 SSSLPAIQSPTTSHYPLSTDHPLGFALAQLSGVYILAQNEQGLIVVDMHAAHERIVYEKL 476

Query: 444 RQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAI 503
           +   +   I +Q LL P        + A +    + LH+LG   +   P  IAIR +P +
Sbjct: 477 KASMDHEAIATQPLLIPVCFQTDAHDVATVEAEQDALHKLGFDIKPLSPTQIAIRAMPVL 536

Query: 504 LSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLRE 563
           L +       RDI++E+     +  L +R   +LA++AC+G++R+ R +   EMN LLRE
Sbjct: 537 LKQAEAEAAARDILNELRKYGGSRMLTERRNELLASLACHGAVRANRILSVPEMNALLRE 596

Query: 564 MEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ME+   S QCNHGRPT+  L +++++K+F R
Sbjct: 597 MEQTERSGQCNHGRPTWFALTMNELDKMFMR 627


>gi|34496797|ref|NP_901012.1| DNA mismatch repair protein [Chromobacterium violaceum ATCC 12472]
 gi|34102652|gb|AAQ59017.1| DNA mismatch repair protein [Chromobacterium violaceum ATCC 12472]
          Length = 631

 Score =  402 bits (1032), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 220/632 (34%), Positives = 343/632 (54%), Gaps = 44/632 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I++L + ++NQIAAGE++ERP+ A+KE++ENSLDA ++R+   +A GG    ++TDNG 
Sbjct: 3   RIQRLPDHLVNQIAAGEVVERPASALKEMLENSLDAGATRISVDLAQGGIKLIRVTDNGA 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++++P+A+ RH TSKI+  DD  ++ T GFRGE L S+ +VS LTL SRP   +   
Sbjct: 63  GIAADDLPLALDRHATSKIASLDDLESVSTLGFRGEGLASVASVSRLTLTSRPHDADHAH 122

Query: 120 QI-AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           QI AI G  +  V P A   GT VEV DL+F  PAR  FLKSE  E         R+A+A
Sbjct: 123 QIIAIDG-TLHPVEPAAHPHGTSVEVVDLYFNTPARRKFLKSENTEYAHCAATFERIALA 181

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +P+V F         +++  QS      +R++ ++G+DF+  A+ L+ ++  + L G+  
Sbjct: 182 HPEVEFLLRHNGKVAWRLPSQSAE----DRVAALLGKDFVAAAIPLDSQAGPLALSGFVA 237

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            PT+++ + +  Y ++NGR V+DK     +R AY + +   R+P   L   ++P  VDVN
Sbjct: 238 SPTYSKASRDAQYFYVNGRFVRDKTAQHALRQAYRDVLHHDRHPAYALFFTLEPSGVDVN 297

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVL----------------SKKMI 342
           VHP K  +RFR    +  F+  S+ KA+       +  +                S  + 
Sbjct: 298 VHPTKIEVRFRESQAVHQFLFHSVHKALAGTSAGAAPTVQVEGAETAAPQLPRGESAPLF 357

Query: 343 SSFH----QDNAPKTHLPKY---------ATSLTNTQEKLF--LQENRLSTNDLLPSDDP 387
           +S         AP     +Y         A       +KLF  L+E   + +   P+   
Sbjct: 358 ASASPQPASSGAPAPQPFQYQQQSIPLNVAREAVGVYDKLFGGLREEERALSRPEPAMPS 417

Query: 388 TYSEDNDPVEESEATHYQ-----LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEK 442
             +    P   +   H +     LG A AQ+H  YI+SQ  +GL++VD HAAHER+++E+
Sbjct: 418 PAAPLLHPAVLAMPAHDENGIPPLGFALAQLHGVYILSQCAEGLILVDMHAAHERIVYER 477

Query: 443 MRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPA 502
           ++    S  I  Q LL P        E A   EH E++ RLG++     P  IA+R +P 
Sbjct: 478 LKAALESDAIPLQPLLLPVSFAADRMEVATAHEHGEEMKRLGVELAPLSPTQIAVRGVPV 537

Query: 503 ILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLR 562
            L   +  +L R ++ ++ +   T  L +R   +LATMAC+G++R+ R++   EMN LLR
Sbjct: 538 WLKDGDPVELARAVLKDVREFGLTQVLTERRNELLATMACHGAVRANRQLTLPEMNALLR 597

Query: 563 EMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +ME    S QCNHGRPT+ +L + D++KLF R
Sbjct: 598 DMEATERSGQCNHGRPTWTRLTMRDLDKLFMR 629


>gi|311695392|gb|ADP98265.1| LOW QUALITY PROTEIN: DNA mismatch repair protein mutL [marine
           bacterium HP15]
          Length = 630

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 215/637 (33%), Positives = 347/637 (54%), Gaps = 58/637 (9%)

Query: 6   LSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTS 65
           LS ++ NQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    ++ D+G G+  
Sbjct: 2   LSPRLANQIAAGEVVERPASVVKELVENALDAGANRVDVEVEQGGVKLIRVRDDGSGIEE 61

Query: 66  EEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAI 123
           +++P+A+ RH TSKI+  DD   + + GFRGEAL SI +VS LTL SR       +++ +
Sbjct: 62  DDLPLALSRHATSKIASLDDLEAVASLGFRGEALASISSVSRLTLTSRTESQEAASRVEV 121

Query: 124 SGEKISS-VRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKV 182
            G ++ + + P A   GT VEVRDLFF  PAR  FL++E+ E N + + +RR A++    
Sbjct: 122 EGREMDARISPAAHPVGTTVEVRDLFFNTPARRKFLRTEKTEFNHVEECVRRQALSRFDA 181

Query: 183 SFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTF 242
            FT    +     +    +  +   RI  + G+ FI+NAV ++ ++  + L G+  +PTF
Sbjct: 182 GFTLRHNQRVVQSLRPAESALDRERRIGSLCGQQFIDNAVVIDAEATGLRLWGWVALPTF 241

Query: 243 NRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPA 302
           +R  A+  Y F+NGR ++D+ +   +R AY + +   R+P  VL LE+DP  VDVNVHP 
Sbjct: 242 SRSQADLQYFFVNGRVIRDRLVAHAVRQAYRDVLYNNRHPAFVLYLEVDPATVDVNVHPT 301

Query: 303 KSYIRFRNPTIIRNFIIQSI-----------------------------QKAINKKGIST 333
           K  +RFR+  ++ +FI +++                             Q+A+   G S 
Sbjct: 302 KHEVRFRDGRLVHDFIFRTLHKALADVRPDDHFRGAVAQSFGREAVTQGQEAVPATGASA 361

Query: 334 SSVL-SKKMISSFH---------------QDNAPKTHLPKYATSLTNTQEKLFLQENRLS 377
            +    +  +SS+                Q     +    +  SL         Q   +S
Sbjct: 362 EAGWNGQPSVSSYGYPGGSGAGFGGQSQPQQEWRASDQMAFYQSLNAGGGSDGQQAMPVS 421

Query: 378 TNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHER 437
                P   P    D +P          LG A AQ+H  YI++Q   GL++VD HAAHER
Sbjct: 422 DRAATPMPTPPADSDQEP---------PLGYAIAQLHGIYILAQGRAGLIVVDMHAAHER 472

Query: 438 LIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAI 497
           + +E+M++      + SQ LL P  + + + +      H E+L +LG++ ER GP  +A+
Sbjct: 473 ITYERMKRALAEQDLKSQPLLVPLSLAVSQKKPP-TESHGEELQKLGLQIERIGPETLAV 531

Query: 498 REIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEM 557
           R++PA+L   +  QL+RD++ ++I+   +  ++     +L TMAC+GS+R+ R++   EM
Sbjct: 532 RQVPALLRGADTEQLVRDVLADLIEHGQSDRVEAVTHELLGTMACHGSVRANRQLTIPEM 591

Query: 558 NRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           N LLR+ME    S QCNHGRPT+  + +S+++KLF R
Sbjct: 592 NSLLRDMEATERSGQCNHGRPTWTLVTMSELDKLFLR 628


>gi|78485428|ref|YP_391353.1| DNA mismatch repair protein MutL [Thiomicrospira crunogena XCL-2]
 gi|78363714|gb|ABB41679.1| DNA mismatch repair protein MutL [Thiomicrospira crunogena XCL-2]
          Length = 630

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 218/635 (34%), Positives = 358/635 (56%), Gaps = 60/635 (9%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           + I  L   + +QIAAGE++ERP+  +KEL+EN+LD+ ++++E  I  GG+    + DNG
Sbjct: 13  LDISLLPSHLADQIAAGEVVERPASVVKELLENALDSGATQIEIQIEEGGEKLISVIDNG 72

Query: 61  FGMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+   ++ +AV RH TSKI  + D + + T GFRGEAL SI +VS LTL S+    +  
Sbjct: 73  MGIRQSQLMLAVSRHATSKIHTAQDLAAVATLGFRGEALASISSVSRLTLTSKFQGESAA 132

Query: 119 AQIAISGE-KISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
            Q++  GE + S   P A   GT VEV+DLFF  PAR  FL++ + E   I  +++R+ +
Sbjct: 133 WQLSGEGEGRWSEPTPTAHPQGTHVEVKDLFFNTPARKKFLRAARTEFMHIDQLVKRVML 192

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           + P++S      +    +++    +    +R+ Q++G  F++ ++ELN ++ +I L G+ 
Sbjct: 193 SRPEISMKLVHNQKVVRQVHAAHDDAALKQRLKQLMGTPFVDQSLELNFEAQDIQLSGWV 252

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G  TFNR   +  Y+F+NGR V+D+ +   ++ AYA+ +  GR+P  +L L I    VDV
Sbjct: 253 GQATFNRSQTDMQYLFVNGRIVRDRLLSYAVKQAYADVLYHGRHPAYLLFLNIPHDLVDV 312

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAI----------NKKGISTSSVLSKKMISSFHQ 347
           NVHPAK  +RF N   + +F+ +S+++A+          N   +  S+V S       HQ
Sbjct: 313 NVHPAKYEVRFANGRWVYDFLRRSVREAVTQPVGVASNPNNAALIPSNVFSGNHSGESHQ 372

Query: 348 DNAPKTH----------------------LPKYATSL-TNTQEKLFLQENRLSTNDLLPS 384
            ++  +                       +P YA +    T E L   +NR    D    
Sbjct: 373 MDSQVSQSAMQFQMPSSSASGSGMGVSESVPYYAMAPDAETVESL---KNRFHEAD---- 425

Query: 385 DDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEK-- 442
               YS+++ P+         LG A AQIH  +I+++   GLV+VD HAAHER+++E+  
Sbjct: 426 ---AYSQNSTPI---------LGYAKAQIHGVFILAENEKGLVLVDMHAAHERIVYERIV 473

Query: 443 ---MRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIRE 499
              M+Q +   ++ SQ LL P ++ L   +  +   + E+  +LG +AE FGP  +    
Sbjct: 474 YERMKQQWQQDRLISQPLLVPIVVSLESSQVQVWEAYQEEFQKLGFEAEAFGPEQLKFTM 533

Query: 500 IPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNR 559
           +P++LSK +IP+L+ D+I ++  +  T  + ++I  IL+TMAC+GS+R+ R +   EMN 
Sbjct: 534 VPSLLSKSDIPRLINDMIADLAVAGQTQLVDEKINAILSTMACHGSVRANRHLTLDEMNA 593

Query: 560 LLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LLR+ME   +S+QCNHGRPT+++L +  ++ LF R
Sbjct: 594 LLRDMEATESSAQCNHGRPTWVQLSMEQLDGLFMR 628


>gi|325201860|gb|ADY97314.1| DNA mismatch repair protein MutL [Neisseria meningitidis
           M01-240149]
 gi|325208388|gb|ADZ03840.1| DNA mismatch repair protein MutL [Neisseria meningitidis NZ-05/33]
          Length = 658

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 227/659 (34%), Positives = 360/659 (54%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIGLALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E    T ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCTTMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS     PERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPTQS----LPERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 341 -------MISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
                    S +   N P          KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DSENLFDSASDYPTGNKPDTRNAFGASGKTAPMPYQAARAPQQHSLSLRESRAAMNTYAE 418

Query: 380 --------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
                   DL            +PS+ P    D  P+ +   S++    LG A AQ+   
Sbjct: 419 LYKKTDDIDLELSRLEQARFGNMPSETPAPQTDT-PLSDGIPSQSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM RQ   + K+ SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGKLQSQRLLIPVTFATSHEECAALSD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           H + L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++    
Sbjct: 538 HADALAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLSELAQVGSSQTIEEHENR 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|121997465|ref|YP_001002252.1| DNA mismatch repair protein MutL [Halorhodospira halophila SL1]
 gi|121588870|gb|ABM61450.1| DNA mismatch repair protein MutL [Halorhodospira halophila SL1]
          Length = 620

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 217/618 (35%), Positives = 346/618 (55%), Gaps = 31/618 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR L + +I+QIAAGE++ERP   +KEL+ENSLDA + RVE  I  GGK   +I D+G G
Sbjct: 6   IRPLPDNLIDQIAAGEVVERPGSVVKELVENSLDAGAGRVEVQIERGGKQRIRIADDGDG 65

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  EE+ +A++RH TSK++  ++   I + GFRGEALPSI AVS LTL SR  +   G Q
Sbjct: 66  IPPEELELALRRHATSKLTGLEELERIASLGFRGEALPSIAAVSRLTLASRTAEAELGHQ 125

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           +   G  + +  PVA  PGT V V DLF+  P R  FL++E+ E   + + +RR+A++  
Sbjct: 126 LRCDGGALGAPEPVAHPPGTTVTVDDLFYNTPGRRKFLRTERTELYHVQEALRRLALSRF 185

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V F+        + +    +     ER+++++G  F ++A+ +  +   + L+G+ G+P
Sbjct: 186 DVGFSLVHQGRRLWSVPRAESETERHERLAELLGRAFADHALAVELEGAGLQLRGWLGLP 245

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           T  R   +  Y+F+NGR V+D+     IR AY++ +    YP  VL LE+DP +VDVNVH
Sbjct: 246 TAARRQGDLQYLFVNGRLVRDRGAAHGIRQAYSDCLYRDHYPAYVLFLEMDPARVDVNVH 305

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           P K  +RFR+   + +F+ + I  A+     + ++               P        T
Sbjct: 306 PMKHEVRFRDGRTVHDFLARRIADALATAEPAGAAAPPAAERPPSGAPTGPGQPAAAERT 365

Query: 361 -----SLTNTQE-KLFLQENR------------------LSTNDLLPSDDPTYSEDNDPV 396
                 L  T E  L L E R                   +++ +  S  P+ + D    
Sbjct: 366 GPASEGLGGTAELGLPLAEARQLYGGADAAAEGPGGAAEGASSAIAGSPGPSQTRDR--- 422

Query: 397 EESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQT 456
            ESEAT  +LG A  QI   YI++++  GLV+VD HAAHER+++E+M+    ++ I +Q+
Sbjct: 423 -ESEAT-PELGYAVGQIRDAYILAESQRGLVVVDMHAAHERVVYERMKAQLVASGIATQS 480

Query: 457 LLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDI 516
           LL P  + +   E   +  H   L R G++ +R GP ++ +  +PA+L++ +   L+RD 
Sbjct: 481 LLVPVSVPVTPAEAERVELHAATLARAGLEVDRAGPESVRVHRVPALLAEADAAALVRDA 540

Query: 517 IDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHG 576
           +  +    T   ++DR+  +LA MAC+GS+R+GR+++  EM+ LLR++E+ P ++QCNHG
Sbjct: 541 VAALESEGTGGRVEDRVHALLAQMACHGSVRAGRRLERAEMDALLRDIERTPRAAQCNHG 600

Query: 577 RPTFIKLKLSDIEKLFGR 594
           RPT+  L    + +LF R
Sbjct: 601 RPTYTVLDDEALARLFMR 618


>gi|309379702|emb|CBX21691.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 658

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 225/659 (34%), Positives = 360/659 (54%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQKDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  Q    N  ERI+ ++G+DF   ++E++  S  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQ----NLHERIAAIVGDDFQTASLEIDSGSGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRADLTESVGNAGEVLHDITGVTPAPMPSEN 358

Query: 341 -------MISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
                    S++   N P          KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DSENLFDSASNYPTGNKPDTRNAFGASGKTAPMPYQAAYAPQQRSLSLRESRAAMNTYAE 418

Query: 380 --------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
                   DL            +PS+ P    D  P+ +   S++    LG A AQ+   
Sbjct: 419 LYKKTDDIDLELSRFEQARFGNMPSETPAPKTDT-PLSDGIPSQSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM RQ   + ++ SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKRQRRENGRLQSQRLLIPSTFAASHEECAALAD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           H E L   G++    G N +A+R +PA+L K ++  L +D+++E+    ++ T+++    
Sbjct: 538 HAETLAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLNELAQVGSSQTIEEHENR 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSVRAGRQLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|241758859|ref|ZP_04756972.1| DNA mismatch repair protein MutL [Neisseria flavescens SK114]
 gi|241321067|gb|EER57280.1| DNA mismatch repair protein MutL [Neisseria flavescens SK114]
          Length = 658

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 226/658 (34%), Positives = 361/658 (54%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ S++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHSDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                   +  G++T+ + S+ 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVTTTPMPSEN 358

Query: 341 -------MISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
                    S++   N P          KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DGENLFDSASNYPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQRSLSLRESRAAMNTYAE 418

Query: 380 --------DL------------LPSDDPTYSEDNDPVE--ESEATHYQLGIACAQIHQNY 417
                   DL            +PS+ PT   D    +   S++    LG A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSQFEQARFGNMPSETPTPKTDKQCSDGLPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM RQ   +  + SQ LL P        ECA + +H
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQRLLIPVTFAASHEECAALADH 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++   +I
Sbjct: 539 AEMLTGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLGELAQVGSSQTIEEHENHI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSVRAGRQLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|114319732|ref|YP_741415.1| DNA mismatch repair protein MutL [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226126|gb|ABI55925.1| DNA mismatch repair protein MutL [Alkalilimnicola ehrlichii MLHE-1]
          Length = 636

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 206/631 (32%), Positives = 342/631 (54%), Gaps = 40/631 (6%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I++L  +++NQIAAGE++ERP+  +KEL+ENSLDA +  +   +  GGK   ++ D+G G
Sbjct: 5   IQQLPLQLVNQIAAGEVVERPASVLKELVENSLDAGARSLAVELEQGGKRLIRVRDDGNG 64

Query: 63  MTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  E++ +A++RH TSKI+   +   + + GFRGEALPSIGAVS L L+SRPP       
Sbjct: 65  IPREQLGLALRRHATSKITSLSELEQVVSLGFRGEALPSIGAVSRLRLISRPPGAEHAWA 124

Query: 121 IAISGE-KISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +   G+ + +   P A  PGT VEVRDLFF  P R  FL++++ E +   + +RR+A+  
Sbjct: 125 VRTDGDSEPAGPEPAAHPPGTTVEVRDLFFNTPGRRKFLRTDRTEFSHAQEALRRLALGR 184

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
             V+F           +           R+ +++GE F+   + L   +  + L G+  +
Sbjct: 185 FDVAFRLQHNGRTVLDLPPAGDRAGAERRLGELLGEGFLGECIHLECAAAGLKLSGWLAL 244

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF+R   +  Y ++NGR ++D+     +R AYA+ +   R+P  +L L++DP +VDVNV
Sbjct: 245 PTFSRSQGDLQYFYVNGRMIRDRMAGHALRRAYADVLYRDRFPAYLLYLDLDPDRVDVNV 304

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HP K  +RFR+  ++ +F+ + +++A+ +   +T+S +      S      P++      
Sbjct: 305 HPTKHEVRFRDSRLVYDFLFRQVREALARVSPATASGVQPPQ-GSVASAEGPRSLAAAAG 363

Query: 360 TSLTNTQEK-----------------LFLQENRLSTNDL-------------------LP 383
                                     L L+E RL   +                     P
Sbjct: 364 ERWGGAAPAAGAAPTARRSPHQHGLGLPLEEARLLYGERSKAHAAGPAVASPSGVVRDAP 423

Query: 384 SDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKM 443
           + +    E     + +E     LG A AQ+H  YI++Q   GLV+VD HAAHER+++E+M
Sbjct: 424 AGEAVACETGGAGDPTERGGPPLGHALAQVHGVYILAQNDQGLVLVDMHAAHERVVYERM 483

Query: 444 RQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAI 503
           +   + + I SQ LL PE + +   E   +    E   +LG + +R  P+ + +R +PA+
Sbjct: 484 KAQLSGSGIASQALLMPEGLSVTPAEGEEVERAGERFRQLGFQVDRVAPDRVLVRAVPAL 543

Query: 504 LSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLRE 563
           L+      L+RD++ ++   S +  +++ + ++LATMAC+GS+R+ R++   EM+ LLRE
Sbjct: 544 LANAEPVALVRDVLADLRTQSRSRQVEEALNHVLATMACHGSVRANRRLTLPEMDALLRE 603

Query: 564 MEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ME  PNS QCNHGRPT+  L +  +++LF R
Sbjct: 604 MEATPNSGQCNHGRPTWTVLDMDALDRLFMR 634


>gi|332973074|gb|EGK11011.1| DNA mismatch repair protein MutL [Kingella kingae ATCC 23330]
          Length = 624

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 226/625 (36%), Positives = 352/625 (56%), Gaps = 39/625 (6%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I +L + +INQIAAGE++ERP+ A+KE++ENSLDA +++++  IAGGG    ++ DNG G
Sbjct: 4   IIQLPDHLINQIAAGEVVERPANALKEILENSLDAGATQIQIDIAGGGIKLIRVCDNGSG 63

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           + +E +P+A+ RH TSKI    D   + + GFRGE L S+ +VS LTL SRP      AQ
Sbjct: 64  IDAESLPLALSRHATSKIKTLSDLERVRSMGFRGEGLASVASVSRLTLTSRPATQAHAAQ 123

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I         V   +   GT VEV +LFF  PAR  FLKSE  E      ++ R+A+A P
Sbjct: 124 IKAEDGVFQPVSAASHPVGTTVEVAELFFNTPARRKFLKSESTEYAHCLTMVERLALANP 183

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V+FT      N  K+ F     +  +R++Q++G +F   ++ ++ ++  + L G+   P
Sbjct: 184 NVAFTLK----NNDKLIFAYPAQSPEQRVAQILGAEFHAASLPVSSENGALQLNGFVSKP 239

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TF +G ++  Y F+N R V+DK +L  ++ AY + +     P   L L IDP  VDVN+H
Sbjct: 240 TFAKGKSDTQYFFVNQRFVRDKVMLHAVKQAYRDVLHNQITPAFALFLTIDPSLVDVNIH 299

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAI-NKKGISTSSV------LSKKMISSFHQDNAPKT 353
           P K+ IRFR+   +   +   + KA+ N +   TSSV      L ++M +    + AP  
Sbjct: 300 PTKTEIRFRDSQAVHQLVFHCVNKALANTRADLTSSVSNAGAILHERMANDTAHEIAPNA 359

Query: 354 HLPKYATSLTNT---------------QEKLFLQENRLSTN---DLLPSDD-----PTYS 390
           +     T  T +               Q  L L+E + + +   +L   DD     P+++
Sbjct: 360 YESSLHTRPTPSASVAPAPYAAYHAPRQSSLPLRERQAALDTYAELYRHDDDIEPMPSHT 419

Query: 391 -EDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
            +   P E  E   + LG A AQ+   YI++QT DGL++VD HAA ER+ +EK++   ++
Sbjct: 420 VQAALPTESRE--QHTLGFALAQLLGIYILAQTEDGLILVDMHAAAERINYEKLKTAHHA 477

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             I +Q LL P +      E A + E    L   G+         IA+R +P +LSK ++
Sbjct: 478 NGIQAQMLLIPVVFAATHAEQAAVDEFSHSLREYGLDLVNAETGKIAVRTVPNMLSKSDV 537

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
             L R+++ +++ +  + T++DR   IL+TMAC+GS+R+GR++   EMN LLR+ME+ P 
Sbjct: 538 ATLAREVLRDLMATGQSPTVRDRENEILSTMACHGSVRAGRQLTLPEMNALLRDMEQFPR 597

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S+QCNHGRPT++K+ L D++ LF R
Sbjct: 598 SNQCNHGRPTWVKIGLDDLDALFLR 622


>gi|225075177|ref|ZP_03718376.1| hypothetical protein NEIFLAOT_00177 [Neisseria flavescens
           NRL30031/H210]
 gi|224953352|gb|EEG34561.1| hypothetical protein NEIFLAOT_00177 [Neisseria flavescens
           NRL30031/H210]
          Length = 658

 Score =  398 bits (1023), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 228/659 (34%), Positives = 362/659 (54%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPTQSLH----ERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------KGISTS--------SVLSKKM---- 341
           HP K+ IRFR+   +   +  ++ KA+        + +S +         V+S +M    
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVVSTQMPSEN 358

Query: 342 --------ISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
                    S++   N P          KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DSENLFDSASNYPTGNKPDTRNAFGASGKTAPMPYQAARAPQQRSLSLRESRAAMNTYAE 418

Query: 380 --------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
                   DL            +PS+ PT   D  P+ +   S++    LG A AQ+   
Sbjct: 419 LYKKTDDIDLELNRLEQARFGNMPSETPTPKTDA-PLSDGIPSQSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM RQ   +  + SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQRLLIPVTFAASHEECAALAD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           H E L   G++    G N +A+R +PA+L K ++  L +D+++E+    ++ T+++    
Sbjct: 538 HAETLAGFGLELSDMGGNTLAVRAVPAMLGKSDVVSLAKDVLNELAQVGSSQTIEEHENR 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|253996214|ref|YP_003048278.1| DNA mismatch repair protein MutL [Methylotenera mobilis JLW8]
 gi|253982893|gb|ACT47751.1| DNA mismatch repair protein MutL [Methylotenera mobilis JLW8]
          Length = 610

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 212/610 (34%), Positives = 342/610 (56%), Gaps = 23/610 (3%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR L +++I+QIAAGE++ERP+ A+KEL+ENSLDA S+ ++  +  GG    ++TDNG G
Sbjct: 4   IRLLPDQLISQIAAGEVVERPASALKELLENSLDAGSTDIQVSLLQGGIKQMRVTDNGAG 63

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  E++ +A+ RH TSKIS  +D  ++ + GFRGEAL SI ++S   L+SR   +    +
Sbjct: 64  VAKEDLMLALTRHATSKISSLEDLESVASLGFRGEALASIASISRTQLLSRQSGSKHAWR 123

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I   G ++S++ P A++ GT++EV DL+F  PAR  FLK+E  E     ++  R+A++ P
Sbjct: 124 IGSEGSEVSTIEPAALDAGTVIEVSDLYFNTPARRKFLKTEATEFGHCEEMFTRIALSRP 183

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            VS       + R    F    G    R S+V+G +F+  ++ ++E +  + L G    P
Sbjct: 184 DVSLMLQ--HNGRALSRF--AIGQPERRFSEVLGSEFVAESIPVDESAAGLRLWGMAAKP 239

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNR + +  YV++NGR V+DK I   IR AY + +   R+P  VL LE+DP  VDVNVH
Sbjct: 240 TFNRNSRDTQYVYVNGRFVRDKVIAHAIRQAYQDVLHHDRHPAFVLFLELDPSLVDVNVH 299

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAIN-KKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           PAK+ +RFR+   +  FI  ++ KA+    G+S +   ++   + F       T L    
Sbjct: 300 PAKTEVRFRDSQAVHRFIFHALHKALAIPTGVSNAVTANQAQYNPF-SPQVSNTALANGG 358

Query: 360 TSLTNTQEKLFLQENR--------LSTNDLLPSDDPTYSED---NDPVEESEATHYQLGI 408
                 Q ++ L  +            N   P+   T + D   ++ ++      Y LG 
Sbjct: 359 MLYPTQQSQINLSAHEPAGFYQTLFGNNANQPATPATLTLDVLADNSLKAESINEYPLGF 418

Query: 409 ACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEG 468
           A  Q+H  Y+++Q  +GLV++D HAAHER+++EK++   +S  +  Q LL P   +  + 
Sbjct: 419 AVGQVHGVYVLAQNKEGLVVIDMHAAHERIMYEKLKHALDSQTVQMQPLLLPVSFNADKL 478

Query: 469 ECALIME----HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSS 524
           E A + E    +   L +LG       P  +A+R +P +L   +   L RD++ ++ +  
Sbjct: 479 EVATVHEALAGNQATLQQLGFDIAILSPTTLAVRAVPTMLQDADAVILARDVLRDLREYG 538

Query: 525 TTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLK 584
            +  L +R   +L TMAC+ ++R+ R +   EMN LLR+ME    S QCNHGRPT+ ++ 
Sbjct: 539 ASRVLTERRNELLGTMACHAAVRANRSLTIPEMNALLRDMEATERSGQCNHGRPTWFQVS 598

Query: 585 LSDIEKLFGR 594
           + D++K+F R
Sbjct: 599 MGDLDKMFMR 608


>gi|325266000|ref|ZP_08132686.1| DNA mismatch repair protein MutL [Kingella denitrificans ATCC
           33394]
 gi|324982638|gb|EGC18264.1| DNA mismatch repair protein MutL [Kingella denitrificans ATCC
           33394]
          Length = 623

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 223/628 (35%), Positives = 345/628 (54%), Gaps = 44/628 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENSLDA ++ +   +AGGG    ++TDNG 
Sbjct: 3   RIHALPDHLVNQIAAGEVVERPAAALKEIVENSLDAGATHISVELAGGGIKLIRVTDNGN 62

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++++P+A+ RH TSKI    D  ++ + GFRGE L SI +VS LTL SR        
Sbjct: 63  GIHADDLPLALSRHATSKIKQLHDLEHVRSMGFRGEGLASIASVSRLTLTSRTADLPHAH 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +I      +S+V   A   GT VEVR+LFF  PAR  FLKSE  E      ++ R+A+A 
Sbjct: 123 EIRAEDGVLSAVNAAAHPEGTTVEVRELFFNTPARRKFLKSENTEYAHCAAMLERLALAN 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P+ +F+ +      ++   QS      ER++ V+G +F + ++ ++     + + G+   
Sbjct: 183 PQAAFSLAHNGKTVFRYPVQS----LEERMAAVMGAEFQSASLPVDSGEGAVRVHGFVSK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G +   + F+N R V+DK +L  ++ AY + +     P   L LE+ P  VDVNV
Sbjct: 239 PTFAKGKSELQFCFVNRRFVRDKVVLHAVKQAYRDVLHHKITPAFALFLEMPPEMVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-NKKGISTSSVLSKKMI---------SSFHQDN 349
           HP K+ IRFR+   +   +  ++ KA+   +   T SV +   I         SS H + 
Sbjct: 299 HPTKTEIRFRDSQAVHRLVFHTLDKALEGTRADMTGSVGNAGDILQQRFPNVQSSLHTET 358

Query: 350 A--------PKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDND-PVEESE 400
           A        P    P Y+      Q  L L+ENR +    L +    Y  D+D P+E++ 
Sbjct: 359 AAMPTSGEAPSAPAP-YSAYRAPQQRSLSLKENRAA----LQTYAELYRRDDDFPIEKAA 413

Query: 401 AT--------------HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQD 446
            T               Y LG A AQ+   YI++QT +GL++VD HAA ER+ +EKM+  
Sbjct: 414 CTPKQPAPEAEAAEPPEYPLGFALAQLLGIYILAQTAEGLILVDMHAAAERVNYEKMKAQ 473

Query: 447 FNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSK 506
                + +Q LL P +      E A++ EH E L   G+     G   IA+R +PA+L K
Sbjct: 474 RQQGSLQTQMLLIPPVFAASHTERAVLAEHGETLREYGLLLSDEGNGQIAVRSVPAMLGK 533

Query: 507 KNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEK 566
            +   L ++++ E+    ++ T++     I ATMAC+GS+R+GR++   EMN LLR+ME 
Sbjct: 534 ADAVALAQNVLRELGSVGSSQTVESMENRIFATMACHGSVRAGRQLTLPEMNALLRDMEN 593

Query: 567 NPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
              S+QCNHGRPT++ L L+D++ LF R
Sbjct: 594 TSRSNQCNHGRPTWVHLALADLDALFLR 621


>gi|313201103|ref|YP_004039761.1| DNA mismatch repair protein mutl [Methylovorus sp. MP688]
 gi|312440419|gb|ADQ84525.1| DNA mismatch repair protein MutL [Methylovorus sp. MP688]
          Length = 624

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 218/629 (34%), Positives = 346/629 (55%), Gaps = 47/629 (7%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L +++I+QIAAGE++ERP+ A+KEL+ENSLDA SS +   +  GG    ++TD+G G
Sbjct: 4   IKLLPDQLISQIAAGEVVERPASALKELLENSLDAGSSDIAVTLGQGGVKLLRVTDDGNG 63

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  +++ +A+ RH TSKI+  DD  ++ + GFRGEAL SI ++S  ++ SR  + +   +
Sbjct: 64  IPHDDLTLALTRHATSKIASLDDLESVASLGFRGEALASIASISRTSITSRHAEASHAWR 123

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA  G  +    P A++ GTIVEV+D++F  PAR  FLK+EQ E     +  RR+A++ P
Sbjct: 124 IAADGGLLGDAAPAALDRGTIVEVQDIYFNTPARRKFLKTEQTEFGHCEEAFRRIALSRP 183

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V F      + R  M      G    R ++V+G DF   A EL+E +  + L G    P
Sbjct: 184 DVGFMLQ--HNGRALMRL--APGEAKRRFTEVLGPDFSAEAFELDESAGGLRLWGMAAKP 239

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TF+R   +  YV++NGR V+DK I   IR AY + +   R+P   L LE+DP  VDVNVH
Sbjct: 240 TFSRSARDTQYVYVNGRFVRDKLISHAIRQAYQDVLHHDRHPAFALFLELDPTLVDVNVH 299

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAIN----------------------KKGISTSSVLS 338
           P+K+ +RFR    +  FI  ++ KA+                         GI       
Sbjct: 300 PSKTEVRFREGQAVHRFIFHALHKALATPVGLPANGLVPPPVAAPATSYSSGIPAGQPYP 359

Query: 339 KKMIS-SFHQDNAPKTH------LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSE 391
           ++  S     + AP  +      LP+ A    ++        + +S+ DL  +  P+ + 
Sbjct: 360 RQQGSFDLRANEAPGFYQTLFGGLPREAVDTASS-----FVPSAISSADLQATLSPSQAS 414

Query: 392 DNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK 451
            +   E++ A  Y LG A AQ+H  Y+++Q   GL++VD HAAHER+++E+++   +   
Sbjct: 415 SSLSPEQA-AQEYPLGFALAQLHGVYVLAQNAQGLIVVDMHAAHERIMYERLKNALDGDS 473

Query: 452 ITSQTLLTPEIIDLLEGECALIMEH------DEDLHRLGIKAERFGPNAIAIREIPAILS 505
           +  Q LL P   +    E A + E        + LH+LG +  +  P+ +A+R IPA+L 
Sbjct: 474 VPMQPLLLPVSFNADRFEVATVQEQLSTPEGQQTLHQLGFEIVQLSPSTLAVRAIPAMLQ 533

Query: 506 KKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREME 565
             +   L RD++ ++ +   +  L +R   +LATMAC+ ++R+ R +   EMN LLR+ME
Sbjct: 534 DADAVALARDVLRDLREYGGSRVLTERRNELLATMACHAAVRANRILSIQEMNALLRDME 593

Query: 566 KNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
               S QCNHGRPT+ +  ++D++K+F R
Sbjct: 594 ATERSGQCNHGRPTWFQATMADLDKMFMR 622


>gi|238022530|ref|ZP_04602956.1| hypothetical protein GCWU000324_02438 [Kingella oralis ATCC 51147]
 gi|237867144|gb|EEP68186.1| hypothetical protein GCWU000324_02438 [Kingella oralis ATCC 51147]
          Length = 636

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 225/639 (35%), Positives = 349/639 (54%), Gaps = 55/639 (8%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L   +INQIAAGE++ERP+ A+KE++ENSLDA ++++   I GGG    ++ DNG G
Sbjct: 4   IQFLPSHLINQIAAGEVVERPANALKEIVENSLDAGATQISVDIVGGGIKLLRVCDNGCG 63

Query: 63  MTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           M ++++P+A+ RH TSKI    D   + + GFRGE L SI +VS LTL SR   N    Q
Sbjct: 64  MEADDLPLALSRHATSKIKSLSDLERVQSMGFRGEGLASIASVSRLTLTSRTTHNAHAHQ 123

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I      +  V   A   GT +E+ +LFF  PAR  FLKSE  E      ++ R+A+A P
Sbjct: 124 IRAVDGALGEVAAAAHPVGTTIEIAELFFNTPARRKFLKSENTEYAHCATMLERLALANP 183

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            VSF+      N  K  F        ER++ ++G  F   A+ ++ ++ E+ L+G+   P
Sbjct: 184 AVSFSLK----NNGKTVFDYPAQPLSERVAAIMGAAFQAAALPIDSQAGEMALRGFVSKP 239

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TF +G +++ + F+N R V+DK +L  ++ AY + +     P  VL L++ P QVDVNVH
Sbjct: 240 TFAQGKSDKQFFFVNNRFVRDKVMLHAVKQAYRDVLHNQITPAFVLFLDLPPEQVDVNVH 299

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINK------KGISTSSVLSKK-------------- 340
           P K+ IRFR+   +   I  ++ KA+ +      + +S +  L ++              
Sbjct: 300 PTKTEIRFRDSQAVHQMIFHALNKALAETRADVTESVSNAGALLQQRFVPQPAAPDETLF 359

Query: 341 -----------MISSFHQDNA----PKTH-LPKYATSLTNTQEKLFLQENRLSTNDLLPS 384
                      M ++    +A    PK+  +P  A +    Q  L L ENR +    L +
Sbjct: 360 LGSLKTEGFNGMTTAIPAADAFSGSPKSAPMPYQAAARAPQQRPLSLNENRAA----LQA 415

Query: 385 DDPTYSEDNDPVE-ESEATH-------YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHE 436
               Y ED+D    E +A         Y LG A AQ+   Y+++Q  D L++VD HAA E
Sbjct: 416 YAELYREDDDLAAFEPQAAQVRQPENAYPLGFAIAQLLGIYVLAQAADSLILVDMHAAAE 475

Query: 437 RLIFEKMRQDFNS-TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAI 495
           R+ +EKM+   ++   + +Q LL P   +    E A   ++  +L + G+     G   I
Sbjct: 476 RVNYEKMKAQRDAEGSLKTQMLLIPVAFEASHAELAARADYAAELAQYGLDLADLGNGQI 535

Query: 496 AIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSI 555
           A+R +P +L K ++  L RD++ E+    ++ T++ +   IL+TMAC+GSIR+GR++   
Sbjct: 536 AVRAVPQMLGKADVAALARDVLRELAAVGSSQTIEAKENQILSTMACHGSIRAGRQLTLP 595

Query: 556 EMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           EMN LLR+ME  P S+QCNHGRPT++KL L+D++ LF R
Sbjct: 596 EMNALLRDMEATPRSNQCNHGRPTWVKLTLADLDGLFLR 634


>gi|313668557|ref|YP_004048841.1| DNA mismatch repair protein [Neisseria lactamica ST-640]
 gi|313006019|emb|CBN87478.1| DNA mismatch repair protein [Neisseria lactamica 020-06]
          Length = 658

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 226/659 (34%), Positives = 356/659 (54%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATEIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   +    
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSAHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  Q    N  ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQ----NLHERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRANLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 341 -------MISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
                    S +   N P          KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DSENLFDRASDYPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQRSLSLRESRTAMNTYAE 418

Query: 380 --------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
                   DL            +PS+ P    D  P+ +   S++    LG A AQ+   
Sbjct: 419 LYKKTGDIDLELSRLEQARFGNMPSETPAPKTDT-PLSDGIPSQSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM RQ   + ++ SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKRQRRENGRLQSQRLLIPSTFAASHEECAALAD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           H E L   G++    G N +A+R  PA+L K ++  L RD++ E+    ++ T+++    
Sbjct: 538 HAETLAGFGLELSDMGGNTLAVRAAPAMLGKSDVVSLARDVLGELAQVGSSQTIEEHENR 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|110835066|ref|YP_693925.1| DNA mismatch repair protein [Alcanivorax borkumensis SK2]
 gi|110648177|emb|CAL17653.1| DNA mismatch repair protein MutL [Alcanivorax borkumensis SK2]
          Length = 622

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 212/626 (33%), Positives = 345/626 (55%), Gaps = 41/626 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI+ L  ++ NQIAAGE++ERP+  +KEL+EN+LDA S  +   +  GG    ++ DNG 
Sbjct: 3   KIQLLDSRLANQIAAGEVVERPASVLKELLENALDAGSESISVDVEQGGVKLLRVRDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+A+ RH TSKI   DD   I T GFRGEAL +I +VS L+L S       G 
Sbjct: 63  GIERDDLPLALSRHATSKIRGLDDLEAIGTLGFRGEALAAISSVSRLSLASNVEGEPEGW 122

Query: 120 QIAISGEKIS-SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+ + G  ++ SV P     GT V +RDLFF  PAR  FL++E+ E N + +V RR+A++
Sbjct: 123 QVTVEGRDMAPSVSPAGHPRGTTVTMRDLFFNTPARRRFLRTEKTEFNHLEEVFRRIALS 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
               +F  +  +   +++     +     R++++ G+ FI  AV ++ + + + L G+ G
Sbjct: 183 EFNTAFRLTHNQKVIHQLPAGLDDTLRAARVAKLCGKGFIEQAVPVDVERDGLRLHGWMG 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y ++NGR ++DK +   +R AY++ +  GR+P  VL LE+DP  VDVN
Sbjct: 243 LPTFSRSQADLQYFYVNGRVIRDKVVSHAVRQAYSDVLYHGRHPAYVLFLELDPAMVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAIN------------------KKGISTSSVLSKK 340
           VHP K  +RFR   ++  F+  S+ + I                     G+  +   S+ 
Sbjct: 303 VHPTKHEVRFREQRMVHGFLYSSLHRVIAGVRPGQELAGSVADEGGPAAGMDAAMAPSQG 362

Query: 341 MIS--SFHQDNAPKTHLPKYATSLTNT----------QEKLFLQENRLSTNDLLPSDDPT 388
            +S  S        +H P  A   T            Q   +    R    +  P+  P 
Sbjct: 363 NMSLTSPTGSGGSLSHPPGQAYPSTGGGVFGYGQGARQADAYGALVRGHVGESAPAVMP- 421

Query: 389 YSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFN 448
                 P  E+E T   LG A AQ+H  +I+++   G+V+VD HAAHER+ +E+++Q + 
Sbjct: 422 ------PANENE-TVPPLGYAVAQLHGIFILAENEQGMVVVDMHAAHERITYERLKQSWA 474

Query: 449 STKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKN 508
             K+ SQ LL P  + +   E     +  E   RLG   +R GP  + +RE+PA+L   +
Sbjct: 475 EDKVRSQPLLVPVSLAVSSREADFAEQQPEVFSRLGFVVQRAGPETLVVREVPALLRNGD 534

Query: 509 IPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNP 568
              ++RD++ +++   ++  +  +++ +L+TMAC+GS+R+ R++   EMN LLR+ME   
Sbjct: 535 SESMVRDVLSDLLAEGSSERIAQKLDELLSTMACHGSVRANRRLTIAEMNALLRDMEATE 594

Query: 569 NSSQCNHGRPTFIKLKLSDIEKLFGR 594
            S QCNHGRPT+ ++ + D+++LF R
Sbjct: 595 RSGQCNHGRPTWTQMSIKDLDRLFMR 620


>gi|114331804|ref|YP_748026.1| DNA mismatch repair protein MutL [Nitrosomonas eutropha C91]
 gi|114308818|gb|ABI60061.1| DNA mismatch repair protein MutL [Nitrosomonas eutropha C91]
          Length = 608

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 222/622 (35%), Positives = 342/622 (54%), Gaps = 49/622 (7%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L + +I+QIAAGE+IERP+  +KEL+ENS+DA ++ +   IA GG    ++TDNG G
Sbjct: 4   IKLLPDGLISQIAAGEVIERPASVLKELLENSIDAGATEITVNIAQGGLKLIRVTDNGSG 63

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           + +EE+P+A+ RH TSKI+  +D  +I + GFRGE L SI +VS+L+L+S  P      +
Sbjct: 64  IPAEELPLALTRHATSKIASQEDLHSITSLGFRGEGLASIASVSYLSLISHQPAGKHAWE 123

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I   G ++ S  P +   GT VEVRDLFF +PAR  FLK+E  E     +V RRMA+++ 
Sbjct: 124 IRSEGTRLMSPEPSSHMAGTTVEVRDLFFNLPARRKFLKTEATEFAHCEEVFRRMALSHA 183

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            ++FT     +   + ++Q+      ERI  V+GE+F   A  ++E+S  I LQG   +P
Sbjct: 184 DITFTLR--HNGNLRSHWQAAEA--AERIGAVLGEEFSGAATWMDEQSAGIGLQGMLALP 239

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
            ++R   +  Y F+NGR ++DK I   +R AY + + L R+   VL L IDP QVDVNVH
Sbjct: 240 AYSRATRDMQYFFVNGRFIRDKLITHALREAYRDVLHLDRHAAFVLYLAIDPEQVDVNVH 299

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAIN--KKGISTSSVLSKKMISSFHQDNA-------- 350
           P K+ +RFR    I  FI   + KA+   + G+++SS +      +  QD +        
Sbjct: 300 PTKTEVRFREARAIHQFIYHGVSKALALPRSGVASSSPVGAVWPGA--QDASVDPTRTGF 357

Query: 351 ----PKTHLPKYA--------------TSLTNTQEKLFLQENRLSTNDLLPSDDPTYSED 392
               P  + P+ A                LT  +      +N+L       SD+      
Sbjct: 358 TPAVPTLNYPRQARLPSERVAQPFNFYQVLTGGESGATAMQNQLRQTGEGESDE------ 411

Query: 393 NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
            +P          LG A   +   YI++Q   GLVIVD HAAHER+++E+++   +   +
Sbjct: 412 -NPAMPP------LGFALGLLRGIYILAQNQKGLVIVDMHAAHERIVYEQLKTQLDQQVL 464

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
           ++Q LL P        + A + E+   L +L  +        + IR +P  L   +  +L
Sbjct: 465 SAQRLLIPVTFHADSLDIATVEENQALLQQLCFEVSTLSATTLVIRTVPTTLQHADAEKL 524

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           +R ++DEI +      L  R   +LATMAC+G++R+ R++  IEMN LLR+ME    S Q
Sbjct: 525 VRALLDEIRNGDPAQLLAARRNELLATMACHGAVRANRQLTLIEMNELLRKMEVTERSDQ 584

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT+ ++ L++++K+F R
Sbjct: 585 CNHGRPTWFEISLAELDKMFMR 606


>gi|325204429|gb|ADY99882.1| DNA mismatch repair protein MutL [Neisseria meningitidis
           M01-240355]
          Length = 658

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 229/659 (34%), Positives = 359/659 (54%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  + GGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELDGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      +I R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMIERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++GEDF   ++ ++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGEDFQTASLGIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                   +  GI+ + + S+ 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGITPAPMSSEN 358

Query: 341 -------MISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
                    S++   N P          KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DSENLFDSASNYPTGNKPDTRNTFGSSGKTAPMPYQAARAPQQRSLSLRESRAAMNTYAE 418

Query: 380 --------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
                   DL            +PS+ PT   D  P+ +   S++    LG A AQ+   
Sbjct: 419 LYKKTDDIDLELSQFEQARFGNMPSETPTPQTDT-PLSDGIPSQSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM RQ   + K+ SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGKLQSQRLLIPVTFAASHEECAALAD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           + E L   G++    G N +A+R +PA+L K +I  L RD++ E+    ++ T+++    
Sbjct: 538 YAETLAGFGLELSDMGGNTLAVRAVPAMLGKSDIVSLARDVLGELAQVGSSQTIEEHENR 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|15677300|ref|NP_274454.1| DNA mismatch repair protein [Neisseria meningitidis MC58]
 gi|20455152|sp|Q9JYT2|MUTL_NEIMB RecName: Full=DNA mismatch repair protein mutL
 gi|7226683|gb|AAF41803.1| mismatch repair protein MutL [Neisseria meningitidis MC58]
 gi|316984569|gb|EFV63534.1| DNA mismatch repair MutL family protein [Neisseria meningitidis
           H44/76]
 gi|325134577|gb|EGC57221.1| DNA mismatch repair protein MutL [Neisseria meningitidis M13399]
 gi|325140613|gb|EGC63133.1| DNA mismatch repair protein MutL [Neisseria meningitidis CU385]
 gi|325199942|gb|ADY95397.1| DNA mismatch repair protein MutL [Neisseria meningitidis H44/76]
 gi|325205804|gb|ADZ01257.1| DNA mismatch repair protein MutL [Neisseria meningitidis
           M04-240196]
          Length = 658

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 227/660 (34%), Positives = 362/660 (54%), Gaps = 73/660 (11%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ +E  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIEVELAGGGIRLIRVSDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQNDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++GEDF   ++ ++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGEDFQTASLGIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI--NKKGISTS------------SVLSKKM---- 341
           HP K+ IRFR+   +   +  ++ KA+   +  ++ S             V+S  M    
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRANLTESVGNAGEVLHDITGVVSTPMPSEN 358

Query: 342 --------ISSFHQDNAPKTH-----------LPKYATSLTNTQEKLFLQENRLSTN--- 379
                   +S++   N   TH           +P Y ++    Q  L L+E+R + N   
Sbjct: 359 DSENLFDSVSNYPTGNKSDTHNAFGSSGKTAPMP-YQSAYAPQQRSLSLRESRAAMNTYA 417

Query: 380 ---------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQ 415
                    DL            +PS+ P    D  P+ +   S++    LG A AQ+  
Sbjct: 418 ELYKKTDDIDLELSRFEQARFGNMPSETPAPQTDT-PLSDGIPSQSELPPLGFAIAQLLG 476

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIM 474
            YI++Q  D L+++D HAA ER+ +EKM RQ   +  + SQ LL P        ECA + 
Sbjct: 477 IYILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQRLLIPVTFAASHEECAALA 536

Query: 475 EHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIE 534
           ++ E L   G++    G N +A+R +PA+L K ++  L +D+++E+    ++ T+++   
Sbjct: 537 DYAETLAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLNELAQVGSSQTIEEHEN 596

Query: 535 NILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            ILATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 597 RILATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|297538675|ref|YP_003674444.1| DNA mismatch repair protein MutL [Methylotenera sp. 301]
 gi|297258022|gb|ADI29867.1| DNA mismatch repair protein MutL [Methylotenera sp. 301]
          Length = 622

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 220/623 (35%), Positives = 343/623 (55%), Gaps = 37/623 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I  L +++I+QIAAGE++ERP+ A+KEL+ENSLDA S+ +   +  GG    ++ DNG G
Sbjct: 4   IHLLPDQLISQIAAGEVVERPASALKELLENSLDAGSTDISVSLVQGGVKQLRVADNGNG 63

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  E++ MA+ RH TSKI+  DD   + + GFRGEAL SI +VS   + SR        +
Sbjct: 64  IAQEDLAMALTRHATSKIASLDDLEAVASLGFRGEALASIASVSRTQISSRALDTKHAWR 123

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA +G +IS + P A++ GTI+EV DL+F  PAR  FLK+E  E         R+ ++ P
Sbjct: 124 IASNGSEISPIEPTALDAGTIIEVDDLYFNTPARRKFLKTEGTEFGHCEAAFNRVVLSRP 183

Query: 181 KVSFTF--STIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            V+F    +    +RY ++  +      +R  +V+G DF    + + E +  + + G   
Sbjct: 184 DVAFMLQHNGRALSRYAVSEPT------KRFGEVLGADFAAETIAVEESAAGLRIWGVVA 237

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            PTFNR  ++  YV++NGR V+DK I   IR AY + +   R+P  VL LE+DP  VDVN
Sbjct: 238 KPTFNRNKSDTQYVYVNGRFVRDKLISHAIRQAYQDVLHHDRHPAFVLFLELDPNLVDVN 297

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI-NKKGISTSSVLSKKMISSFHQDNA-----PK 352
           VHPAK+ +RFR+   I  FI  S+ KA+ +  G+S +S  ++   + F   NA       
Sbjct: 298 VHPAKTEVRFRDGQAIHRFIFHSLHKALASPTGVSNASTANQAAYNPFGGQNANSPSYSA 357

Query: 353 THLPKYAT--SLTNTQEKLFLQ------------ENRLSTNDLLPSDDPTYSE---DNDP 395
           +  P+Y    +L+  +   F Q             N L+   L  + D         ++ 
Sbjct: 358 SPYPQYQAQINLSANEPNSFYQTLFSANSAQNYSNNALNNTALQTNRDGLAGGAVFTSNA 417

Query: 396 VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQ 455
            E    + + LG A AQIH  Y+++Q   GLV+VD HAAHER+++E+++   ++  +  Q
Sbjct: 418 SENYAESAFPLGFAVAQIHGVYVLAQNAQGLVVVDMHAAHERIMYEQLKNALDNQAVGMQ 477

Query: 456 TLLTPEIIDLLEGECALIME----HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQ 511
            LL P   +    E A + E    +D  L +LG       P  +A+R +P +L   +   
Sbjct: 478 PLLLPVSFNADRLEVATVQEALASNDGSLQQLGFDIAIISPTTLAVRAVPTMLQDADAVT 537

Query: 512 LLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSS 571
           L RD++ ++ +   +  L +R   +L TMAC+ ++R+ R +   EMN LLR+ME    S 
Sbjct: 538 LARDVLRDLREYGASRALTERRNELLGTMACHAAVRANRSLTIPEMNALLRDMEATERSG 597

Query: 572 QCNHGRPTFIKLKLSDIEKLFGR 594
           QCNHGRPT+ ++ +SD++K+F R
Sbjct: 598 QCNHGRPTWFQVSMSDLDKMFMR 620


>gi|58584653|ref|YP_198226.1| DNA mismatch repair ATPase MutL [Wolbachia endosymbiont strain TRS
           of Brugia malayi]
 gi|81311642|sp|Q5GSP0|MUTL_WOLTR RecName: Full=DNA mismatch repair protein mutL
 gi|58418969|gb|AAW70984.1| DNA mismatch repair enzyme MutL, predicted ATPase [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 628

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 234/634 (36%), Positives = 358/634 (56%), Gaps = 47/634 (7%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I  L  K IN+IAAGE+IERP+  +KEL+EN++DA SS +E  I  GG +   ITD+G
Sbjct: 1   MAIILLDTKTINRIAAGEVIERPASVVKELVENAIDAGSSEIEIKIESGGCNLITITDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            G+   ++ +A  RH TSK+SD +   I   GFRGEAL SI AVS + L S+    +   
Sbjct: 61  GGIEKSDLELAFMRHATSKLSDSELIEIKHLGFRGEALSSIAAVSRIKLSSKANGASEAW 120

Query: 120 QIAI-SGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            I+   GEKI  + P ++  GT +EVRDLFF  P RL FLK+E+ E   I D++  +A+ 
Sbjct: 121 SISYEGGEKIGELIPYSLPQGTHIEVRDLFFATPNRLKFLKTERAEIQSIVDIVNNLAMI 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              + FT ++      K   Q++      R+ +V  E+F +N++E+NE+ + + L G+  
Sbjct: 181 NYSIGFTLTSGSKKPLKYAKQTS---LFSRLCEV-EEEFQDNSLEINEEEDGVRLTGHIC 236

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            PT NRG ++  Y F+NGR ++D  ++S IR AY + IP  RYP   L LEI   Q+DVN
Sbjct: 237 KPTVNRGKSDMIYTFVNGRPIKDNLLVSAIRYAYHDFIPSNRYPFATLHLEIPYDQIDVN 296

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAIN-KKGISTSSVLSKKMISSFHQDNAP------ 351
           VHP KS +RF+N  +I   + + + KA++ + G S  S + +       ++ +       
Sbjct: 297 VHPNKSEVRFQNKRLIYEIVRRGLIKALSTRTGNSAVSNIDRSRCQGIGKETSGLPFDVS 356

Query: 352 -----KTHLPKYATSLTNTQEKLFLQ-----ENRLSTNDLLPSD---------------- 385
                  H+    +  T ++ +L+ +     ENRL      PS                 
Sbjct: 357 ESQGNDNHINNGKSRETKSERELYERRPNPFENRLMKESNSPSVGKKDLSERSVLFDSGI 416

Query: 386 DPTYSEDNDPVEESEAT----HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFE 441
             + S+    V E E      ++ LG A  Q++  YII++    L+IVDQHAAHERL++E
Sbjct: 417 QKSLSQAKTVVLEREQIDLIENHPLGFARCQVYNTYIIAEARGKLIIVDQHAAHERLVYE 476

Query: 442 KMRQDFNSTKITSQTLLTPEIIDLL-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREI 500
            ++Q    + I  Q LL  E++++  +    ++  + + L  +G   +    N + ++EI
Sbjct: 477 CLKQ---KSSIKRQKLLLSEVVEIKNQAGMEMVEVYKDKLFEMGFDIQINSENKVIVKEI 533

Query: 501 PAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRL 560
           PAIL   ++ ++L DI+D +++      ++D++  ILAT+AC+GSIR+GR M+  EMN L
Sbjct: 534 PAILGTIDVKEMLIDIVDRLMEIEDMLPIEDKVNKILATIACHGSIRAGRTMKLEEMNVL 593

Query: 561 LREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LR+ME+ P S QCNHGRPT I++KLSDIEKLF R
Sbjct: 594 LRQMEETPYSGQCNHGRPTHIEMKLSDIEKLFER 627


>gi|304387173|ref|ZP_07369416.1| DNA mismatch repair protein MutL [Neisseria meningitidis ATCC
           13091]
 gi|304338740|gb|EFM04851.1| DNA mismatch repair protein MutL [Neisseria meningitidis ATCC
           13091]
          Length = 658

 Score =  395 bits (1015), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 226/659 (34%), Positives = 357/659 (54%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ +E  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIEVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQKDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK-------------------KGISTSSVLSK- 339
           HP K+ IRFR+   +   +  ++ KA+                      G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRADLTESVGNAGEVLHEITGVTPAPMPSEN 358

Query: 340 ------KMISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
                    S +   N P          KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DSENLFNRASDYPTGNKPDTRNAFGASGKTAPMPYQAARAPQQRSLSLRESRAAMNTYAE 418

Query: 380 --------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
                   DL            +PS+ P    D  P+ +   S++    LG A AQ+   
Sbjct: 419 LYKKTDDIDLELSRFEQARFGNMPSETPAPQTDT-PLSDGIPSQSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM RQ   + ++ SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGRLQSQRLLIPVTFAASHEECAALAD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           + E L   G++    G N +A+R  PA+L K ++  L RD++ E+    ++ T+++    
Sbjct: 538 YAETLAGFGLELSDMGGNTLAVRAAPAMLGKSDVVSLARDVLGELAQVGSSQTIEEHENR 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|121635130|ref|YP_975375.1| DNA mismatch repair protein [Neisseria meningitidis FAM18]
 gi|166232098|sp|A1KUP6|MUTL_NEIMF RecName: Full=DNA mismatch repair protein mutL
 gi|120866836|emb|CAM10594.1| DNA mismatch repair protein [Neisseria meningitidis FAM18]
 gi|325132377|gb|EGC55070.1| DNA mismatch repair protein MutL [Neisseria meningitidis M6190]
 gi|325138442|gb|EGC61008.1| DNA mismatch repair protein MutL [Neisseria meningitidis ES14902]
 gi|325198576|gb|ADY94032.1| DNA mismatch repair protein MutL [Neisseria meningitidis G2136]
          Length = 658

 Score =  395 bits (1015), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 226/660 (34%), Positives = 360/660 (54%), Gaps = 73/660 (11%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSEATEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSDNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 341 -------MISSFHQDNAPKTH-----------LPKYATSLTNTQEKLFLQENRLSTN--- 379
                    S++   N   TH           +P Y ++    Q  L L+E+R + N   
Sbjct: 359 NSENLFDRASNYPTGNKSDTHNAFGSSGKTAPMP-YQSAYAPQQRSLSLRESRAAMNTYA 417

Query: 380 ---------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQ 415
                    DL            +PS+ P    D  P+ +   S +    LG A AQ+  
Sbjct: 418 ELYKKTDDIDLELSRFEQARFGNMPSETPAPQTDT-PLSDGIPSPSELPPLGFAIAQLLG 476

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIM 474
            YI++Q  D L+++D HAA ER+ +EKM RQ   +  + SQ LL P        ECA + 
Sbjct: 477 IYILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQRLLIPVTFAASHEECAALA 536

Query: 475 EHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIE 534
           +H E L   G++    G N +A+R  PA+L K ++  L RD+++E     ++ T+++   
Sbjct: 537 DHAEALAGFGLELSDMGGNTLAVRAAPAMLGKSDVVSLARDVLNEFAQVGSSQTIEEHEN 596

Query: 535 NILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +ILATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 597 HILATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|325144738|gb|EGC67033.1| DNA mismatch repair protein MutL [Neisseria meningitidis
           M01-240013]
          Length = 658

 Score =  395 bits (1015), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 227/660 (34%), Positives = 361/660 (54%), Gaps = 73/660 (11%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ +E  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIEVELAGGGIRLIRVSDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQNDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++GEDF   ++ ++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGEDFQTASLGIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI--NKKGISTS------------SVLSKKM---- 341
           HP K+ IRFR+   +   +  ++ KA+   +  ++ S             V+S  M    
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRANLTESVGNAGEVLHDITGVVSTPMPSEN 358

Query: 342 --------ISSFHQDNAPKTH-----------LPKYATSLTNTQEKLFLQENRLSTN--- 379
                   +S++   N   TH           +P Y ++    Q  L L+E+R + N   
Sbjct: 359 DSENLFDSVSNYPTGNKSDTHNAFGSSGKTAPMP-YQSAYAPQQRSLSLRESRAAMNTYA 417

Query: 380 ---------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQ 415
                    DL            +PS+ P    D  P+ +   S +    LG A AQ+  
Sbjct: 418 ELYKKTDDIDLELSRFEQARFGNMPSETPAPQTDT-PLSDGIPSPSELPPLGFAIAQLLG 476

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIM 474
            YI++Q  D L+++D HAA ER+ +EKM RQ   +  + SQ LL P        ECA + 
Sbjct: 477 IYILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQRLLIPVTFAASHEECAALA 536

Query: 475 EHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIE 534
           ++ E L   G++    G N +A+R +PA+L K ++  L +D+++E+    ++ T+++   
Sbjct: 537 DYAETLAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLNELAQVGSSQTIEEHEN 596

Query: 535 NILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            ILATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 597 RILATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|325136514|gb|EGC59118.1| DNA mismatch repair protein MutL [Neisseria meningitidis M0579]
          Length = 658

 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 227/660 (34%), Positives = 359/660 (54%), Gaps = 73/660 (11%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  + GGG     ++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELDGGGIRLIHVSDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSLLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS        GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAATHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  S  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSGSGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI--NKKGISTS------------SVLSKKM---- 341
           HP K+ IRFR+   +   +  ++ KA+   +  ++ S             V+S  M    
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRANLTESVGNAGEVLHDITGVVSTPMPSEN 358

Query: 342 --------ISSFHQDNAPKTH-----------LPKYATSLTNTQEKLFLQENRLSTN--- 379
                   +S++   N   TH           +P Y ++    Q  L L+E+R + N   
Sbjct: 359 DSENLFDSVSNYPTGNKSDTHNAFGSSGKTAPMP-YQSAYAPQQRSLSLRESRAAMNTYA 417

Query: 380 ---------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQ 415
                    DL            +PS+ P    D  P+ +   S++    LG A AQ+  
Sbjct: 418 ELYKKTDDIDLELSRFEQARFGNMPSETPAPQTDT-PLSDGIPSQSELPPLGFAIAQLLG 476

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIM 474
            YI++Q  D L+++D HAA ER+ +EKM RQ   +  + SQ LL P        ECA + 
Sbjct: 477 IYILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQRLLIPVTFAASHEECAALA 536

Query: 475 EHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIE 534
           +H E L   G++    G N +A+R  PA+L K ++  L RD+++E     ++ T+++   
Sbjct: 537 DHAEALAGFGLELSDMGGNTLAVRAAPAMLGKSDVVSLARDVLNEFAQVGSSQTIEEHEN 596

Query: 535 NILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +ILATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 597 HILATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|319410690|emb|CBY91069.1| DNA mismatch repair protein MutL [Neisseria meningitidis WUE 2594]
          Length = 658

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 227/659 (34%), Positives = 357/659 (54%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  + GGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELDGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      +I  +A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMIELLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  S  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSGSGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI--NKKGISTS------------SVLSKKM---- 341
           HP K+ IRFR+   +   +  ++ KA+   +  ++ S             V+S  M    
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRANLTESVGNAGEVLHDITGVVSTPMPSEN 358

Query: 342 --------ISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
                    S +   N P          KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DSENLFDSASDYPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMNTYAE 418

Query: 380 --------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
                   DL            +PS+ P    D  P+ +   S++    LG A AQ+   
Sbjct: 419 LYKKTDDIDLELNRLEQARFGNMPSETPIPKTDT-PLSDGLPSQSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM RQ   + K+ SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKRQRRENGKLQSQRLLIPSTFAASHEECAALAD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           H E L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++    
Sbjct: 538 HAEALAGFGLELSDMGGNTLAVRTVPAMLGKADVVSLAKDVLGELAQVGSSQTIEEHENR 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSVRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|253998998|ref|YP_003051061.1| DNA mismatch repair protein MutL [Methylovorus sp. SIP3-4]
 gi|253985677|gb|ACT50534.1| DNA mismatch repair protein MutL [Methylovorus sp. SIP3-4]
          Length = 624

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 218/629 (34%), Positives = 345/629 (54%), Gaps = 47/629 (7%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L +++I+QIAAGE++ERP+ A+KEL+ENSLDA SS +   +  GG    ++TD+G G
Sbjct: 4   IKLLPDQLISQIAAGEVVERPASALKELLENSLDAGSSDIAVTLGQGGVKLLRVTDDGNG 63

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +   ++ +A+ RH TSKI+  DD  ++ + GFRGEAL SI ++S  ++ SR  + +   +
Sbjct: 64  IPHGDLTLALTRHATSKIASLDDLESVASLGFRGEALASIASISRTSITSRHAEASHAWR 123

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA  G  +    P A++ GTIVEV+D++F  PAR  FLK+EQ E     +  RR+A++ P
Sbjct: 124 IAADGGLLGDAAPAALDRGTIVEVQDIYFNTPARRKFLKTEQTEFGHCEEAFRRIALSRP 183

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V F      + R  M      G    R ++V+G DF   A EL+E +  + L G    P
Sbjct: 184 DVGFMLQ--HNGRALMRL--APGEAKRRFTEVLGPDFSAEAFELDESAGGLRLWGMAAKP 239

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TF+R   +  YV++NGR V+DK I   IR AY + +   R+P   L LE+DP  VDVNVH
Sbjct: 240 TFSRSARDTQYVYVNGRFVRDKLISHAIRQAYQDVLHHDRHPAFALFLELDPTLVDVNVH 299

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAIN----------------------KKGISTSSVLS 338
           P+K+ +RFR    +  FI  ++ KA+                         GI       
Sbjct: 300 PSKTEVRFREGQAVHRFIFHALHKALATPVGLPANGLVPPPAAAPATSYSPGIPAGQPYP 359

Query: 339 KKMIS-SFHQDNAPKTH------LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSE 391
           ++  S     + AP  +      LP+ A    ++        + +S+ DL  +  P+ + 
Sbjct: 360 RQQGSFDLRANEAPGFYQTLFGGLPREAVDTASS-----FVPSAISSADLQATLSPSQAS 414

Query: 392 DNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK 451
            +   E++ A  Y LG A AQ+H  Y+++Q   GL++VD HAAHER+++E+++   +   
Sbjct: 415 SSLSPEQA-AQEYPLGFALAQLHGVYVLAQNALGLIVVDMHAAHERIMYERLKNALDGDS 473

Query: 452 ITSQTLLTPEIIDLLEGECALIMEH------DEDLHRLGIKAERFGPNAIAIREIPAILS 505
           +  Q LL P   +    E A + E        + LH+LG +  +  P+ +A+R IPA+L 
Sbjct: 474 VPMQPLLLPVSFNADRFEVATVQEQLSTPEGQQTLHQLGFEIVQLSPSTLAVRAIPAMLQ 533

Query: 506 KKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREME 565
             +   L RD++ ++ +   +  L +R   +LATMAC+ ++R+ R +   EMN LLR+ME
Sbjct: 534 DADAVALARDVLRDLREYGGSRVLTERRNELLATMACHAAVRANRILSIQEMNALLRDME 593

Query: 566 KNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
               S QCNHGRPT+ +  ++D++K+F R
Sbjct: 594 ATERSGQCNHGRPTWFQATMADLDKMFMR 622


>gi|254805223|ref|YP_003083444.1| DNA mismatch repair protein MutL [Neisseria meningitidis alpha14]
 gi|254668765|emb|CBA06657.1| DNA mismatch repair protein MutL [Neisseria meningitidis alpha14]
          Length = 658

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 228/659 (34%), Positives = 359/659 (54%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   +    
Sbjct: 63  GIHPDDIKLALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQDGSAHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSEATEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  S  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSGSGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI--NKKGISTS------------SVLSKKM---- 341
           HP K+ IRFR+   +   +  ++ KA+   +  ++ S             V+S  M    
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVVSTPMPSEN 358

Query: 342 --------ISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
                    S +   N P          KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DSENLFDSASDYPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQRSLSLRESRAAMNTYAE 418

Query: 380 --------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
                   DL            +PS+ P    D  P+ +   S++    LG A AQ+   
Sbjct: 419 LYKKTDGIDLELNRLEQARFGNMPSEMPIPKTDA-PLSDGIPSQSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM RQ   + K+ SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGKLQSQRLLIPVTFAASHEECAALSD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           H + L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++   +
Sbjct: 538 HADALAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLGELAQVGSSQTIEEHENH 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSIRAGRRLTLPEMNVLLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|296314214|ref|ZP_06864155.1| DNA mismatch repair protein MutL [Neisseria polysaccharea ATCC
           43768]
 gi|296839113|gb|EFH23051.1| DNA mismatch repair protein MutL [Neisseria polysaccharea ATCC
           43768]
          Length = 658

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 225/659 (34%), Positives = 360/659 (54%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ +E  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIEVELAGGGIRLIRVSDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQNDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  S  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPTQSLH----ERIAAIVGDDFQTASLEIDSGSGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSK- 339
           HP K+ IRFR+   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 340 ------KMISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
                    S++   N P          KT    Y ++    Q  L L+E+R + N    
Sbjct: 359 DSENLFNRASNYPTGNKPDTRNAFGSSGKTAPMPYQSAYAPQQRSLPLRESRAAMNTYAE 418

Query: 380 --------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
                   DL            +PS+ P    D  P+ +   S++    LG A AQ+   
Sbjct: 419 LYKKTDDIDLELSRFEQARFGNMPSETPAPKTDT-PLSDGIPSQSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM RQ   + ++ SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGRLQSQRLLIPVTFAASHEECAALAD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           + E L   G++    G N +A+R  PA+L K ++  L +D+++E     ++ T+++    
Sbjct: 538 YAETLAGFGLELSDMGGNTLAVRAAPAMLGKADVVSLAKDVLNEFAQVGSSQTIEEHENR 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSVRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|152980279|ref|YP_001352152.1| DNA mismatch repair protein [Janthinobacterium sp. Marseille]
 gi|166232093|sp|A6SV55|MUTL_JANMA RecName: Full=DNA mismatch repair protein mutL
 gi|151280356|gb|ABR88766.1| DNA mismatch repair protein [Janthinobacterium sp. Marseille]
          Length = 613

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 210/607 (34%), Positives = 347/607 (57%), Gaps = 21/607 (3%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ LS+++I+QIAAGE++ERPS  +KEL+EN+LDA ++ +   +  GG     ITDNG G
Sbjct: 11  IQPLSDQLISQIAAGEVVERPSAVVKELLENALDAGATAITVRLEQGGVKRIAITDNGRG 70

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +T E++P+A+ RH TSKI+  ++  N+ T GFRGEAL SI +V+ LTL SR        +
Sbjct: 71  ITPEQLPLALARHATSKINSLNELENVGTLGFRGEALASIASVAQLTLTSRTADAQHAWE 130

Query: 121 IA-ISG-EKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           I+ + G ++ ++V P +  PGT V+V+DL+F  PAR  FLK+EQ E     +V+RR+A++
Sbjct: 131 ISGVQGSDQKNTVAPSSGAPGTTVDVQDLYFNTPARRKFLKTEQTEFGHCAEVVRRIALS 190

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P V+F+ S    N   ++  + N +  +R + ++G +F    + L E +  + L G+ G
Sbjct: 191 RPDVAFSLS---HNGKTVDHWAVN-DIAKRSAHILGSEFSGARLPLEETAGPLHLHGFIG 246

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PT ++   +  Y ++NGR V+DK ++  +R+AY + +   RYP  V+ L++DP  VDVN
Sbjct: 247 LPTASKARGDAQYFYVNGRFVRDKLLMHAVRSAYQDVLHGDRYPSYVISLDLDPALVDVN 306

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKK-----GISTSSVLSKKMISSFHQDNAPKT 353
           VHP+K  +RFR+   +  F+  ++ +A+ +      G   S   +      + ++    T
Sbjct: 307 VHPSKIEVRFRDSRSVHQFVFHAVSRALAQTSATAFGAVPSPTPAPSGALPWLREQQQTT 366

Query: 354 HLPKY-----ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSE-DNDPVEESEATHYQLG 407
             P++         T     LF  +  ++     P+  P ++   N P +      + LG
Sbjct: 367 FAPQFQQQYGVAQTTANYGALFNTDGAVTPLGTEPA--PAFAAFTNSPAQTMSDDEFPLG 424

Query: 408 IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLE 467
            A AQ+H  +I++Q T GLV+VD HAAHER+++E+++   +   +  Q LL P      +
Sbjct: 425 FALAQLHGIFILAQNTKGLVLVDMHAAHERILYEQLKNALDDNAMQVQPLLIPITFYADD 484

Query: 468 GECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTY 527
            E     +  E L  LG       P  +AIR +P +L   +   L RD++ ++ +   + 
Sbjct: 485 VEVGTAEDSKETLLSLGFDIAVMSPTTLAIRAVPTLLKNADAQSLARDVLRDVREYGGSR 544

Query: 528 TLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSD 587
            L +R   +L T+AC+ ++R+ R +   EMN LLR+ME    + QCNHGRPT+++L LSD
Sbjct: 545 VLVERRNELLGTLACHTAVRANRMLTGPEMNALLRQMEATERADQCNHGRPTWVQLGLSD 604

Query: 588 IEKLFGR 594
           ++KLF R
Sbjct: 605 LDKLFER 611


>gi|319638431|ref|ZP_07993193.1| DNA mismatch repair protein mutL [Neisseria mucosa C102]
 gi|317400180|gb|EFV80839.1| DNA mismatch repair protein mutL [Neisseria mucosa C102]
          Length = 658

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 225/659 (34%), Positives = 359/659 (54%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   +    
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQDGSAHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKPVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 341 MISSFHQD--NAP---------------KTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
              +   D  N P               KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 NSENLFDDVSNYPTGNKSDTRNAFGSSGKTAPMPYQAARAPQQRSLSLRESRAAMNTYAE 418

Query: 380 --------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
                   DL            +PS+ PT   D  P+ +   S++    LG A AQ+   
Sbjct: 419 LYKKTDDIDLELSQFEQARFGNMPSEMPTQKTDT-PLSDGLPSQSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM RQ   +  + SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQRLLIPVTFAASHEECAALAD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           H E L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++   +
Sbjct: 538 HAEALAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLGELAQVGSSQTIEEHENH 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSVRAGRQLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|71908777|ref|YP_286364.1| DNA mismatch repair protein MutL [Dechloromonas aromatica RCB]
 gi|71848398|gb|AAZ47894.1| DNA mismatch repair protein MutL [Dechloromonas aromatica RCB]
          Length = 615

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 213/611 (34%), Positives = 341/611 (55%), Gaps = 28/611 (4%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I +L + +I+QIAAGE++ERP+  +KEL+ENSLDA S  ++  +  GG    +ITD+G G
Sbjct: 12  IARLPDLLISQIAAGEVVERPASVLKELLENSLDAGSKAIQVHLEEGGVKLIRITDDGCG 71

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  +E+ +A+ RH TSKIS  DD   + T GFRGEAL S+ +V+ L++ SR  +      
Sbjct: 72  IARDELALALTRHATSKISSLDDLERVGTLGFRGEALASVASVARLSITSR--ERGAAHA 129

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
             + GE  +   P A+  GT+VE+RDL+F  PAR  FLKSE  E     D ++R+A+  P
Sbjct: 130 WKLRGEPGAEPEPAALMAGTVVEMRDLYFNTPARRKFLKSESTEFAHCADAVKRLALTRP 189

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V+ + +    N     FQ    + P RI+ ++G++F+  A  ++  +  +++ G+   P
Sbjct: 190 DVAISLTHNGRNL----FQLAPADAPRRIADILGDEFLGAARAVDAGTGALSIGGFAIDP 245

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           T      +  YVF+NGR V+DK I   +R AY + +   R P V L + IDP  VDVNVH
Sbjct: 246 TRATDAKDGQYVFVNGRFVRDKIISHALREAYRDVLHGSRQPAVCLFVNIDPALVDVNVH 305

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINK--KGISTSSVLSKKMISSFHQ------DNAPK 352
           PAK+ +RFR+   +  F+  +IQ+ +    +  +  +++ +   SS +Q      +N P 
Sbjct: 306 PAKTEVRFRDSRAMHQFVFHAIQRTLAAPVQAEAAPALIERATPSSEYQAPALSPENRPN 365

Query: 353 THLPKYATSLTN-------TQEKLFLQENRLSTNDLLPSDDP--TYSEDNDPVEESEATH 403
               +YA  L +                   +  D+  S  P    +    P+E + +  
Sbjct: 366 V---EYAPPLRHQGSLGVAEPAAAAYLAFARAAQDIGQSPAPRSEVAPQFQPIESTGSDG 422

Query: 404 YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEII 463
             LG A AQ+H  YI++Q   GL+++D HAAHER+++EK++  F++ +I +Q LL P + 
Sbjct: 423 PPLGYALAQLHGIYILAQNARGLILIDMHAAHERILYEKLKTAFDNRQIATQALLIPAVF 482

Query: 464 DLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDS 523
                + A + EH + L  LG +    GPN + +R +PA+L   +   L + +I E+ + 
Sbjct: 483 SADPLDIAAVEEHADALADLGFQITPLGPNQLGVRAVPALLQSGDPAALAKSLIAELREH 542

Query: 524 STTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKL 583
             T     R   +LATMAC+G++R+ R++   EMN LLR+ME+   + QCNHGRPT+ +L
Sbjct: 543 GITQLATARRNELLATMACHGAVRARRQLTVPEMNALLRQMEETERAGQCNHGRPTWTEL 602

Query: 584 KLSDIEKLFGR 594
            +  ++KLF R
Sbjct: 603 TMDQLDKLFLR 613


>gi|134093680|ref|YP_001098755.1| DNA mismatch repair protein [Herminiimonas arsenicoxydans]
 gi|166232092|sp|A4G289|MUTL_HERAR RecName: Full=DNA mismatch repair protein mutL
 gi|133737583|emb|CAL60626.1| DNA mismatch repair protein MutL [Herminiimonas arsenicoxydans]
          Length = 612

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 216/610 (35%), Positives = 348/610 (57%), Gaps = 28/610 (4%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ LS+++I+QIAAGE++ERPS  +KEL+EN+LDA ++ +   +  GG     ITDNG G
Sbjct: 11  IQALSDQLISQIAAGEVVERPSAVVKELLENALDAGATHISVRLEQGGVKRIAITDNGRG 70

Query: 63  MTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  E++P+A+ RH TSKI+   +  N+ T GFRGEAL SI +VS LTL SR    +    
Sbjct: 71  IAPEQLPLALARHATSKINSLTELENVATLGFRGEALASIASVSQLTLTSR--TADAAHA 128

Query: 121 IAISG----EKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMA 176
             ISG    ++ S+V P +   GT V+V DL+F  PAR  FLK+EQ E     +V+RR+A
Sbjct: 129 WEISGVQSIDQKSTVAPSSGTAGTTVDVLDLYFNTPARRKFLKTEQTEFGHCAEVVRRIA 188

Query: 177 IAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
           ++ P V+F+ +    N   ++  + N +   R + ++G +F    + L E +  + L G+
Sbjct: 189 LSRPDVAFSLT---HNGKTIDHWAVN-DIARRSAHILGNEFSAARLPLKETAGPLRLHGF 244

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
            G+PT ++   +  Y ++NGR V+DK ++  +R+AY + +   RYP  V+ LE+DP  VD
Sbjct: 245 IGLPTASKARGDAQYFYVNGRFVRDKLLMHAVRSAYQDVLHGDRYPSYVISLELDPALVD 304

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKK-----GISTSSVLSKKMISSFHQDNAP 351
           VNVHP+K  +RFR+   +  F+  ++ +A+ +      G + S   +      + ++   
Sbjct: 305 VNVHPSKIEVRFRDSRAVHQFVFHAVTRALAQTSATAFGAAPSPTPAPSSALPWLREQQQ 364

Query: 352 KTHLPKYATSLTNTQEKL---FLQENRLSTND---LLPSDDPTYSEDNDPVEESEATHYQ 405
            T  P++ +     Q       L  N  ++ND     PS     S     + + E   + 
Sbjct: 365 STFAPQFNSPYGVAQSAANYGALFANGPASNDSNSAAPSLHTAGSHGATTLPDDE---FP 421

Query: 406 LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDL 465
           LG A AQ+H  +I++Q T GLV+VD HAAHER+++E+++   +  ++  Q LL P I   
Sbjct: 422 LGFALAQLHGIFILAQNTKGLVLVDMHAAHERILYEQLKHALDDNELQVQPLLIP-ITFY 480

Query: 466 LEGECALIMEHDED-LHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSS 524
            +G      E ++D LH LG       P  +A+R +PA+L   +   L RD++ ++ +  
Sbjct: 481 ADGMEVGTTEDNQDILHALGFDIAALSPTTLAVRAVPALLKNADAQTLARDVLRDVREFG 540

Query: 525 TTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLK 584
            +  L +R   +L T+AC+ ++R+ R +   EMN LLR+ME    + QCNHGRPT+++L 
Sbjct: 541 GSRVLLERRNELLGTLACHTAVRANRTLTVPEMNALLRQMEATERADQCNHGRPTWVQLG 600

Query: 585 LSDIEKLFGR 594
           LSD++KLF R
Sbjct: 601 LSDLDKLFER 610


>gi|307825900|ref|ZP_07656115.1| DNA mismatch repair protein MutL [Methylobacter tundripaludum SV96]
 gi|307733019|gb|EFO03881.1| DNA mismatch repair protein MutL [Methylobacter tundripaludum SV96]
          Length = 614

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 214/619 (34%), Positives = 356/619 (57%), Gaps = 32/619 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M+I  L  +++NQIAAGE++ERPS  +KEL+EN  DA +S+V   I  GG    +I DNG
Sbjct: 1   MRIHSLPTQLVNQIAAGEVVERPSSVVKELVENCFDAGASQVSIEIEQGGARLIKIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  E++P+A+ RH TSKI+   D   + + GFRGEALPSI +VS LTL+SR    +  
Sbjct: 61  CGIVKEDLPLALSRHATSKIASLKDLEQVVSMGFRGEALPSISSVSRLTLISRISDADCA 120

Query: 119 AQIAISG-EKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
            ++   G E+  + +P     GT ++VRDLF+  PAR  FLK+E+ E   I  +I+RMA+
Sbjct: 121 WRVNADGTEQDFNPQPDPHPQGTTIDVRDLFYNTPARRKFLKTEKTEFAHIETLIKRMAL 180

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           +   + F  S  +   + +    T     +RI+ + G  FI N+++++  ++ + L G+ 
Sbjct: 181 SRFDIGFILSHNQKEIFNLKPAITESEQEQRIAGICGSAFIENSIKIDFAASGLQLTGWV 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PTF+R   +  + ++NGR V+DK +   ++ AY + +  GR+PV VL L +DP  VDV
Sbjct: 241 GLPTFSRSQQDMQFFYVNGRLVRDKLVSHAVKQAYQDVLFHGRHPVFVLYLTLDPALVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAIN--KKGIS------------TSSVLSKKMIS 343
           N HPAK  +RFR   ++ +F+  ++ +++   + G +            T +VL  K  +
Sbjct: 301 NAHPAKLEVRFREGRLVHDFLFSALHRSLADLRPGRNLMQQVEVEALPQTPAVLDAKPNN 360

Query: 344 -SFHQDNAPKTHLP----KYATSLTNTQEK---LFLQENRLSTNDLLPSDDPTYSEDNDP 395
            ++  D+  +   P    K A S  + Q+    L ++E   +   L P  +P        
Sbjct: 361 VAWLNDSVTQQSKPNFDNKTAYSSRSPQQASLPLHVEEAMQAYASLYPKPEPV------- 413

Query: 396 VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQ 455
            + ++     LG A A +H  YI+S+T +G+++VD HAAHER+ +E+++Q + +  + +Q
Sbjct: 414 AQSAQPEARPLGHAIAHLHNIYILSETPNGIILVDAHAAHERVTYERLKQQYQNGAVPNQ 473

Query: 456 TLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRD 515
            LL P  I +   E  L  +  E  + LG +  R G   I +R IP +L   ++  L+RD
Sbjct: 474 PLLLPIKIKVSAAEADLAEQEHEFFNTLGFEINRSGLETIVLRSIPVLLGNTDMETLVRD 533

Query: 516 IIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNH 575
           ++ ++I+   +  +Q++   ILAT+AC+G++R+ R++   EMN LLR+ME+     QCNH
Sbjct: 534 VLADMIEHGMSQRIQEKSNEILATVACHGAVRAHRRLTIDEMNALLRDMEQTERIGQCNH 593

Query: 576 GRPTFIKLKLSDIEKLFGR 594
           GRPT+++L  +D++K F R
Sbjct: 594 GRPTWVELSTNDLDKFFLR 612


>gi|261364762|ref|ZP_05977645.1| DNA mismatch repair protein MutL [Neisseria mucosa ATCC 25996]
 gi|288567069|gb|EFC88629.1| DNA mismatch repair protein MutL [Neisseria mucosa ATCC 25996]
          Length = 664

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 223/668 (33%), Positives = 354/668 (52%), Gaps = 83/668 (12%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ +E  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIEVELAGGGIRLIRVSDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   +    
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQDGSAHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++GEDF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGEDFQAVSLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK-------------------KGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                      GI  ++  S+ 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRADLTESVGNAGEVLHEITGIRPAATSSEN 358

Query: 341 MISSFHQD----------NAPKTHLPK--------------YATSLTNTQEKLFLQENRL 376
             + F Q+            P TH+ +              Y  +    Q  L L+E+R 
Sbjct: 359 EHNQFLQNPTASSETIFAAVPNTHVSEPRNSFSSGKIAPMPYQAARAPQQRSLSLRESRA 418

Query: 377 STN-----------------------------DLLPSDDPTYSEDNDPVEESEATHYQLG 407
           + N                                 S+ P ++  +DP  E       LG
Sbjct: 419 ALNTYAELFKNTAADEADIELAQFEQARFGSTSATSSETPAHTFSDDPKPELPP----LG 474

Query: 408 IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLL 466
            A AQ+   YI++Q  D L+++D HAA ER+ +EKM RQ   +  + SQ LL P      
Sbjct: 475 FAIAQLLGIYILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQRLLIPVTFAAS 534

Query: 467 EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTT 526
             ECA + +H + L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++
Sbjct: 535 HEECATLADHADTLAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLGELAQVGSS 594

Query: 527 YTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLS 586
            T+++   +ILATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L 
Sbjct: 595 QTIEEHENHILATMSCHGSVRAGRQLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLK 654

Query: 587 DIEKLFGR 594
           +++ LF R
Sbjct: 655 ELDALFLR 662


>gi|218768445|ref|YP_002342957.1| DNA mismatch repair protein [Neisseria meningitidis Z2491]
 gi|20455150|sp|Q9JTS2|MUTL_NEIMA RecName: Full=DNA mismatch repair protein mutL
 gi|121052453|emb|CAM08789.1| DNA mismatch repair protein [Neisseria meningitidis Z2491]
          Length = 658

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 224/659 (33%), Positives = 359/659 (54%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  + GGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELDGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      +I R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMIERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  S  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSGSGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSK- 339
           HP K+ IRFR+   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 340 ------KMISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
                    S +   N P          KT    Y ++    Q  L L+E+R + N    
Sbjct: 359 DSENLFNRASDYPTGNKPDTRNAFGSSGKTAPMPYQSAYAPQQRSLSLRESRAAMNTYAE 418

Query: 380 --------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
                   DL            +PS+ P    D  P+ +   S++    LG A AQ+   
Sbjct: 419 LYKKTDDIDLELSQFEQARFGNMPSETPAPKTDT-PLSDGIPSQSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM RQ   + ++ SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGRLQSQRLLIPITFAASHEECAALAD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           + E L   G++    G N +A+R +P +L K ++  L RD++ E+    ++ T+++   +
Sbjct: 538 YAETLAGFGLELSDMGGNTLAVRAVPTMLGKADVVSLARDVLGELAQVGSSQTIEEHENH 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSVRAGRQLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|261400853|ref|ZP_05986978.1| DNA mismatch repair protein MutL [Neisseria lactamica ATCC 23970]
 gi|269209324|gb|EEZ75779.1| DNA mismatch repair protein MutL [Neisseria lactamica ATCC 23970]
          Length = 658

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 226/659 (34%), Positives = 356/659 (54%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++GEDF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGEDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 341 -------MISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
                    S +   N P          KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DNENLFDSASDYPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQRSLSLRESRAAINTYAE 418

Query: 380 --------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
                   DL            +PS+ P    D  P+ +   S +    LG A AQ+   
Sbjct: 419 LYKKTDDIDLELSRFEQARFGNMPSETPAPQTDT-PLSDGIPSPSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM RQ   + ++ SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKRQRRENGRLQSQRLLIPVTFAASHEECAALAD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           + E L   G++    G N +A+R  PA+L K ++  L RD++ E     ++ T+++    
Sbjct: 538 YAETLAGFGLELSDMGGNTLAVRAAPAMLGKSDVVSLARDVLGEFAQVGSSQTIEEHENR 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|257094379|ref|YP_003168020.1| DNA mismatch repair protein MutL [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257046903|gb|ACV36091.1| DNA mismatch repair protein MutL [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 615

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 208/613 (33%), Positives = 345/613 (56%), Gaps = 25/613 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + +I+QIAAGE+++RP+  +KEL+EN+LDA SS ++  +  GG    +++D+G 
Sbjct: 6   RIALLPDLLISQIAAGEVVDRPASVLKELLENALDAGSSTIQIQLEEGGVKLLRVSDDGG 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           GM  +E+ +A+ RH TSKI+   D   + T GFRGEAL S+ AV+ LTL SR   ++  A
Sbjct: 66  GMARDELALALTRHATSKINSLADLERVGTLGFRGEALASVAAVARLTLTSRQASSDRAA 125

Query: 120 ---QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMA 176
                 ++ E  +  +P A+  GT+VE+RDL++  PAR  FLKSE  E     + ++R+A
Sbjct: 126 GQHAWRLTDEPGAGPQPAALQAGTVVEMRDLYYNTPARRKFLKSEGSEFAHCAEAVKRIA 185

Query: 177 IAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
           +A+P V+FT S   + R  ++  +++     R+  ++G++F+  +  L+  +  + + GY
Sbjct: 186 LAHPGVAFTLS--HNGRVALHLSASDSRV--RVGAILGDEFLAESRCLDVSAGPLRVAGY 241

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
             +P ++R   +  Y ++NGR V+DK +   +R AY + +   RYP   L L+IDP  VD
Sbjct: 242 CALPAYSRARGDAQYCYVNGRFVRDKLLGHALRQAYQDLLHGSRYPAYCLFLDIDPAGVD 301

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKK----GISTSSVLS--KKMISSFHQDN- 349
           VNVHP K+ +RFR+   +  F+  ++Q+ +       G ++SS +      +S + +   
Sbjct: 302 VNVHPQKTEVRFRDARAVHQFVFHAVQRLLASPLATLGTASSSEVPTPNTQVSPWPEQRP 361

Query: 350 -APKTHL--PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQ- 405
            AP  H   P      T  Q  L + E        L   D T S +  P E S A     
Sbjct: 362 AAPAMHAAEPVAFGRRTPFQGSLHVGEP-ARAGTYLSFVDATQSPEPAPEELSNAAGDDG 420

Query: 406 ----LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPE 461
               LG A AQ+   YI++Q T GL++VD HAAHER+++E+++Q  +  ++ +Q LL P 
Sbjct: 421 RAPPLGYALAQLQGVYILAQNTHGLIVVDMHAAHERILYERLKQALDGERVATQPLLIPA 480

Query: 462 IIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEII 521
           +      + A   EH   L RLG      GP  +A+R +PA+L   +   L+R ++ E+ 
Sbjct: 481 VFMADALDVAAAEEHSVALQRLGFDVAAMGPRQLAVRSVPALLLGGDPAALVRSLLGELR 540

Query: 522 DSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFI 581
           +   +  +      +LA+MAC+G++R+ R +   EMN LLR+ME+   S  CNHGRPT++
Sbjct: 541 EHGISQLMTTHRNELLASMACHGAVRARRLLSLSEMNALLRQMEETERSDHCNHGRPTWM 600

Query: 582 KLKLSDIEKLFGR 594
           +  ++++++ F R
Sbjct: 601 QFSMAELDRYFQR 613


>gi|261380220|ref|ZP_05984793.1| DNA mismatch repair protein MutL [Neisseria subflava NJ9703]
 gi|284797072|gb|EFC52419.1| DNA mismatch repair protein MutL [Neisseria subflava NJ9703]
          Length = 658

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 224/659 (33%), Positives = 360/659 (54%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATTIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDSKQVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNTLTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSKK 340
           HP K+ IRF +   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFHDSQQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 341 -------MISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
                    S++   N P          KT    Y  S    Q  L L+E+R + N    
Sbjct: 359 NSENLFDSASNYPTGNKPDTRNAFGPSGKTAPMPYQASRAPQQRSLSLRESRAAMNTYAE 418

Query: 380 --------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
                   DL            +PS+ PT   D  P+ +   S++    LG A AQ+   
Sbjct: 419 LYKKTDDIDLELSQFEQACFGNMPSETPTPQTDT-PLSDGLPSQSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKMR-QDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM+ Q   +  + SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKLQRQENGNLQSQRLLIPVTFAASHEECASLAD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           H E L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++   +
Sbjct: 538 HAETLAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLGELAQVGSSQTIEEHENH 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSVRAGRQLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|325128499|gb|EGC51377.1| DNA mismatch repair protein MutL [Neisseria meningitidis N1568]
          Length = 658

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 224/659 (33%), Positives = 359/659 (54%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  + GGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELDGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSEATEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSK- 339
           HP K+ IRFR+   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRADLTESVGNAGEVLHDITGVTPAPMPSEN 358

Query: 340 ------KMISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
                    S +   N P          KT    Y ++    Q  L L+E+R + N    
Sbjct: 359 DSENLFNRASDYPTGNKPDTRNAFGASGKTAPMPYQSAYAPQQRSLSLRESRAAMNTYAE 418

Query: 380 --------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
                   DL            +PS+ P    D  P+ +   S +    LG A AQ+   
Sbjct: 419 LYKKTDDIDLELSRFEQARFGNMPSETPAPQTDT-PLSDGIPSPSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM RQ   + K+ SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGKLQSQRLLIPVTFAASHEECAALAD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           + E L   G++    G N +A+R +PA+L K ++  L +D+++E+    ++ T+++    
Sbjct: 538 YAETLAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLNELAQVGSSQTIEEHENR 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|298368806|ref|ZP_06980124.1| DNA mismatch repair protein MutL [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298282809|gb|EFI24296.1| DNA mismatch repair protein MutL [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 665

 Score =  392 bits (1007), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 225/665 (33%), Positives = 355/665 (53%), Gaps = 76/665 (11%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA+++ +E  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDADATAIEVELAGGGIRLIRVSDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   +    
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQDGSAHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+S+    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSNPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNA-VELNEKSNEITLQGYTG 238
           P ++F+        +K+  Q    N  ERI+ ++GEDF   A +E++  +  + L G   
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQ----NLHERIAAIVGEDFQAAASLEIDSGNGALRLYGAIA 238

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVN
Sbjct: 239 KPTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVN 298

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINK-------------------KGISTSSVLSK 339
           VHP K+ IRFR+   +   +  ++ KA+                      GI  ++  S+
Sbjct: 299 VHPTKTEIRFRDSQQVHQLVFHTLNKALADTRADLTESVGNAGEVLHEITGIRPAATSSE 358

Query: 340 KMISSFHQD----------NAPKTHL--PKYATSLTNT------------QEKLFLQENR 375
              S FH +           AP  H   P+ A S   T            Q  L L+E+R
Sbjct: 359 NEHSGFHPNPTASSENIFAAAPSAHTSEPRNAFSSGKTAPMPYQAARAPQQRSLSLRESR 418

Query: 376 LSTN----------------DLLPSDDPTYSEDNDPVEESEATHYQ---------LGIAC 410
            + N                +L   +   +   +    E+ A  +          LG A 
Sbjct: 419 AALNTYAELFKNTAADEADIELAQFEQARFGSTSATSSENSARSFSDDPKPELPPLGFAI 478

Query: 411 AQIHQNYIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGE 469
           AQ+   YI++Q  D L+++D HAA ER+ +EKM RQ   +  + SQ LL P        E
Sbjct: 479 AQLLGIYILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQRLLIPVTFAASHEE 538

Query: 470 CALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTL 529
           CA + +H + L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+
Sbjct: 539 CAALADHADTLAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLGELAQVGSSQTI 598

Query: 530 QDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIE 589
           ++   +ILATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++
Sbjct: 599 EEHENHILATMSCHGSVRAGRQLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELD 658

Query: 590 KLFGR 594
            LF R
Sbjct: 659 ALFLR 663


>gi|329120521|ref|ZP_08249185.1| DNA mismatch repair protein MutL [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327461260|gb|EGF07592.1| DNA mismatch repair protein MutL [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 699

 Score =  392 bits (1006), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 227/646 (35%), Positives = 347/646 (53%), Gaps = 69/646 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ +   I GGG    ++TDNG 
Sbjct: 68  RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAISVEIEGGGVKLLRVTDNGA 127

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++ +A+ RH TSKIS   D   + + GFRGE L SI +VS LTL SR  Q+  G 
Sbjct: 128 GIHPDDLALALSRHATSKISGLRDLERVASMGFRGEGLASIASVSRLTLTSR--QSGEGH 185

Query: 120 QIAISGE--KISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
              I  E   +S V   A   GT VEV DLFF  PAR  FLKS+  E      ++ R+A+
Sbjct: 186 ARTIRAEDGSLSPVSAAAAPEGTTVEVADLFFNTPARRKFLKSDNTEAAHCAAMLERLAL 245

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           A+P  +F+ +      +K+  Q+       R + ++G DF   ++ ++ ++  +TL G  
Sbjct: 246 AFPATAFSLTREGKPVFKLPPQTLEA----RAAAIVGHDFQTASLPVSAQAGGMTLYGLI 301

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
             PTF +G + Q Y F+N R V+DK IL  ++ AY + +     P  VL L++ P  VD 
Sbjct: 302 AKPTFAKGKSTQQYCFVNRRCVRDKVILHAVKQAYRDVLHHALVPAFVLFLDLPPEAVDA 361

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAI-NKKGISTSSVLSKKMISSFHQ--------- 347
           NVHPAK+ IRFR+ + +  F+  ++ KA+ + +   T S+ +   +   HQ         
Sbjct: 362 NVHPAKTEIRFRDSSAVHQFVFHTLDKALADTRADRTESIGNAGAL--LHQIAGIPDADR 419

Query: 348 ------------DNAP----KTHLPKYATSLTNTQEKLFLQENR---------------- 375
                        NAP    KT    YA +    Q  L L E+R                
Sbjct: 420 PSENPQNPFSDAPNAPTGGGKTAPAPYARA--PQQRSLGLNESRRALDTYAELYRRSPQE 477

Query: 376 ------LSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIV 429
                 L  +  LP + P+ +  ++P E      + LG A AQ+   YI++Q  D L+++
Sbjct: 478 DHELAALEHSRRLPPERPSENPSDNPPE------HPLGYAIAQLLGIYILAQAEDSLLLI 531

Query: 430 DQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAE 488
           D HAA ER+ +EKM RQ     ++ SQ+LL P        E A + EH + L   G+   
Sbjct: 532 DMHAAAERVNYEKMKRQRDTQGRLNSQSLLIPVTFAASREETAALAEHADSLRAYGLDLS 591

Query: 489 RFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRS 548
             G N IA+R +P +L   +I  L RD++ +  +   +  ++ R   +LATM+C+GS+R+
Sbjct: 592 AVGENRIAVRAVPQMLGTSDIESLARDMLRDFAEHGASQQIEARENRLLATMSCHGSVRA 651

Query: 549 GRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 652 GRRLTLPEMNALLRDMEHTPRSNQCNHGRPTWVKLTLKELDALFLR 697


>gi|82702273|ref|YP_411839.1| DNA mismatch repair protein MutL [Nitrosospira multiformis ATCC
           25196]
 gi|82410338|gb|ABB74447.1| DNA mismatch repair protein MutL [Nitrosospira multiformis ATCC
           25196]
          Length = 616

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 219/620 (35%), Positives = 345/620 (55%), Gaps = 37/620 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L + +I+QIAAGE++ERP+ A+KEL+ENSLDA ++ V   +  GG    ++ DNG G
Sbjct: 4   IQPLPDLLISQIAAGEVVERPASALKELLENSLDAGATEVTVQLFQGGVKLVRVADNGAG 63

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           ++ E++P+A+ RH TSKI   +D  N+ + GFRGEAL SI +VS L L+SR   +    +
Sbjct: 64  ISGEDLPLALARHATSKIRTLEDLQNVPSLGFRGEALASIASVSRLALVSRSAGDKHAWR 123

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I     + +   P A   GT VE+RDL+F  PAR  FLK+E  E      V +R+A++ P
Sbjct: 124 IEAEAGRFTPPEPAAFAQGTAVEMRDLYFNTPARRKFLKTEATEFAHCESVFKRIALSRP 183

Query: 181 KVSFTF---STIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            V FT     T++S+      ++ +     RI+ V+G++F   +V +++++ ++ L G  
Sbjct: 184 SVGFTLQHNGTVRSH-----LRTADARL--RIAAVLGDEFSQASVFVDDQAADLRLWGMA 236

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
            +P ++R + +  Y F+NGR V+DK +   +R AY + + L R+P  VL LEI+   VDV
Sbjct: 237 ALPAYSRSSGDAQYFFVNGRFVRDKLVAHALREAYRDILHLDRHPAFVLFLEINGGGVDV 296

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGIS-TSSVLSKKMISSFHQDNAPKTHL- 355
           NVHP+K+ +RFR+P  +  FI  ++ KA+    ++  ++V     +  F +  A +  L 
Sbjct: 297 NVHPSKTEVRFRDPRALHQFIFHTVDKALAMPHLTGGAAVPVAGKLPEFTRKAAGEVSLA 356

Query: 356 -PKY-----------ATSLTNTQEKLFLQ---------ENRLSTNDLLPSDDPTYSEDND 394
            P Y           A  +   Q + F Q           R +      +    + +   
Sbjct: 357 PPAYSRQDAIPFASAAPQIKAAQPQAFYQVLFGSDSNAGTRQTGYQAGINGQSAFMKPEG 416

Query: 395 PVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITS 454
            V E E     LG A AQ+   YI+SQ   GL+IVD HAAHER+++EK++   ++  ++ 
Sbjct: 417 TVREPEIP--PLGFALAQLLGVYILSQNERGLLIVDMHAAHERILYEKLKSALDNHTLSM 474

Query: 455 QTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLR 514
           Q LL P        + A   E+   LH +G +   F P  +A+R +PA L   ++  L R
Sbjct: 475 QPLLIPAAFRADSQDIATAEENSAVLHDIGFEISPFSPVMLAVRAVPAALKDADVVTLAR 534

Query: 515 DIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCN 574
           D+++EI +   +  L  R   +LATMAC+G+IR+ R +   EMN LLREME    S QCN
Sbjct: 535 DVLNEIREFGGSQVLVSRRNELLATMACHGAIRANRSLSIPEMNALLREMEITERSGQCN 594

Query: 575 HGRPTFIKLKLSDIEKLFGR 594
           HGRPT+ ++  +D++K+F R
Sbjct: 595 HGRPTWFEISRTDLDKMFMR 614


>gi|332283318|ref|YP_004415229.1| DNA mismatch repair protein [Pusillimonas sp. T7-7]
 gi|330427271|gb|AEC18605.1| DNA mismatch repair protein [Pusillimonas sp. T7-7]
          Length = 624

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 207/623 (33%), Positives = 353/623 (56%), Gaps = 38/623 (6%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I +L + +I+QIAAGE+IERP+  +KEL+EN++DA +  +E  + GGG     ++D+G G
Sbjct: 7   IAQLPDLLISQIAAGEVIERPASVLKELLENAIDAGARAIEVRLDGGGIRRISVSDDGSG 66

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +   E+ +A+ RH TSKIS  D+   +++ GFRGEAL S+ +V+ LTL SR        Q
Sbjct: 67  IPKSELKLALTRHATSKISSLDELEAVNSMGFRGEALASVASVARLTLTSRSAAEPHAWQ 126

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I    ++ S+    + + GT ++VR LF  +PAR  FL++E  E     D + R+A+A+P
Sbjct: 127 IEAEQDEPSAA---SGSMGTTIDVRQLFDNVPARRKFLRAEATEYGHCVDALERIALAHP 183

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            ++F      +++ + N++++     +R+  V+G++F +  + +  +   I+LQG    P
Sbjct: 184 HIAFRL--FHNDKAQRNWRASE--VGQRVRDVLGQEFTDQGLYVEHEQGLISLQGVITRP 239

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           T+ R  A++ Y+++NGR V+D+ +   +R AYA+ +   R P  VL L IDP  VDVNVH
Sbjct: 240 TYARSRADRQYLYVNGRYVKDRTVAHAVRQAYADVLHGDRQPAFVLFLTIDPAMVDVNVH 299

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKG---ISTSSVLSKK--------MISSFHQDN 349
           PAK  +RFR    I  F+ Q++ + ++  G   ++TS + +           +S+     
Sbjct: 300 PAKHEVRFRESGAIHRFVNQTLTQVLSAAGGQSLATSELAANHPTESAQAGTMSTDSYAT 359

Query: 350 APKTH--LPKYATSLTNTQEKLFL------QENRLSTNDLLPSDDPTYSE---------- 391
            P  H   P  A  + + Q  +        Q+     ++  P     +            
Sbjct: 360 EPGIHQPAPTGAGGIADGQAPIPAPYRPQQQQQTFRLHEQAPGRKQDWQSLYRPLDAPAV 419

Query: 392 DNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK 451
             D  + + A  + LG+A  Q+H  YI++Q  DGLV+VD HAAHER+++E++++  ++  
Sbjct: 420 HADVADSTGAAEFPLGMALGQLHGIYILAQNHDGLVLVDMHAAHERVVYEELKKAMDAQS 479

Query: 452 ITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQ 511
           +  Q LL P + +  E +  LI EH   L+ LG+     GPN+ A+R +PA+L+  +I  
Sbjct: 480 LPRQELLVPVVFNATEKDIGLIEEHAHTLNELGLSIRPAGPNSAAVRAVPALLANGDIEA 539

Query: 512 LLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSS 571
           L R ++ ++     +  L ++   +L+TMAC+GS+R+ R++   EMN LLR+ME+   + 
Sbjct: 540 LARSVLRDLASVGVSPRLTEQRNELLSTMACHGSVRANRRLTLDEMNGLLRKMEQTERAD 599

Query: 572 QCNHGRPTFIKLKLSDIEKLFGR 594
           QCNHGRPT+++ K+ +++KLF R
Sbjct: 600 QCNHGRPTWVQWKVGELDKLFMR 622


>gi|161870311|ref|YP_001599481.1| DNA mismatch repair protein [Neisseria meningitidis 053442]
 gi|189030402|sp|A9M0G1|MUTL_NEIM0 RecName: Full=DNA mismatch repair protein mutL
 gi|161595864|gb|ABX73524.1| DNA mismatch repair protein [Neisseria meningitidis 053442]
          Length = 658

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 223/659 (33%), Positives = 359/659 (54%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  + GGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELDGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKPVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 341 -------MISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
                    S +   N P          KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DSENLFDSASDYPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMNTYAE 418

Query: 380 --------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
                   DL            +PS+ P    D  P+ +   S++    LG A AQ+   
Sbjct: 419 LYKKTDDIDLELSRLEQARFGNMPSETPIPKTDT-PLSDGIPSQSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM RQ   + K+ SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGKLQSQRLLIPVTFAASHEECAALAD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           + E L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++   +
Sbjct: 538 YAETLAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLGELAQVGSSQTIEEHENH 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSVRAGRQLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|261377459|ref|ZP_05982032.1| DNA mismatch repair protein MutL [Neisseria cinerea ATCC 14685]
 gi|269146187|gb|EEZ72605.1| DNA mismatch repair protein MutL [Neisseria cinerea ATCC 14685]
          Length = 658

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 223/662 (33%), Positives = 356/662 (53%), Gaps = 77/662 (11%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  + GGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELVGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++GEDF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGEDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVTPAPMSSEN 358

Query: 341 -------MISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTND--- 380
                    S++   N P          KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DNENLFDSASNYPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMNTYAE 418

Query: 381 ---------------------------LLPSDDPTYSEDNDPVEESEATHYQLGIACAQI 413
                                      L+P  D   S D  P   S++    LG A AQ+
Sbjct: 419 LYKKTDDIDLELSQFEQVRFGNMPSEMLIPQTDTPLS-DGIP---SQSELPPLGFAIAQL 474

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECAL 472
              YI++Q  D L+++D HAA ER+ +EKM RQ   + K+ SQ LL P        ECA 
Sbjct: 475 LGIYILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGKLQSQRLLIPVTFAASHEECAA 534

Query: 473 IMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDR 532
           + +H + L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++ 
Sbjct: 535 LSDHADALAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLGELAQVGSSQTIEEH 594

Query: 533 IENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLF 592
             +ILATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF
Sbjct: 595 ENHILATMSCHGSVRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALF 654

Query: 593 GR 594
            R
Sbjct: 655 LR 656


>gi|6018218|gb|AAF01798.1|AF170912_2 MutL homolog [Caulobacter crescentus CB15]
          Length = 526

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 198/527 (37%), Positives = 302/527 (57%), Gaps = 40/527 (7%)

Query: 106 LTLMSRPPQNNTGAQIAISGEKISSVRPVAM-NP-GTIVEVRDLFFTIPARLNFLKSEQV 163
           L + SR         I + G ++  V P A   P G  +EVRDLF+  PARL F+KSE+ 
Sbjct: 1   LQISSRAKGAKDAFSILVEGGQVGEVAPAAFPGPHGARIEVRDLFYATPARLKFMKSERA 60

Query: 164 ETNLITDVIRRMAIAYPKVSFTFSTIKSN--RYKMNFQSTNGNFPERISQVIGEDFINNA 221
           E   IT+ I+R A+A   V F+         R         G    R++ V+G +F  NA
Sbjct: 61  EALAITEEIKRQAMANESVGFSLDIDGRRVLRLPPEHPGPQGRL-ARLAAVLGREFQENA 119

Query: 222 VELNEKSNEITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRY 281
           +E+++  + + L G+ G+PT+NRGNA   Y+F+NGR V+D+ +   +R AYA+ +   R+
Sbjct: 120 LEIDQTRDGVRLSGFAGLPTYNRGNAAHQYLFVNGRPVRDRLLQGALRAAYADFLARDRH 179

Query: 282 PVVVLLLEIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKM 341
           P   L + ++  +VDVNVHPAK+ +RFR+P ++R  I+ +++ A+   G   S+ ++ + 
Sbjct: 180 PTAALYVTLETTEVDVNVHPAKAEVRFRDPALVRGLIVGALRHALAGAGHRASTTVAAQA 239

Query: 342 ISSFHQDNAP-KTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSD-----------DPTY 389
           + S     +P   + P+Y    +      + +E   +     P D           +P+Y
Sbjct: 240 LDSIRAQQSPFPGYQPQYQPGPSPAGFSAW-REGGWTPPTQRPMDLPGLNEVSARVEPSY 298

Query: 390 S----------------EDNDPVEESEAT------HYQLGIACAQIHQNYIISQTTDGLV 427
                            ED  P +   AT       Y LG A AQ+H+ YI++QT DG+V
Sbjct: 299 GGDLAGVVREAYAAAAFEDRPPTDYPGATAPFDPVDYPLGAARAQVHETYIVAQTRDGMV 358

Query: 428 IVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKA 487
           IVDQHAAHERL++E+M+ +  S  +T QTLL PE++DL   E   ++   E+L  LG+  
Sbjct: 359 IVDQHAAHERLVYERMKGEMASGGVTRQTLLLPEVVDLDPAEAERVVARAEELAGLGLVL 418

Query: 488 ERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIR 547
           E FGP A+ +RE PA+L K +   L+RDI D++ ++     L++R+E + +TMAC+GS+R
Sbjct: 419 ESFGPGAVLVRETPALLGKTDAAALVRDIADDLAENGQALALKERLEEVCSTMACHGSVR 478

Query: 548 SGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +GR++   EMN LLREME  P+S QCNHGRPT+++LKL+DIEKLFGR
Sbjct: 479 AGRRLNGAEMNALLREMEATPHSGQCNHGRPTYVELKLADIEKLFGR 525


>gi|194098697|ref|YP_002001759.1| DNA mismatch repair protein [Neisseria gonorrhoeae NCCP11945]
 gi|239999002|ref|ZP_04718926.1| DNA mismatch repair protein [Neisseria gonorrhoeae 35/02]
 gi|240080646|ref|ZP_04725189.1| DNA mismatch repair protein [Neisseria gonorrhoeae FA19]
 gi|240112989|ref|ZP_04727479.1| DNA mismatch repair protein [Neisseria gonorrhoeae MS11]
 gi|254493793|ref|ZP_05106964.1| DNA mismatch repair protein [Neisseria gonorrhoeae 1291]
 gi|268594850|ref|ZP_06129017.1| DNA mismatch repair protein mutL [Neisseria gonorrhoeae 35/02]
 gi|268596770|ref|ZP_06130937.1| DNA mismatch repair protein mutL [Neisseria gonorrhoeae FA19]
 gi|268599068|ref|ZP_06133235.1| DNA mismatch repair protein [Neisseria gonorrhoeae MS11]
 gi|238690209|sp|B4RLX4|MUTL_NEIG2 RecName: Full=DNA mismatch repair protein mutL
 gi|193933987|gb|ACF29811.1| DNA mismatch repair protein [Neisseria gonorrhoeae NCCP11945]
 gi|226512833|gb|EEH62178.1| DNA mismatch repair protein [Neisseria gonorrhoeae 1291]
 gi|268548239|gb|EEZ43657.1| DNA mismatch repair protein mutL [Neisseria gonorrhoeae 35/02]
 gi|268550558|gb|EEZ45577.1| DNA mismatch repair protein mutL [Neisseria gonorrhoeae FA19]
 gi|268583199|gb|EEZ47875.1| DNA mismatch repair protein [Neisseria gonorrhoeae MS11]
 gi|317164295|gb|ADV07836.1| DNA mismatch repair protein [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 658

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 225/659 (34%), Positives = 356/659 (54%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ V+  + GGG    ++ DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAVDVELEGGGIRLIRVGDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  ++ + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSGNSALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL LE+ P+ VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLELPPKAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRANLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 341 -------MISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLS------ 377
                    S+    N P          KT    Y  +    Q  L L+E+R +      
Sbjct: 359 DSENLFDSASNHPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMDTYAE 418

Query: 378 ----TNDL--------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
               T+D+              +PS+ P +  D  P+ +   S++    LG A AQ+   
Sbjct: 419 LYKKTDDIDLELSQFEQARFGNMPSETPAHKTDT-PLSDGIPSQSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM RQ   +  + SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQHLLIPVTFAASHEECAALAD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           H E L   G++    G N +A+R  P +L K ++  L RD++ E+    ++ T+      
Sbjct: 538 HAETLAGFGLELSDMGGNTLAVRAAPVMLGKSDVVSLARDVLGELAQVGSSQTIASHENR 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDTLFLR 656


>gi|237748580|ref|ZP_04579060.1| DNA mismatch repair protein mutL [Oxalobacter formigenes OXCC13]
 gi|229379942|gb|EEO30033.1| DNA mismatch repair protein mutL [Oxalobacter formigenes OXCC13]
          Length = 629

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 215/608 (35%), Positives = 345/608 (56%), Gaps = 24/608 (3%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L++ +I+QIAAGE++ERPS  +KEL+EN++DA S+++E  +  GG     I DNG G
Sbjct: 28  IQLLTDTLISQIAAGEVVERPSAVVKELLENAVDAGSTQIEIRLENGGIKRIAIIDNGCG 87

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  E++ +A+ RH TSKI+  +D  N+ T GFRGEAL SI +V+ LTL SR  +     Q
Sbjct: 88  IPPEQLRLALTRHATSKIASLNDLENVATLGFRGEALASIASVADLTLQSRTAEEPHAWQ 147

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           +    +   ++ P +   GT V+V +L+   PAR  FLKSEQ E     +V+RR+A+A P
Sbjct: 148 MR-GNDPTGTLSPCSGGFGTTVDVHELYSNTPARRKFLKSEQTEYGHCAEVVRRIALAQP 206

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELN----EKSNEITLQGY 236
            + FT      +  K   Q    N  +R +QV+GE F  + + ++    E +N + L G+
Sbjct: 207 GIRFTLM----HNGKATAQWNAHNLSQRCNQVLGEQFAQSQLPIDITVGEGANSLRLYGF 262

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
            G PT +R   +  Y ++NGR V+D+ +   +R AY + +   RYP  +L L +DP  VD
Sbjct: 263 IGQPTASRTRGDMQYFYVNGRFVRDRLLTHAVRAAYEDVLHGNRYPAYLLYLTLDPSLVD 322

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINK---------KGISTSSVLSKKMISSFHQ 347
           VNVHPAK  +RFR+   I +FI QS+ + + +         + I+ +   ++  +S    
Sbjct: 323 VNVHPAKIEVRFRDSRSIHHFIHQSVSRTLAQTMEPHAAADESIAYAETPARSPVSWHSN 382

Query: 348 DNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDP-TYSEDNDPVEESEATHYQL 406
             +P ++  +  T+   +   LF Q      +   P   P T   D   ++E     + L
Sbjct: 383 TPSPVSYGVEQKTA---SYGALFRQSREQEESHSSPLPMPATELSDLFRIDEKTEEDFPL 439

Query: 407 GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLL 466
           G A AQ+H  YI++Q   GLV+VD HAAHER+++EK++   +   + +QTLL P  + + 
Sbjct: 440 GFALAQLHDIYILAQNRHGLVLVDMHAAHERIVYEKLKTALDEKTLQTQTLLIPVTMKVS 499

Query: 467 EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTT 526
           E E    +E+ E L  LG       P  IA+R +P +L + +    LR+I+ ++ +  T+
Sbjct: 500 EVEAGTALENRETLQELGFDISALTPETIAVRTVPTLLREADTANALRNILRDMHEYGTS 559

Query: 527 YTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLS 586
              +++   +LAT+AC+ ++R+ R +   EMN LLR+ME+   + QCNHGRPT+ +L LS
Sbjct: 560 SIAKEKRNELLATVACHNAVRANRSLTITEMNALLRQMEQTERADQCNHGRPTWTQLGLS 619

Query: 587 DIEKLFGR 594
           +++ LF R
Sbjct: 620 ELDALFLR 627


>gi|240125775|ref|ZP_04738661.1| DNA mismatch repair protein [Neisseria gonorrhoeae SK-92-679]
 gi|268684372|ref|ZP_06151234.1| DNA mismatch repair protein [Neisseria gonorrhoeae SK-92-679]
 gi|268624656|gb|EEZ57056.1| DNA mismatch repair protein [Neisseria gonorrhoeae SK-92-679]
          Length = 658

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 225/659 (34%), Positives = 355/659 (53%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ V+  + GGG    ++ DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAVDVELEGGGIRLIRVGDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  ++ + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSGNSALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL LE+ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLELPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRANLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 341 -------MISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLS------ 377
                    S+    N P          KT    Y  +    Q  L L+E+R +      
Sbjct: 359 DGENLFDSASNHPTGNKPDIRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMDTYAE 418

Query: 378 ----TNDL--------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
               T+D+              +PS+ P +  D  P+ +   S++    LG A AQ+   
Sbjct: 419 LYKKTDDIDLELSQFEQARFGNMPSETPAHKTDT-PLSDGIPSQSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM RQ   +  + SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQHLLIPVTFAASHEECAALAD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           H E L   G++    G N +A+R  P +L K ++  L RD++ E+    ++ T+      
Sbjct: 538 HAETLAGFGLELSDMGGNTLAVRAAPVMLGKSDVVSLARDVLGELAQVGSSQTIASHENR 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDTLFLR 656


>gi|255066273|ref|ZP_05318128.1| DNA mismatch repair protein MutL [Neisseria sicca ATCC 29256]
 gi|255049483|gb|EET44947.1| DNA mismatch repair protein MutL [Neisseria sicca ATCC 29256]
          Length = 664

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 222/668 (33%), Positives = 352/668 (52%), Gaps = 83/668 (12%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ +E  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIEVELAGGGIRLIRVSDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS L L SR   +    
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLILTSRQDGSAHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+S+    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSNPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++GEDF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGEDFQAASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK-------------------KGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                      GI  ++  S+ 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRADLTESVSNAGEVLHEITGIRPTATSSEN 358

Query: 341 MISSFHQD----------NAPKTHLPK--------------YATSLTNTQEKLFLQENRL 376
               F Q+           AP TH  +              Y  +    Q  L L+E+R 
Sbjct: 359 EHHQFLQNPTASSENIFAAAPNTHASEPRSTFGSGKTAPMPYQAARAPQQRSLSLRESRA 418

Query: 377 STNDLL-----------------------------PSDDPTYSEDNDPVEESEATHYQLG 407
           + N                                 S++P  +  +DP  E       LG
Sbjct: 419 ALNTYAELFKNTAADEADIELAQFEQARFGNTTATSSENPARAFSDDPKPELPP----LG 474

Query: 408 IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLL 466
            A AQ+   YI++Q  D L+++D HAA ER+ +EKM RQ   +  + SQ LL P      
Sbjct: 475 FAIAQLLGIYILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQRLLIPVTFAAS 534

Query: 467 EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTT 526
             ECA + +H + L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++
Sbjct: 535 HEECAALADHGDTLAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLGELAQVGSS 594

Query: 527 YTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLS 586
            T+++   +ILATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L 
Sbjct: 595 QTIEEHENHILATMSCHGSVRAGRQLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLK 654

Query: 587 DIEKLFGR 594
           +++ LF R
Sbjct: 655 ELDALFLR 662


>gi|59801161|ref|YP_207873.1| DNA mismatch repair protein [Neisseria gonorrhoeae FA 1090]
 gi|240118039|ref|ZP_04732101.1| DNA mismatch repair protein [Neisseria gonorrhoeae PID1]
 gi|268603752|ref|ZP_06137919.1| DNA mismatch repair protein [Neisseria gonorrhoeae PID1]
 gi|81311203|sp|Q5F8M6|MUTL_NEIG1 RecName: Full=DNA mismatch repair protein mutL
 gi|59718056|gb|AAW89461.1| putative DNA mismatch repair protein [Neisseria gonorrhoeae FA
           1090]
 gi|268587883|gb|EEZ52559.1| DNA mismatch repair protein [Neisseria gonorrhoeae PID1]
          Length = 658

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 225/659 (34%), Positives = 355/659 (53%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ V+  + GGG    ++ DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAVDVELEGGGIRLIRVGDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  ++ + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSGNSALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL LE+ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLELPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRANLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 341 -------MISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLS------ 377
                    S+    N P          KT    Y  +    Q  L L+E+R +      
Sbjct: 359 DGENLFDSASNHPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMDTYAE 418

Query: 378 ----TNDL--------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
               T+D+              +PS+ P +  D  P+ +   S++    LG A AQ+   
Sbjct: 419 LYKKTDDIDLELSQFEQARFGNMPSETPAHKTDT-PLSDGIPSQSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM RQ   +  + SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQHLLIPVTFAASHEECAALAD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           H E L   G++    G N +A+R  P +L K ++  L RD++ E+    ++ T+      
Sbjct: 538 HAETLAGFGLELSDMGGNTLAVRAAPVMLGKSDVVSLARDVLGELAQVGSSQTIASHENR 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDTLFLR 656


>gi|260440446|ref|ZP_05794262.1| DNA mismatch repair protein [Neisseria gonorrhoeae DGI2]
 gi|291043745|ref|ZP_06569461.1| DNA mismatch repair protein mutL [Neisseria gonorrhoeae DGI2]
 gi|291012208|gb|EFE04197.1| DNA mismatch repair protein mutL [Neisseria gonorrhoeae DGI2]
          Length = 658

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 225/659 (34%), Positives = 355/659 (53%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ V+  + GGG    ++ DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAVDVELEGGGIRLIRVGDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  ++ + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSGNSALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL LE+ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLELPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRANLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 341 -------MISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLS------ 377
                    S+    N P          KT    Y  +    Q  L L+E+R +      
Sbjct: 359 DSENLFDSASNHPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMDTYAE 418

Query: 378 ----TNDL--------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
               T+D+              +PS+ P +  D  P+ +   S++    LG A AQ+   
Sbjct: 419 LYKKTDDIDLELSQFEQARFGNMPSETPAHKTDT-PLSDGIPSQSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM RQ   +  + SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQHLLIPVTFAASHEECAALAD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           H E L   G++    G N +A+R  P +L K ++  L RD++ E+    ++ T+      
Sbjct: 538 HAETLAGFGLELSDMGGNTLAVRAAPVMLGKSDVVSLARDVLGELAQVGSSQTIASHENR 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDTLFLR 656


>gi|294787957|ref|ZP_06753201.1| DNA mismatch repair protein MutL [Simonsiella muelleri ATCC 29453]
 gi|294484250|gb|EFG31933.1| DNA mismatch repair protein MutL [Simonsiella muelleri ATCC 29453]
          Length = 626

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 225/630 (35%), Positives = 343/630 (54%), Gaps = 45/630 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I +L   +INQIAAGE++ERP+ A+KE++ENSLDA +S+V   I GGG    ++TDNG 
Sbjct: 3   RIAQLPNHLINQIAAGEVVERPANALKEILENSLDAGASQVSVEITGGGIKLIRVTDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++++P+A+ RH TSKI +  D  ++ + GFRGE L SI +VS LTL SR  +     
Sbjct: 63  GIHADDLPLALSRHATSKIKNLSDLEHVRSMGFRGEGLASIASVSRLTLTSRTAELPHAH 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +I      +S +   +   GT VEV +LFF  PAR  FLKSE  E      ++ R+A+A 
Sbjct: 123 EIRAEDGVLSPIAAASHPIGTTVEVCELFFNTPARRQFLKSENTEYAHCATMLERLALAN 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P+V+F+      N  K  F        +R+  ++GEDF    + ++   N + + G+   
Sbjct: 183 PQVAFSLK----NNGKSVFNYPAQTLAQRVGTIVGEDFQAACLPVDSGENILRVHGFVSK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G ++  + F+N R V+DK IL  ++ AY + +     P  VL L+I P  VDVNV
Sbjct: 239 PTFAKGKSDMQFCFVNNRFVRDKVILHAVKQAYRDVLHNQIVPAFVLFLDIPPELVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI------------NKKGISTSSVL-------SKK 340
           HP K+ +RFR+   +   I  ++ K +            N   I    +L       S K
Sbjct: 299 HPTKTEVRFRDSQAVHQLIFHNLNKVLAETRADVTDSVSNAGDILHERILPNDTFSGSLK 358

Query: 341 MISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVE--- 397
             +S +  N  K     YA      Q  L L+E+R + N    +    Y +DN+  E   
Sbjct: 359 SENSNNYSNNQKVAPANYAAFRAPIQRNLSLKESRAAMN----TYAELYRQDNELAELEQ 414

Query: 398 -------------ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMR 444
                          E   Y LG A AQ+   YI+SQT++GL++VD HAA ER+ +EKM+
Sbjct: 415 TRLNVAPENPKNNHVENQEYPLGFALAQLLGIYILSQTSEGLILVDMHAAAERVNYEKMK 474

Query: 445 QDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAIL 504
               S  + +Q LL P        E A + +H + LH  G++ +  G   IAI  IPA+L
Sbjct: 475 TQRLSGSLKTQMLLIPMRFQATHEERATLADHADTLHEYGLQLQDLGDGQIAILAIPAML 534

Query: 505 SKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREM 564
            + +   L +D++ E+    ++  ++     I++TMAC+GS+R+GR++   EMN LLR+M
Sbjct: 535 GQADAVALAQDVLRELACVGSSQIVEKLENQIISTMACHGSVRAGRQLTQPEMNALLRDM 594

Query: 565 EKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           E  P S+QCNHGRPT+++L L+D++ LF R
Sbjct: 595 ENTPRSNQCNHGRPTWVRLALTDLDALFLR 624


>gi|212212503|ref|YP_002303439.1| DNA mismatch repair protein [Coxiella burnetii CbuG_Q212]
 gi|226723030|sp|B6J016|MUTL_COXB2 RecName: Full=DNA mismatch repair protein mutL
 gi|212010913|gb|ACJ18294.1| MutL [Coxiella burnetii CbuG_Q212]
          Length = 575

 Score =  388 bits (997), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 220/601 (36%), Positives = 334/601 (55%), Gaps = 36/601 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L+++  NQIAAGE++ERP+  +KELIENS+DA +S +   I  GG    +I D+G
Sbjct: 2   MYIRRLNDQTANQIAAGEVVERPASVVKELIENSIDAHASCIRVDILQGGAKQIRIQDDG 61

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  E++ +A++RH TSKI+  DD  ++ T GFRGEAL SI AVS LTL SR      G
Sbjct: 62  DGIHPEDLVLALERHATSKIAKIDDLQDVTTLGFRGEALASISAVSRLTLTSRQKNAEMG 121

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +I+    KI +  P A   GT ++V+DLF+  PAR  FL+S   E   I  +I R+A++
Sbjct: 122 YRISNISHKIMTPVPAAHPQGTTIDVQDLFYNTPARRKFLRSPATEFQHIRRIIERLALS 181

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +    F     +         +T      RI  ++G+ F+ +A+ +    + +TL+GY  
Sbjct: 182 HFTTEFLLHHNEKEIIHFKSATTISGQENRIKSILGDVFMQSALAIEFSQSGLTLKGYIA 241

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
              + R   +  Y+++NGR V+DK I   +R AY + +  GR+P  VL LEIDP  VD+N
Sbjct: 242 EAAYTRSQPDLQYIYVNGRFVRDKLIAQALRQAYHDVLFHGRHPAYVLYLEIDPAFVDIN 301

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI--NKKGIS---TSSVLSKKMISSFHQDNAPKT 353
           VHP K  +RFR+P  +R+F+I +++ A+   K GI+     S      I++F    AP  
Sbjct: 302 VHPTKHEVRFRDPQWVRDFLIHAVKTALAQTKPGIAHPLPQSTAEYNPITNF----AP-- 355

Query: 354 HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQI 413
                 T L   Q  L L +                 E   P  ++    + LG A AQ+
Sbjct: 356 ------TPLIEGQGNLSLIQ-----------------EQPAPYTQTIVHKHPLGHALAQL 392

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
              YI+SQ   GLVIVD HAAHER+++EKM++      +  Q+LL P  + L   E    
Sbjct: 393 QGIYILSQNEKGLVIVDMHAAHERILYEKMKKQLAEVGLVMQSLLVPINLSLNPQEITAW 452

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRI 533
             +     RLG + E FGP+ I +R  P++L  KN+  L+RD++ ++I  +TT  + +RI
Sbjct: 453 QTNKALFARLGFEIESFGPDKIVVRRHPSLLKPKNLENLIRDVLADLITHNTTSRVGERI 512

Query: 534 ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFG 593
             +LAT+AC+ ++R+   +   EM  LLREMEK  +   CNHGRPT+ +  +++++  F 
Sbjct: 513 NAVLATLACHAALRAPHYLTIEEMEALLREMEKTEHGGLCNHGRPTWKQFDIAELDTFFL 572

Query: 594 R 594
           R
Sbjct: 573 R 573


>gi|321272299|gb|ADW80184.1| MutL [Wolbachia endosymbiont wVitA of Nasonia vitripennis phage
           WOVitA1]
 gi|321272351|gb|ADW80232.1| MutL [Wolbachia endosymbiont wVitB of Nasonia vitripennis phage
           WOVitB]
          Length = 598

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 235/621 (37%), Positives = 359/621 (57%), Gaps = 51/621 (8%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I  L  K IN+IAAGE+IERP+  +KEL+EN++DA SS +E  I  GG++   +TD+G
Sbjct: 1   MAIILLDTKTINRIAAGEVIERPASVVKELVENAIDAGSSEIEIKIESGGRNLITVTDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            G+  +++ +A  RH TSK+SD +   I   GFRGEALPSI AVS + L S+     +GA
Sbjct: 61  NGIEKDDLELAFMRHATSKLSDSELIEIKHLGFRGEALPSIAAVSRMKLSSKA----SGA 116

Query: 120 QIAIS-----GEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRR 174
           + A S     GEKI  + P ++  GT +EVRDLFF  P RL FLK+E+ ET  I D++  
Sbjct: 117 KEAWSIRYEGGEKIREITPCSLLQGTYIEVRDLFFATPNRLKFLKTERAETQSIVDIVNN 176

Query: 175 MAIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQ 234
           +A+    + FT ++      K   Q++  N   R+ + I E+F +N++E+ E+   I L+
Sbjct: 177 LAMINYSIGFTLTSGNKKLLKYVKQTSLFN---RLCE-IEEEFQSNSLEVKEEEEGIKLK 232

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           G+   P  NRGN+ Q Y F+NGR ++D  ++  IR AY + IP  RYP  VL LEI   Q
Sbjct: 233 GHICKPNVNRGNSTQIYTFVNGRPIKDNLLVGAIRYAYHDFIPNNRYPFAVLHLEIPYDQ 292

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMI-----SSFHQDN 349
           VDVNVHP KS +RF+N  +I   + + I K ++ +  +    + +++I     S    D+
Sbjct: 293 VDVNVHPNKSEVRFQNKRLIYEIVRRGIIKTLSTRFAAGDQGIEEELIFNDSKSQEQVDS 352

Query: 350 APKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDD-----PTYSEDNDPVEESEAT-- 402
             K    ++       +++  L ENRL      P +       T+     P ++      
Sbjct: 353 QEKKDQKEF------YEKRPSLLENRLMKEFNAPDERRQSLPETFKYGESPPQKGTMVLE 406

Query: 403 --------HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITS 454
                    + LG A  Q+H  YII+++ D L+IVDQHAA+ERLI+E ++Q    + I  
Sbjct: 407 RKQIDLVEDHPLGYARCQVHNTYIIAESGDRLIIVDQHAAYERLIYECLKQ---KSSIKR 463

Query: 455 QTLLTPEIIDLL-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLL 513
           Q LL PE +++  +    ++  + ++L  +G   E    + + I+EIPAIL   +I ++L
Sbjct: 464 QKLL-PETVEIKNQAGMGMVKTYKDELFEMGFDIEIQSEDKVTIKEIPAILGTIDIKEML 522

Query: 514 RDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQC 573
            DI+D++++   T  ++D++  I AT+AC+G   +GRKM+  EMN +LR++EK P S   
Sbjct: 523 VDIVDKLMEMEDTLPIEDKVNKISATIACHG---AGRKMKLEEMNEILRQIEKTPYSG-- 577

Query: 574 NHGRPTFIKLKLSDIEKLFGR 594
            H RPT+I++KLSDIEKLF R
Sbjct: 578 -HERPTYIEMKLSDIEKLFER 597


>gi|77918908|ref|YP_356723.1| DNA mismatch repair protein [Pelobacter carbinolicus DSM 2380]
 gi|123729468|sp|Q3A504|MUTL_PELCD RecName: Full=DNA mismatch repair protein mutL
 gi|77544991|gb|ABA88553.1| DNA mismatch repair protein MutL [Pelobacter carbinolicus DSM 2380]
          Length = 628

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 210/627 (33%), Positives = 351/627 (55%), Gaps = 37/627 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI  L E + NQIAAGE++ERP+  +KEL+EN+LDA +SR++  +  GGK   ++TDNG 
Sbjct: 4   KIHILPESLCNQIAAGEVVERPASVVKELVENALDAGASRIQVDVENGGKRLIRVTDNGC 63

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           GM+ E+  + ++RH TSK+    D   + T GFRGEALPSI AVS  TL +R  ++  G 
Sbjct: 64  GMSREDAFLCLERHATSKVRAEQDLFRLTTLGFRGEALPSIAAVSRFTLRTRLAEDVEGW 123

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           ++ + G  +       + PGTI+E+R+LFF  PAR  FL+ ++ E   I + + R+A++ 
Sbjct: 124 ELVVEGGTVKRSSAAGVPPGTIIEIRNLFFNTPARRKFLRRDETELGHIGETLTRLALSC 183

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNE-ITLQGYTG 238
           P+V F F       +++N Q +     ER ++++G + + + + +  +  E + L G   
Sbjct: 184 PEVCFRFMHNGRMLWEVNRQKS---LVERAAELLGREAVRDMLPVERQGPEGMRLHGLIS 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P  NR      + FINGR ++DK +   +   Y   +  GR+PV+VL LEIDP QVDVN
Sbjct: 241 SPRLNRSGLGGMFTFINGRFIRDKVVQHALADGYRNLLAKGRHPVLVLFLEIDPSQVDVN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQ--------KAINKKGISTSSVLSKKMISSFHQD-- 348
           VHP K  +RFR   ++ +FI+++++         A+   G S  +V +++  +S   D  
Sbjct: 301 VHPTKHEVRFRQQALVHDFIVKALRDHLQQVPTSAMPAPGNSPFTVPARENAASVKPDET 360

Query: 349 ---------------NAPKTHLP-KYATSLTNTQEKLFLQENRLSTNDLLP--SDDPTYS 390
                           + ++ +P   A+ +T T +     ++ +      P  S++  +S
Sbjct: 361 KPALADTPAAFSAGEGSSRSDVPYPSASQVTETTDSYDAHDSGVEGASTAPPLSEEGLFS 420

Query: 391 EDND--PVEESEATHYQLGIACAQIHQN-YIISQTTDGLVIVDQHAAHERLIFEKMRQDF 447
              D  P E++E + +   +     +QN Y++ Q+   L+++DQHAAHER+ FE +R+ +
Sbjct: 421 VTADVRPSEQTENSGFFASLRLIGQYQNSYLVCQSEKDLILIDQHAAHERIGFEHLRKQY 480

Query: 448 NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKK 507
            +  I  Q LL P +++       ++ E  + L RLG   E FG NA A++E+P +L + 
Sbjct: 481 LAGSIERQLLLFPLVLEFDFRLGRIVEEQRDSLFRLGFALENFGGNAFALKELPRMLKEA 540

Query: 508 NIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKN 567
           +  +L+RD++DE      +  ++  +E IL  MAC+  +R+ +++   EM  LL E++K 
Sbjct: 541 DAERLVRDVVDEFAAIGRSQAVEIELERILLKMACHAMVRAHQRLSFDEMQALLDELDKT 600

Query: 568 PNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           P SS C HGRPTF++  L ++E+LF R
Sbjct: 601 PFSSNCPHGRPTFLRWSLGELERLFKR 627


>gi|222056190|ref|YP_002538552.1| DNA mismatch repair protein MutL [Geobacter sp. FRC-32]
 gi|254766168|sp|B9M3N0|MUTL_GEOSF RecName: Full=DNA mismatch repair protein mutL
 gi|221565479|gb|ACM21451.1| DNA mismatch repair protein MutL [Geobacter sp. FRC-32]
          Length = 598

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 207/603 (34%), Positives = 335/603 (55%), Gaps = 18/603 (2%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ L E++ N+IAAGE++ERP+  +KEL+EN+LDA  S V   I  GGK   +++D G 
Sbjct: 4   RIKILPEQLTNKIAAGEVVERPASVVKELVENALDAGCSEVMVEIEAGGKRLIRVSDTGC 63

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           GMT E+  +A++RH TSKI+  +D  ++ T GFRGEALPS+ +VS  TL +R   +  G 
Sbjct: 64  GMTREDALLALERHATSKIANDEDLFSLATLGFRGEALPSVASVSRFTLATREKGSLEGT 123

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +I   G +I  V+   M  GT++ VR+LFF  PARL F+KS + E   + D++ R+AI+ 
Sbjct: 124 EIYAEGGRIKEVKACGMAEGTVISVRNLFFNTPARLKFMKSSETEAGHVGDLLTRLAISR 183

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P + F    I +N  K  F++ N +  ER++ ++G     +   L+    ++ + G  G 
Sbjct: 184 PDIRF----IYTNDGKTVFRALNADLRERVATLLGRTLSQDLYPLDFCDGQLNVTGLVGK 239

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P  +R  A+  Y +INGR ++DK +   +  AY   +  GRYPVVVL + +   +VDVNV
Sbjct: 240 PECSRSAASHVYTYINGRFIRDKVVQHAVLQAYRNFMERGRYPVVVLFISVPAAEVDVNV 299

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-NKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           HP K  +RFR    + + I ++++  + +   + T  V+ K   S+    +     + + 
Sbjct: 300 HPTKHEVRFREQGRVHDAIQEAVESVLRSSPWVKTQPVVQKTQAST----SIAAARIAQV 355

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSD-------DPTYSEDNDPVEESEATHYQLGIACA 411
             SLT  + +   Q++   +   +P+        DP    D  P  E E  ++       
Sbjct: 356 RESLTQYRPQKTTQQSFKMSTPAVPASFRETSLPDPVPVADAAPAPEVERGYFSGLSVIG 415

Query: 412 QIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECA 471
           Q +  YI+ Q  + LVI+DQHAAHER+ FE+++    +  + SQ LL PE ++    E A
Sbjct: 416 QFNAAYILCQDGNSLVIIDQHAAHERVAFERLKTQHAAMGVESQRLLFPETVEFSFKEGA 475

Query: 472 LIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQD 531
           +I EH  +L R+G   E FG +   +  +P +LS  +  + LRDI++E+     + + QD
Sbjct: 476 VIREHQTELDRVGFSLEEFGGSTWLLNAVPHLLSGNDYVKTLRDILEELQSLGRSRSFQD 535

Query: 532 RIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKL 591
            +E+ILA +AC+  +R    +   E+  L ++M+    SS C HGRP    L L++IE++
Sbjct: 536 ILEDILARIACHSVVRGSHCLSQQEIKALFQQMDTTEFSSNCPHGRPVLHTLTLAEIERM 595

Query: 592 FGR 594
           F R
Sbjct: 596 FKR 598


>gi|73542454|ref|YP_296974.1| DNA mismatch repair protein [Ralstonia eutropha JMP134]
 gi|72119867|gb|AAZ62130.1| DNA mismatch repair protein MutL [Ralstonia eutropha JMP134]
          Length = 652

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 216/643 (33%), Positives = 351/643 (54%), Gaps = 58/643 (9%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR L +++I+QIAAGE++ERP+  +KEL+EN+LDA +S++   +  GG     ITDNG G
Sbjct: 15  IRPLPDQLISQIAAGEVVERPASVVKELLENALDAGTSQLGIRLEEGGVRRIVITDNGCG 74

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +   E+P+A+ RH TSKI+  D+   + T GFRGEAL SI +VS L+L SR   +    Q
Sbjct: 75  IPPAELPVALMRHATSKIASLDELEAVLTLGFRGEALASIASVSQLSLTSRTASDAHATQ 134

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           ++       +++P +   GT V+V+ L+F  PAR  FLKSEQ E     +++RR+A+A P
Sbjct: 135 VSAD---TGAMQPASGGVGTTVDVQHLYFNTPARRKFLKSEQTELGHCLEMVRRVALARP 191

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V+ +   +  N   +   +  G+   R +QV+G DF    + L+E++ ++ L G+ G+P
Sbjct: 192 DVAIS---VHHNGKPLEHWNA-GDVATRTAQVLGSDFARARLPLDEEAGDLHLYGFAGLP 247

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           T +RG  +Q Y F+NGR V+DK +   +R+AY + +   R+P  VL L++ P  VDVNVH
Sbjct: 248 TASRGRPDQQYFFVNGRFVRDKLLNHAVRSAYQDVLHGDRFPSYVLCLDLPPEMVDVNVH 307

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKK----------GISTSSVLSKKMISSFHQDNA 350
           P+K  +RFR    +  F+  ++Q+ + ++          G     V +        +  A
Sbjct: 308 PSKIEVRFRESRSVHQFVYHAVQRCLARQAGENGDSLHTGTDVEDVPAAGGAGELREPRA 367

Query: 351 P------------------KTHL----PKYA------------TSLTNTQEKLFLQENRL 376
           P                  +T L    P+ A              + ++Q   +L + + 
Sbjct: 368 PYGGTASSGSQWINYSAARQTELGIAQPRQAYLGMVREATMPRPYVPSSQPPAWLADAQA 427

Query: 377 STNDLLPS--DDPTYSEDNDPVEESE---ATHYQLGIACAQIHQNYIISQTTDGLVIVDQ 431
           +  D  PS  D    +    P+ E     A  + LG A AQ+H  Y+++Q   GLV+VD 
Sbjct: 428 ARADEPPSLLDGVAPARMALPIAEDATEGAEDHPLGYAIAQLHGIYVLAQNARGLVLVDM 487

Query: 432 HAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFG 491
           HAAHER+++E+++   ++  +  Q LL P  +     E     EH E L  LG       
Sbjct: 488 HAAHERILYEQIKDALDARDLAVQPLLLPVTLPANPVEIGTAEEHRETLELLGFDIAPVS 547

Query: 492 PNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRK 551
           P  +A+R +PA+L + +   L RD++ ++     +  L +R   +LAT+AC+ ++R+ RK
Sbjct: 548 PTTLAVRAVPALLQQADAEALARDVLRDLHSYGGSRVLAERRNELLATLACHSAVRANRK 607

Query: 552 MQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +   EMN LLR+ME+   + QCNHGRPT+++L +S++++LF R
Sbjct: 608 LTLEEMNALLRQMEQTERADQCNHGRPTWVQLSVSELDRLFLR 650


>gi|237745903|ref|ZP_04576383.1| DNA mismatch repair protein MutL [Oxalobacter formigenes HOxBLS]
 gi|229377254|gb|EEO27345.1| DNA mismatch repair protein MutL [Oxalobacter formigenes HOxBLS]
          Length = 627

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 210/619 (33%), Positives = 349/619 (56%), Gaps = 36/619 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ LS+ +I+QIAAGE++ERPS  +KEL+EN++DA +++++  +  GG     ++DNG G
Sbjct: 16  IQLLSDTLISQIAAGEVVERPSAVVKELLENAVDAGATQIDIRLENGGIKRIAVSDNGCG 75

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  +++ +A+ RH TSKI+  +D  N+ T GFRGEAL SI +V+ +TL SR  +     Q
Sbjct: 76  IAPDQLQLALTRHATSKIASLNDLENVSTLGFRGEALASIASVAEVTLQSRTSEQPHAWQ 135

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I    +   ++ P +   GT V+V +L+   PAR  FLKSEQ E     +++RR+A+A P
Sbjct: 136 IR-GNDPSKTLTPCSGVKGTAVDVHELYANTPARRKFLKSEQTEYGHCAEIVRRIALARP 194

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELN----EKSNEITLQGY 236
            + FT      +  K+  Q    N  +R +Q++GE F  + + ++    E S+ ++L G+
Sbjct: 195 GIRFTLM----HNGKVTAQYQADNLSQRCNQILGEAFSQSLLPVDLAAGEDSDRLSLTGF 250

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
            G+PT +R   +  Y ++NGR V+D+ +   +R AY + +   RYPV +L L+++P +VD
Sbjct: 251 IGLPTASRTRGDMQYFYVNGRFVRDRLLTHAVRAAYEDVLHGNRYPVYLLYLKLEPSRVD 310

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTS---------------------S 335
           VNVHPAK  +RFR+   I  FI  SI + + +                           S
Sbjct: 311 VNVHPAKIEVRFRDSRAIHQFIYHSISRILARPMEPEPETTGEERPSSIRSPSPPRGPVS 370

Query: 336 VLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDP 395
             S    +++  +   +++   +  +L  T+EK  LQ   +   D+     P  +E    
Sbjct: 371 WRSAPPPAAYRIEQKTESYGALFRDTLRQTEEKRPLQ---IQNPDIPSGTAPALAETGSQ 427

Query: 396 VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQ 455
            +  E   + LG A AQ+H  YI++Q   GLV+VD HAAHER+++EK++   +   + +Q
Sbjct: 428 -KSGEIDDFPLGFALAQLHDIYILAQNRKGLVLVDMHAAHERIVYEKLKTALDEKTLETQ 486

Query: 456 TLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRD 515
           +LL P  + + E E    +E+ E L  LG       P  IAIR +P +L + +I   +R 
Sbjct: 487 SLLIPLTLKVGEVEAGTALENRETLLELGFDISALSPETIAIRTVPVLLKQADIATAIRH 546

Query: 516 IIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNH 575
           ++ ++ +  T+   +++   +LAT+AC+ ++R+ R +   EMN LLR+MEK   + QCNH
Sbjct: 547 VLRDLHEYGTSSVTREKRNELLATVACHNAVRANRTLTIPEMNALLRQMEKTERADQCNH 606

Query: 576 GRPTFIKLKLSDIEKLFGR 594
           GRPT+ +L LS+++ LF R
Sbjct: 607 GRPTWTQLALSELDALFMR 625


>gi|325130516|gb|EGC53271.1| DNA mismatch repair protein MutL [Neisseria meningitidis
           OX99.30304]
          Length = 658

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 226/659 (34%), Positives = 360/659 (54%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSEATEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSK- 339
           HP K+ IRFR+   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRADLTESVGNAGEVLHDITGVTPAPMPSEN 358

Query: 340 ------KMISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
                    S +   N P          KT    Y ++    Q  L L+E+R + N    
Sbjct: 359 DSENLFNRASDYPTGNKPDTRNAFGASGKTAPMPYQSAYAPQQRSLSLRESRAAMNTYAE 418

Query: 380 --------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
                   DL            +PS+ P    D  P+ +   S++    LG A AQ+   
Sbjct: 419 LYKKTDDIDLELSRFEQARFGNMPSETPAPQTDT-PLSDGIPSQSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM RQ   + ++ SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGRLQSQRLLIPVTFAASHEECAALAD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           H + L   G++    G N +A+R +PA+L K +I  L RD++ E+    ++ T+++    
Sbjct: 538 HADALAGFGLELSDMGGNTLAVRAVPAMLGKSDIVSLARDVLGELAQVGSSQTIEEHENR 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|215919100|ref|NP_820082.2| DNA mismatch repair protein [Coxiella burnetii RSA 493]
 gi|206583985|gb|AAO90596.2| DNA mismatch repair protein [Coxiella burnetii RSA 493]
          Length = 575

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 218/599 (36%), Positives = 331/599 (55%), Gaps = 32/599 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L+++  NQIAAGE++ERP+  +KELIENS+DA +S +   I  GG    +I D+G
Sbjct: 2   MYIRRLNDQTANQIAAGEVVERPASVVKELIENSIDAHASCIRVDILQGGAKQIRIQDDG 61

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  E++ +A++RH TSKI+  DD  +I T GFRGEAL SI AVS LTL SR      G
Sbjct: 62  DGIHPEDLVLALERHATSKIAKIDDLQDITTLGFRGEALASISAVSRLTLTSRQKNAEMG 121

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +I+    KI +  P A   GT ++V+DLF+  PAR  FL+S   E   I  +I R+A++
Sbjct: 122 YRISNISHKIMTPVPAAHPQGTTIDVQDLFYNTPARRKFLRSPATEFQHIRRIIERLALS 181

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +    F     +         +T      RI  ++G+ F+ +A+ +    + +TL+GY  
Sbjct: 182 HFTTEFLLHHNEKEIIHFKSATTISGQENRIKSILGDVFMQSALAIEFSQSGLTLKGYIA 241

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
              + R   +  Y+++NGR V+DK +   +R AY + +  GR+P  VL LEIDP  VD+N
Sbjct: 242 EAAYTRSQPDLQYIYVNGRFVRDKLVAQALRQAYHDVLFHGRHPAYVLYLEIDPAFVDIN 301

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI--NKKGISTSSVLSKKMISSFHQDNAPKTHLP 356
           VHP K  +RFR+P  +R+F+I +++ A+   K GI          +    Q  A    + 
Sbjct: 302 VHPTKHEVRFRDPQWVRDFLIHAVKTALAQAKPGI----------VHPLPQSTAEYNPIT 351

Query: 357 KYA-TSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQ 415
            +A T L   Q  L L +                 E   P  ++    + LG A AQ+  
Sbjct: 352 NFAPTPLIEGQGNLSLIQ-----------------EQPAPYTQTIVHKHPLGHALAQLQG 394

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
            YI+SQ   GLVIVD HAAHER+++EKM++      +  Q+LL P  + L   E      
Sbjct: 395 IYILSQNEKGLVIVDMHAAHERILYEKMKKQLAEVGLAMQSLLVPINLSLNPQEITAWQT 454

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           +     RLG + E FGP+ I +R  P++L  KN+  L+RD++ ++I  +TT  + +RI  
Sbjct: 455 NKALFARLGFEIESFGPDKIVVRRHPSLLKPKNLENLIRDVLADLITHNTTSRVGERINA 514

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            LAT+AC+ ++R+   +   EM  LLREMEK  +   CNHGRPT+ +  +++++  F R
Sbjct: 515 ALATLACHAALRAPHYLTIEEMEALLREMEKTEHGGLCNHGRPTWKQFDIAELDTFFLR 573


>gi|17547282|ref|NP_520684.1| DNA mismatch repair protein [Ralstonia solanacearum GMI1000]
 gi|20455088|sp|Q8XWB1|MUTL_RALSO RecName: Full=DNA mismatch repair protein mutL
 gi|17429584|emb|CAD16270.1| probable dna mismatch repair protein mutl [Ralstonia solanacearum
           GMI1000]
          Length = 636

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 208/631 (32%), Positives = 343/631 (54%), Gaps = 46/631 (7%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR L +++I+QIAAGE++ERP+  +KEL+EN+LDA +++++  +  GG     ITDNG G
Sbjct: 11  IRPLPDQLISQIAAGEVVERPASVVKELLENALDAGATQLQIKLEEGGVRRIAITDNGGG 70

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  +E+P+A+ RH TSKI   ++  ++ T GFRGEAL SI +V+ LTL SR  Q+    Q
Sbjct: 71  IPVDELPVALMRHATSKIGSLEELESVATLGFRGEALASIASVAELTLTSRTAQDAHATQ 130

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I     +   V+P +   GT V+V+ L+F  PAR  FLK+EQ E     +VIRR A+A P
Sbjct: 131 IIA---QTGRVQPASGGVGTTVDVQHLYFNTPARRKFLKTEQTELGHCLEVIRRTALARP 187

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V+   S   + +   ++ +   +   R + V+G +F    +   E + E+ L G+ G+P
Sbjct: 188 DVAI--SVHHNGKPLEHWNAAQADM--RTAAVLGTEFARARLPFEEAAGELRLFGFAGLP 243

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           T +RG A+  + ++NGR V+D+ +   +R+AY + +   R+P  VL LE+ P  VDVNVH
Sbjct: 244 TASRGRADHQFFYVNGRFVRDRLLTHAVRSAYEDVLHGDRFPAYVLCLELPPEAVDVNVH 303

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA---PKTHLPK 357
           P+K  +RFR+   +  F+  ++Q+A+++        L   +  +  Q  A   P  +  +
Sbjct: 304 PSKIEVRFRDSRAVHQFVYHAVQRALSRHAGEQGDSLRTDIADAPEQPGATATPADNTTR 363

Query: 358 YATSLTNTQEKLFLQENRLSTNDLL-------PSDDPTYSED------------------ 392
           +   +   Q  L + + R     ++       PS  P +  D                  
Sbjct: 364 WVNQMAARQTSLGIAQPRAEYLAMMRGGSAPQPSSRPAWMADVPSAATLFDGAASAPADA 423

Query: 393 -----NDPVEESEATH----YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKM 443
                ++P    +A      + LG A AQ+H  Y+++Q   G+V+VD HAAHER+++E++
Sbjct: 424 APAQASEPAAAPQADDSDDAHPLGFAVAQLHGIYVLAQNARGMVLVDMHAAHERILYEQL 483

Query: 444 RQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAI 503
           +    + +I  Q LL P        E     E  + L  LG       P  +A+R +P +
Sbjct: 484 KTALEARRIEVQPLLIPVTFAASPVEIGTAEEFGDTLDLLGFDISAVSPTTLAVRAVPTL 543

Query: 504 LSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLRE 563
           L K +   L RD++ ++     +  L +R   +LAT+AC+ ++R+ R++   EMN LLR+
Sbjct: 544 LQKADAQALARDVLRDLQAYGGSRVLAERQNELLATLACHSAVRANRRLNLDEMNALLRQ 603

Query: 564 MEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ME    + QCNHGRPT+I+L ++D+++LF R
Sbjct: 604 MEATERADQCNHGRPTWIQLTVADLDRLFLR 634


>gi|189030396|sp|A9KE32|MUTL_COXBN RecName: Full=DNA mismatch repair protein mutL
          Length = 574

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 221/601 (36%), Positives = 332/601 (55%), Gaps = 36/601 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L+++  NQIAAGE++ERP+  +KELIENS+DA +S +   I  GG    +I D+G
Sbjct: 1   MYIRRLNDQTANQIAAGEVVERPASVVKELIENSIDAHASCIRVDILQGGAKQIRIQDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  E++ +A++RH TSKI+  DD  +I T GFRGEAL SI AVS LTL SR      G
Sbjct: 61  DGIHPEDLVLALERHATSKIAKIDDLQDITTLGFRGEALASISAVSRLTLTSRQKNAEMG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +I+    KI +  P A   GT ++V+DLF+  PAR  FL+S   E   I  +I R+A++
Sbjct: 121 YRISNISHKIMTPVPAAHPQGTTIDVQDLFYNTPARRKFLRSPATEFQHIRRIIERLALS 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +    F     +         +T      RI  ++G+ F+ +A+ +    + +TL+GY  
Sbjct: 181 HFTTEFLLHHNEKEIIHFKSATTISGQENRIKSILGDVFMQSALAIEFSQSGLTLKGYIA 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
              + R   +  Y+++NGR V+DK I   +R AY + +  GR+P  VL LEIDP  VD+N
Sbjct: 241 EAAYTRSQPDLQYIYVNGRFVRDKLIAQALRQAYHDVLFHGRHPAYVLYLEIDPAFVDIN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAIN--KKGIS---TSSVLSKKMISSFHQDNAPKT 353
           VHP K  +RFR+P  +R+F+I +++ A+   K GI+     S      I++F    AP  
Sbjct: 301 VHPTKHEVRFRDPQWVRDFLIHAVKTALAQAKPGIAHPLPQSTAEYNPITNF----AP-- 354

Query: 354 HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQI 413
                 T L   Q  L L                   E   P  ++    + LG A AQ+
Sbjct: 355 ------TPLIEGQGNLSL-----------------IQEQPAPYTQTIVHKHPLGHALAQL 391

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
              YI+SQ   GLVIVD HAAHER+++EKM++      +  Q+LL P  + L   E    
Sbjct: 392 QGIYILSQNEKGLVIVDMHAAHERILYEKMKKQLAEVGLAMQSLLVPINLSLNPQEITAW 451

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRI 533
             +     RLG + E FGP+ I +R  P++L  KN+  L+RD++ ++I  +TT  + +RI
Sbjct: 452 QTNKALFARLGFEIESFGPDKIVVRRHPSLLKPKNLENLIRDVLADLITHNTTSRVGERI 511

Query: 534 ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFG 593
              LAT+AC+ ++R+   +   EM  LLREMEK  +   CNHGRPT+ +  +++++  F 
Sbjct: 512 NAALATLACHAALRAPHYLTIEEMEALLREMEKTEHGGLCNHGRPTWKQFDIAELDTFFL 571

Query: 594 R 594
           R
Sbjct: 572 R 572


>gi|209363988|ref|YP_001424550.2| DNA mismatch repair protein [Coxiella burnetii Dugway 5J108-111]
 gi|207081921|gb|ABS76590.2| DNA mismatch repair protein [Coxiella burnetii Dugway 5J108-111]
          Length = 575

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 221/601 (36%), Positives = 332/601 (55%), Gaps = 36/601 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L+++  NQIAAGE++ERP+  +KELIENS+DA +S +   I  GG    +I D+G
Sbjct: 2   MYIRRLNDQTANQIAAGEVVERPASVVKELIENSIDAHASCIRVDILQGGAKQIRIQDDG 61

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  E++ +A++RH TSKI+  DD  +I T GFRGEAL SI AVS LTL SR      G
Sbjct: 62  DGIHPEDLVLALERHATSKIAKIDDLQDITTLGFRGEALASISAVSRLTLTSRQKNAEMG 121

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +I+    KI +  P A   GT ++V+DLF+  PAR  FL+S   E   I  +I R+A++
Sbjct: 122 YRISNISHKIMTPVPAAHPQGTTIDVQDLFYNTPARRKFLRSPATEFQHIRRIIERLALS 181

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +    F     +         +T      RI  ++G+ F+ +A+ +    + +TL+GY  
Sbjct: 182 HFTTEFLLHHNEKEIIHFKSATTISGQENRIKSILGDVFMQSALAIEFSQSGLTLKGYIA 241

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
              + R   +  Y+++NGR V+DK I   +R AY + +  GR+P  VL LEIDP  VD+N
Sbjct: 242 EAAYTRSQPDLQYIYVNGRFVRDKLIAQALRQAYHDVLFHGRHPAYVLYLEIDPAFVDIN 301

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAIN--KKGIS---TSSVLSKKMISSFHQDNAPKT 353
           VHP K  +RFR+P  +R+F+I +++ A+   K GI+     S      I++F    AP  
Sbjct: 302 VHPTKHEVRFRDPQWVRDFLIHAVKTALAQAKPGIAHPLPQSTAEYNPITNF----AP-- 355

Query: 354 HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQI 413
                 T L   Q  L L                   E   P  ++    + LG A AQ+
Sbjct: 356 ------TPLIEGQGNLSL-----------------IQEQPAPYTQTIVHKHPLGHALAQL 392

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
              YI+SQ   GLVIVD HAAHER+++EKM++      +  Q+LL P  + L   E    
Sbjct: 393 QGIYILSQNEKGLVIVDMHAAHERILYEKMKKQLAEVGLAMQSLLVPINLSLNPQEITAW 452

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRI 533
             +     RLG + E FGP+ I +R  P++L  KN+  L+RD++ ++I  +TT  + +RI
Sbjct: 453 QTNKALFARLGFEIESFGPDKIVVRRHPSLLKPKNLENLIRDVLADLITHNTTSRVGERI 512

Query: 534 ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFG 593
              LAT+AC+ ++R+   +   EM  LLREMEK  +   CNHGRPT+ +  +++++  F 
Sbjct: 513 NAALATLACHAALRAPHYLTIEEMEALLREMEKTEHGGLCNHGRPTWKQFDIAELDTFFL 572

Query: 594 R 594
           R
Sbjct: 573 R 573


>gi|161830565|ref|YP_001596643.1| DNA mismatch repair protein [Coxiella burnetii RSA 331]
 gi|81839061|sp|Q83CM9|MUTL_COXBU RecName: Full=DNA mismatch repair protein mutL
 gi|189030397|sp|A9NCK3|MUTL_COXBR RecName: Full=DNA mismatch repair protein mutL
 gi|161762432|gb|ABX78074.1| DNA mismatch repair protein MutL [Coxiella burnetii RSA 331]
          Length = 574

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 218/599 (36%), Positives = 330/599 (55%), Gaps = 32/599 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L+++  NQIAAGE++ERP+  +KELIENS+DA +S +   I  GG    +I D+G
Sbjct: 1   MYIRRLNDQTANQIAAGEVVERPASVVKELIENSIDAHASCIRVDILQGGAKQIRIQDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  E++ +A++RH TSKI+  DD  +I T GFRGEAL SI AVS LTL SR      G
Sbjct: 61  DGIHPEDLVLALERHATSKIAKIDDLQDITTLGFRGEALASISAVSRLTLTSRQKNAEMG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +I+    KI +  P A   GT ++V+DLF+  PAR  FL+S   E   I  +I R+A++
Sbjct: 121 YRISNISHKIMTPVPAAHPQGTTIDVQDLFYNTPARRKFLRSPATEFQHIRRIIERLALS 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +    F     +         +T      RI  ++G+ F+ +A+ +    + +TL+GY  
Sbjct: 181 HFTTEFLLHHNEKEIIHFKSATTISGQENRIKSILGDVFMQSALAIEFSQSGLTLKGYIA 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
              + R   +  Y+++NGR V+DK +   +R AY + +  GR+P  VL LEIDP  VD+N
Sbjct: 241 EAAYTRSQPDLQYIYVNGRFVRDKLVAQALRQAYHDVLFHGRHPAYVLYLEIDPAFVDIN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI--NKKGISTSSVLSKKMISSFHQDNAPKTHLP 356
           VHP K  +RFR+P  +R+F+I +++ A+   K GI          +    Q  A    + 
Sbjct: 301 VHPTKHEVRFRDPQWVRDFLIHAVKTALAQAKPGI----------VHPLPQSTAEYNPIT 350

Query: 357 KYA-TSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQ 415
            +A T L   Q  L L                   E   P  ++    + LG A AQ+  
Sbjct: 351 NFAPTPLIEGQGNLSL-----------------IQEQPAPYTQTIVHKHPLGHALAQLQG 393

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
            YI+SQ   GLVIVD HAAHER+++EKM++      +  Q+LL P  + L   E      
Sbjct: 394 IYILSQNEKGLVIVDMHAAHERILYEKMKKQLAEVGLAMQSLLVPINLSLNPQEITAWQT 453

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           +     RLG + E FGP+ I +R  P++L  KN+  L+RD++ ++I  +TT  + +RI  
Sbjct: 454 NKALFARLGFEIESFGPDKIVVRRHPSLLKPKNLENLIRDVLADLITHNTTSRVGERINA 513

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            LAT+AC+ ++R+   +   EM  LLREMEK  +   CNHGRPT+ +  +++++  F R
Sbjct: 514 ALATLACHAALRAPHYLTIEEMEALLREMEKTEHGGLCNHGRPTWKQFDIAELDTFFLR 572


>gi|212218528|ref|YP_002305315.1| DNA mismatch repair protein [Coxiella burnetii CbuK_Q154]
 gi|212012790|gb|ACJ20170.1| DNA mismatch repair protein [Coxiella burnetii CbuK_Q154]
          Length = 575

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 221/601 (36%), Positives = 332/601 (55%), Gaps = 36/601 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L+++  NQIAAGE++ERP+  +KELIENS+DA +S +   I  GG    +I D+G
Sbjct: 2   MYIRRLNDQTANQIAAGEVVERPASVVKELIENSIDAHASCIRVDILQGGAKQIRIQDDG 61

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  E++ +A++RH TSKI+  DD  +I T GFRGEAL SI AVS LTL SR      G
Sbjct: 62  DGIHPEDLVLALERHATSKIAKIDDLQDITTLGFRGEALSSISAVSRLTLTSRQKNAEMG 121

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +I+    KI +  P A   GT ++V+DLF+  PAR  FL+S   E   I  +I R+A++
Sbjct: 122 YRISNISHKIMTPVPAAHPQGTTIDVQDLFYNTPARRKFLRSPATEFQHIRRIIERLALS 181

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +    F     +         +T      RI  ++G+ F+ +A+ +    + +TL+GY  
Sbjct: 182 HFTTEFLLHHNEKEIIHFKPATTISGQENRIKSILGDVFMQSALAIEFSQSGLTLKGYIA 241

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
              + R   +  Y+++NGR V+DK I   +R AY + +  GR+P  VL LEIDP  VD+N
Sbjct: 242 EAAYTRSQPDLQYIYVNGRFVRDKLIAQALRQAYHDVLFHGRHPAYVLYLEIDPAFVDIN 301

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAIN--KKGIS---TSSVLSKKMISSFHQDNAPKT 353
           VHP K  +RFR+P  +R+F+I +++ A+   K GI+     S      I++F    AP  
Sbjct: 302 VHPTKHEVRFRDPQWVRDFLIHAVKTALAQAKPGIAHPLPQSTAEYNPITNF----AP-- 355

Query: 354 HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQI 413
                 T L   Q  L L                   E   P  ++    + LG A AQ+
Sbjct: 356 ------TPLIEGQGNLSL-----------------IQEQPAPYTQTIVHKHPLGHALAQL 392

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
              YI+SQ   GLVIVD HAAHER+++EKM++      +  Q+LL P  + L   E    
Sbjct: 393 QGIYILSQNEKGLVIVDMHAAHERILYEKMKKQLAEVGLAMQSLLVPINLSLNPQEITAW 452

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRI 533
             +     RLG + E FGP+ I +R  P++L  KN+  L+RD++ ++I  +TT  + +RI
Sbjct: 453 QTNKALFARLGFEIESFGPDKIVVRRHPSLLKPKNLENLIRDVLADLITHNTTSRVGERI 512

Query: 534 ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFG 593
              LAT+AC+ ++R+   +   EM  LLREMEK  +   CNHGRPT+ +  +++++  F 
Sbjct: 513 NAALATLACHAALRAPHYLTIEEMEALLREMEKTEHGGLCNHGRPTWKQFDIAELDTFFL 572

Query: 594 R 594
           R
Sbjct: 573 R 573


>gi|164685701|ref|ZP_01946749.2| DNA mismatch repair protein MutL [Coxiella burnetii 'MSU Goat
           Q177']
 gi|164601208|gb|EAX32616.2| DNA mismatch repair protein MutL [Coxiella burnetii 'MSU Goat
           Q177']
          Length = 574

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 221/601 (36%), Positives = 332/601 (55%), Gaps = 36/601 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L+++  NQIAAGE++ERP+  +KELIENS+DA +S +   I  GG    +I D+G
Sbjct: 1   MYIRRLNDQTANQIAAGEVVERPASVVKELIENSIDAHASCIRVDILQGGAKQIRIQDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  E++ +A++RH TSKI+  DD  +I T GFRGEAL SI AVS LTL SR      G
Sbjct: 61  DGIHPEDLVLALERHATSKIAKIDDLQDITTLGFRGEALSSISAVSRLTLTSRQKNAEMG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +I+    KI +  P A   GT ++V+DLF+  PAR  FL+S   E   I  +I R+A++
Sbjct: 121 YRISNISHKIMTPVPAAHPQGTTIDVQDLFYNTPARRKFLRSPATEFQHIRRIIERLALS 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +    F     +         +T      RI  ++G+ F+ +A+ +    + +TL+GY  
Sbjct: 181 HFTTEFLLHHNEKEIIHFKPATTISGQENRIKSILGDVFMQSALAIEFSQSGLTLKGYIA 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
              + R   +  Y+++NGR V+DK I   +R AY + +  GR+P  VL LEIDP  VD+N
Sbjct: 241 EAAYTRSQPDLQYIYVNGRFVRDKLIAQALRQAYHDVLFHGRHPAYVLYLEIDPAFVDIN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAIN--KKGIS---TSSVLSKKMISSFHQDNAPKT 353
           VHP K  +RFR+P  +R+F+I +++ A+   K GI+     S      I++F    AP  
Sbjct: 301 VHPTKHEVRFRDPQWVRDFLIHAVKTALAQAKPGIAHPLPQSTAEYNPITNF----AP-- 354

Query: 354 HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQI 413
                 T L   Q  L L                   E   P  ++    + LG A AQ+
Sbjct: 355 ------TPLIEGQGNLSL-----------------IQEQPAPYTQTIVHKHPLGHALAQL 391

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
              YI+SQ   GLVIVD HAAHER+++EKM++      +  Q+LL P  + L   E    
Sbjct: 392 QGIYILSQNEKGLVIVDMHAAHERILYEKMKKQLAEVGLAMQSLLVPINLSLNPQEITAW 451

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRI 533
             +     RLG + E FGP+ I +R  P++L  KN+  L+RD++ ++I  +TT  + +RI
Sbjct: 452 QTNKALFARLGFEIESFGPDKIVVRRHPSLLKPKNLENLIRDVLADLITHNTTSRVGERI 511

Query: 534 ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFG 593
              LAT+AC+ ++R+   +   EM  LLREMEK  +   CNHGRPT+ +  +++++  F 
Sbjct: 512 NAALATLACHAALRAPHYLTIEEMEALLREMEKTEHGGLCNHGRPTWKQFDIAELDTFFL 571

Query: 594 R 594
           R
Sbjct: 572 R 572


>gi|240123593|ref|ZP_04736549.1| DNA mismatch repair protein [Neisseria gonorrhoeae PID332]
 gi|268682221|ref|ZP_06149083.1| DNA mismatch repair protein [Neisseria gonorrhoeae PID332]
 gi|268622505|gb|EEZ54905.1| DNA mismatch repair protein [Neisseria gonorrhoeae PID332]
          Length = 654

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 224/656 (34%), Positives = 352/656 (53%), Gaps = 69/656 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ V+  + GGG    ++ DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAVDVELEGGGIRLIRVGDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  ++ + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSGNSALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL LE+ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLELPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRANLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 341 -------MISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLS------ 377
                    S+    N P          KT    Y  +    Q  L L+E+R +      
Sbjct: 359 DSENLFDSASNHPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMDTYAE 418

Query: 378 ----TNDL--------------LPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYII 419
               T+D+              +PS+  T +  +   + SE     LG A AQ+   YI+
Sbjct: 419 LYKKTDDIDLELSQFEQARFGNMPSESSTNNVSDGIGQASELP--PLGFAIAQLLGIYIL 476

Query: 420 SQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDE 478
           +Q  D L+++D HAA ER+ +EKM RQ   +  + SQ LL P        ECA + +H E
Sbjct: 477 AQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQHLLIPVTFAASHEECAALADHAE 536

Query: 479 DLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILA 538
            L   G++    G N +A+R  P +L K ++  L RD++ E+    ++ T+      ILA
Sbjct: 537 TLAGFGLELSDMGGNTLAVRAAPVMLGKSDVVSLARDVLGELAQVGSSQTIASHENRILA 596

Query: 539 TMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           TM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 597 TMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDTLFLR 652


>gi|261392296|emb|CAX49822.1| DNA mismatch repair protein MutL [Neisseria meningitidis 8013]
          Length = 658

 Score =  385 bits (988), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 223/659 (33%), Positives = 361/659 (54%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIKLALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 341 -------MISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
                    S++   N P          KT    Y ++    Q  L L+E+R + N    
Sbjct: 359 DSENLFDRASNYPTGNKPDTRNAFGASGKTAPMPYQSAYAPQQRSLSLRESRAAMNTYAE 418

Query: 380 --------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
                   DL            +PS+ P    D  P+ +   S++    LG A AQ+   
Sbjct: 419 LYKKTDDIDLELSRFEQARFGNMPSETPAPQTDT-PLSDGIPSQSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM RQ   + ++ SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGRLQSQRLLIPVTFAASHEECAALAD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           H + L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++    
Sbjct: 538 HADALAGFGLELSDMGGNTLAVRTVPAMLGKADVVSLAKDVLGELAQVGSSQTIEEHENR 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSVRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|299065825|emb|CBJ37004.1| methyl-directed mismatch repair protein [Ralstonia solanacearum
           CMR15]
          Length = 636

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 207/631 (32%), Positives = 342/631 (54%), Gaps = 46/631 (7%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR L +++I+QIAAGE++ERP+  +KEL+EN+LDA +++++  +  GG     ITDNG G
Sbjct: 11  IRPLPDQLISQIAAGEVVERPASVVKELLENALDAGATQLQIKLEEGGVRRIAITDNGGG 70

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  +E+P+A+ RH TSKI   ++  ++ T GFRGEAL SI +V+ LTL SR  Q+    Q
Sbjct: 71  IPVDELPVALMRHATSKIGSLEELESVATLGFRGEALASIASVAELTLTSRTAQDAHATQ 130

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I     +   V+P +   GT V+V+ L+F  PAR  FLK+EQ E     +VIRR A+A P
Sbjct: 131 IIA---QTGRVQPASGGVGTTVDVQHLYFNTPARRKFLKTEQTELGHCLEVIRRTALARP 187

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V+   S   + +   ++ +   +   R + V+G +F    +   E + E+ L G+ G+P
Sbjct: 188 DVAI--SVHHNGKPLEHWNAAQADM--RTAAVLGTEFARARLPFEEAAGELRLFGFAGLP 243

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           T +RG A+  + ++NGR V+D+ +   +R+AY + +   R+P  VL LE+ P  VDVNVH
Sbjct: 244 TASRGRADHQFFYVNGRFVRDRLLTHAVRSAYEDVLHGDRFPAYVLCLELPPEAVDVNVH 303

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA---PKTHLPK 357
           P+K  +RFR+   +  F+  ++Q+A+++        L   +  +  Q  A   P  +  +
Sbjct: 304 PSKIEVRFRDSRAVHQFVYHAVQRALSRHAGEQGDSLRTDIADAPEQPGATATPADNTTR 363

Query: 358 YATSLTNTQEKLFLQENRLSTNDLL-------PSDDPTYSED------------------ 392
           +   +   Q  L + + R     ++       P   P +  D                  
Sbjct: 364 WVNQMAARQTSLGIAQPRAEYLAMMRGGSTPQPPSRPAWMADVPSAATLFDGAADAPADA 423

Query: 393 -----NDPVEESEATH----YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKM 443
                ++P    +A      + LG A AQ+H  Y+++Q   G+V+VD HAAHER+++E++
Sbjct: 424 APAQASEPAAAPQADDSDDAHPLGFAVAQLHGIYVLAQNARGMVLVDMHAAHERILYEQL 483

Query: 444 RQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAI 503
           +    + +I  Q LL P        E     E  + L  LG       P  +A+R +P +
Sbjct: 484 KTALEAKRIEVQPLLIPVTFAASAVEIGTAEEFCDTLDLLGFDISAVSPTTLAVRAVPTL 543

Query: 504 LSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLRE 563
           L K +   L RD++ ++     +  L +R   +LAT+AC+ ++R+ R++   EMN LLR+
Sbjct: 544 LQKADAQALARDVLRDLQAYGGSRVLAERQNELLATLACHSAVRANRRLNLDEMNGLLRQ 603

Query: 564 MEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ME    + QCNHGRPT+I+L ++D+++LF R
Sbjct: 604 MEATERADQCNHGRPTWIQLTVADLDRLFLR 634


>gi|329904231|ref|ZP_08273710.1| DNA mismatch repair protein MutL [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327548094|gb|EGF32819.1| DNA mismatch repair protein MutL [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 612

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 210/612 (34%), Positives = 337/612 (55%), Gaps = 32/612 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I  L +++I+QIAAGE++ERPS  +KEL+EN+LDA ++++   +  GG     ITDNG G
Sbjct: 11  IAALPDQLISQIAAGEVVERPSAVVKELLENALDAGATQITIRLEQGGIKRIAITDNGRG 70

Query: 63  MTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           + ++EIP+A+ RH TSKI+   D  N+ T GFRGEAL SI +++ LTL +R         
Sbjct: 71  IPADEIPLALARHATSKIASLSDLENVATLGFRGEALASIASIAQLTLTTR--TATAAHA 128

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
             +SG + + V P +  PGT ++V+DL++  PAR  FLKS+Q E     +V+RR+A++ P
Sbjct: 129 WEMSGSQPAPV-PSSGAPGTTIDVQDLYYNTPARRKFLKSDQTEYGHCAEVVRRIALSRP 187

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V+F+ +    +  K     T  +   R + ++G DF    + L+E +  + L GY G+P
Sbjct: 188 DVAFSLT----HNGKTVDHWTLADMDRRSAHILGSDFSAARLSLDEAAGPLRLHGYAGLP 243

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           T +RG A+  Y ++NGR V+DK +   +R+AY + +   RYP  VL L++DP  VDVNVH
Sbjct: 244 TASRGRADAQYFYVNGRFVRDKLLTHAVRSAYQDVLHGDRYPSYVLALDLDPALVDVNVH 303

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           P+K  +RFR+   +  F+  ++ +A+     S +S  +  M+ +     A   H  +   
Sbjct: 304 PSKIEVRFRDSRAVHQFVFHAVTRAL-----SQTSATADGMVPAPQAAGAMPWHSTQQTP 358

Query: 361 SLTNTQEKLFLQ------------------ENRLSTNDLLPSDDPTYSEDNDPVEESEAT 402
           +   T++  F Q                  E    +N+          + +  V  S   
Sbjct: 359 AQPYTRQGSFSQQAEPGIAQNSARYGALFGEKSGDSNEAFEQVAVAGWQPSPAVAPSGTA 418

Query: 403 HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEI 462
            + LG A AQ+   YI++Q   GLV+VD HAAHER+++E+ +   ++  +  Q LL P  
Sbjct: 419 EFPLGFALAQLQGIYILAQNLTGLVLVDMHAAHERILYEQFKTALDTDAVVVQPLLIPVT 478

Query: 463 IDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIID 522
                 E     E+   L  LG       P  +A+R IPA+L   +   L RD++ ++ +
Sbjct: 479 FHADAVEVGTTAENQATLAALGFDIAALSPTTLAVRAIPALLKNADAQSLARDVLRDVRE 538

Query: 523 SSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIK 582
              +  L +R   +L T+AC+ ++R+ R +   EMN LLR+ME    + QCNHGRPT+++
Sbjct: 539 FGGSRVLMERRNELLGTLACHTAVRANRILTLPEMNALLRQMEATERADQCNHGRPTWVQ 598

Query: 583 LKLSDIEKLFGR 594
           + LSD+++LF R
Sbjct: 599 MALSDLDRLFQR 610


>gi|226952695|ref|ZP_03823159.1| enzyme in methyl-directed mismatch repair, stimulates binding of
           Vsr and MutS to heteroduplex DNA [Acinetobacter sp. ATCC
           27244]
 gi|226836563|gb|EEH68946.1| enzyme in methyl-directed mismatch repair, stimulates binding of
           Vsr and MutS to heteroduplex DNA [Acinetobacter sp. ATCC
           27244]
          Length = 657

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 222/655 (33%), Positives = 352/655 (53%), Gaps = 69/655 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L   + NQIAAGE+IERPS  +KEL+ENS+DA ++ +   +A GG +  +I DNG 
Sbjct: 8   RIHTLDAALANQIAAGEVIERPSSVVKELLENSIDAGATELIIRVAQGGATLIEIIDNGN 67

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  E++P+AV RH TSKI  +DD   I + GFRGEAL SI AVS LTL S   +   G 
Sbjct: 68  GIHPEDLPLAVMRHATSKIQTADDLHAIVSLGFRGEALASIAAVSRLTLTSSQDEQGVGY 127

Query: 120 QIAISGEKIS--SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           Q+ ++G       ++ VA   GT + V+DLFF +PAR  FLK    E   I +++RR+A+
Sbjct: 128 QVEVNGTAFDHQQIQAVAAQKGTHIRVQDLFFNVPARRKFLKKPSTEFGHIEEIVRRLAL 187

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            + ++ F      + R  +    +     +R+ Q++G+ FI NA  ++ +S  + L G+ 
Sbjct: 188 THFEIRFVLEHNDNIRLNLPVADSGELRYQRVQQLLGQQFIQNAYWIDAESINMRLSGWL 247

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G P+  R  A+  YV++NGR V+DK I   +R AY   +   ++   +L LE+DP  +DV
Sbjct: 248 GHPSDARAQADLQYVYVNGRIVKDKTISHALRMAYEGILHGHQHSSYLLFLEVDPENIDV 307

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQ------------------------------------- 320
           NVHP K  IRF N   +  F+                                       
Sbjct: 308 NVHPTKHEIRFLNQREVHEFVRHYAKATLSQFQTASADLAQAMKVDETDHQAAQYQPQPK 367

Query: 321 -----SIQKAINKKGISTSSV-LSKKMISSFHQDNAPKTHL-------PKY-ATSLTNTQ 366
                ++ KA+  + +S     +S ++++ F+Q      H        P+Y  +   N  
Sbjct: 368 YQEQFNLHKAVVTEPLSDQQTDISTELLTEFNQSRPQAVHYTSGQSQQPRYNGSGQLNNA 427

Query: 367 EKLFLQENRLSTNDLLPSDDPTYSED--NDPVE----ESEATHYQLGIACAQIHQNYIIS 420
            K +L   R        SD PT + D  ND V+    +S    + LGIA AQ+H  YI++
Sbjct: 428 LKTYLAPLR-------ESDVPTTAFDSGNDTVDRDVAQSRVDEFPLGIAIAQLHGIYILA 480

Query: 421 QTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI-TSQTLLTPEIIDLLEGECALIMEHDED 479
           Q T+GL+IVD HAAHER++ ++M+  ++  +   SQ LL P+++ +   +   I E    
Sbjct: 481 QNTEGLIIVDMHAAHERILLQQMKAAWDKPEFWVSQQLLIPKVVSITRMQATRIEELQPQ 540

Query: 480 LHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILAT 539
           L RLG++ +++G   + +R +PAIL K +   L+ ++++++  +     L  + + +LA 
Sbjct: 541 LQRLGLEIDQYGDEQVIVRGVPAILHKADFSNLIPELLNDLDPNDEARGLLQKRDELLAG 600

Query: 540 MACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           MAC+G++R+ R++   EMN LLR+ME+   +SQCNHGRPT+    L  ++KLF R
Sbjct: 601 MACHGAVRAHRQLSLSEMNALLRQMEQTEFASQCNHGRPTWRAFPLHQLDKLFAR 655


>gi|325142632|gb|EGC65023.1| DNA mismatch repair protein MutL [Neisseria meningitidis 961-5945]
          Length = 658

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 224/659 (33%), Positives = 360/659 (54%), Gaps = 71/659 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   +    
Sbjct: 63  GIHPDDIKLALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQDGSAHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSEATEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRADLTESVGNAGEVLHDITGVTPAPMPSEN 358

Query: 341 -------MISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
                    S++   N P          KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 NSENLFDRASNYPTGNKPDTRNAFGASGKTAPMPYQAARAPQQRSLSLRESRAAMNTYAE 418

Query: 380 --------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQN 416
                   DL            +PS+ PT   D  P+ +   S++    LG A AQ+   
Sbjct: 419 LYKKTDDIDLELNRLEQARFGNMPSETPTPKTDA-PLSDGIPSQSELPPLGFAIAQLLGI 477

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           YI++Q  D L+++D HAA ER+ +EKM RQ   + ++ SQ LL P        ECA + +
Sbjct: 478 YILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGRLQSQRLLIPVTFAASHEECAALAD 537

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           H + L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++    
Sbjct: 538 HADALAGFGLELSDMGGNTLAVRTVPAMLGKADVVSLAKDVLGELAQVGSSQTIEEHENR 597

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 598 ILATMSCHGSVRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|163855132|ref|YP_001629430.1| DNA mismatch repair protein [Bordetella petrii DSM 12804]
 gi|163258860|emb|CAP41159.1| DNA mismatch repair protein [Bordetella petrii]
          Length = 641

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 211/631 (33%), Positives = 344/631 (54%), Gaps = 46/631 (7%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I  L + +I+QIAAGE+IERP+  +KE++EN++DA +  +E  + GGG     ++D+G G
Sbjct: 16  IAALPDLLISQIAAGEVIERPASVLKEVLENAIDAGARAIEVRLEGGGIRRIAVSDDGVG 75

Query: 63  MTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  EE+P+A+ RH TSKI    +  ++ + GFRGEAL SI +V+ +TL+SR        Q
Sbjct: 76  IPPEELPLALARHATSKIRSLGELESVASMGFRGEALASIASVAQVTLISRTRDGEHAWQ 135

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I   G  +  V P +  PGT V+VR LF ++PAR  FL++E  E     D + R+A+A+P
Sbjct: 136 I--DGGSLQ-VTPASGPPGTTVDVRQLFDSVPARRKFLRAEATEFGHCVDALERIALAHP 192

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            ++F       +R +  +   +    +RI  V+G +F  + + +   +  I L G    P
Sbjct: 193 DIAFRL--FHHDRAQRQWLPADPG--QRIRDVLGAEFTEHGLPVEASAGAIGLSGMITRP 248

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           T  R  A++ Y+++NGR V+D+ +   +R AYA+ +   R P  VL L+IDP  VDVNVH
Sbjct: 249 TAARARADRQYLYVNGRYVRDRTVSHALRAAYADVLHGDRQPAYVLYLDIDPGAVDVNVH 308

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTS-------------------------S 335
           PAK  +RFR+   +  F+ Q + +A+ + G +++                          
Sbjct: 309 PAKHEVRFRDSGAVHRFVSQVVGQALAQTGGASAVPAAAGMAPGAPAAASDTGAPALTVE 368

Query: 336 VLSKKMISSFHQDNAPKTHLP-KYATSLTNTQEKLFLQENRLSTNDL----LPSDD--PT 388
                M+S+     A     P + A        +L  +   +   D      P D+  P 
Sbjct: 369 TTPAAMLSAGGGSAAAWPAAPDRTARPHAQVPFRLHTEPAGIPATDWRTLYRPLDNTAPA 428

Query: 389 YSEDNDPVEESEAT-----HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKM 443
            +   +P   S         + LG+A AQ+H  YI++Q   GLV+VD HAAHER+++E++
Sbjct: 429 PATLREPAPASPRALPADEEHPLGMALAQLHGIYILAQNRRGLVLVDMHAAHERVVYEQL 488

Query: 444 RQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAI 503
           +Q  ++  +  Q LL P +    E + AL  EH ++L  LG      GP +IA+R +PA+
Sbjct: 489 KQALDARDLPRQDLLVPVVFHAQEKDVALAEEHQQELAGLGFDLRPAGPTSIAVRSVPAL 548

Query: 504 LSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLRE 563
           L++ +I  + R ++ ++     +  L ++   +L+TMAC+GS+R+ R++   EMN LLR+
Sbjct: 549 LARGDIETMARAVLRDLASVGVSRLLTEQRNELLSTMACHGSVRANRRLSIEEMNALLRQ 608

Query: 564 MEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ME    + QCNHGRPT+++  +SD++KLF R
Sbjct: 609 MEVTERADQCNHGRPTWVQWSVSDLDKLFLR 639


>gi|269958988|ref|YP_003328777.1| DNA mismatch repair protein (MutL) [Anaplasma centrale str. Israel]
 gi|269848819|gb|ACZ49463.1| DNA mismatch repair protein (MutL) [Anaplasma centrale str. Israel]
          Length = 632

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 222/634 (35%), Positives = 346/634 (54%), Gaps = 58/634 (9%)

Query: 6   LSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTS 65
           L  K +N+IAAGE+I+ P+  +KEL+ENS+DA ++ +  +I  GG++   + D+G G+  
Sbjct: 11  LDAKTVNKIAAGEVIDCPASVVKELVENSIDAGATTINVLIDKGGRNLISVIDDGCGIPR 70

Query: 66  EEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAI- 123
           +E+  A   H TSK+ D D +NI + GFRGE L SI AV+   ++S+         I + 
Sbjct: 71  DEMERAFICHATSKLPDNDLNNIRSMGFRGEGLTSIAAVARTKMVSKYRGCTEAWSIVLE 130

Query: 124 SGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVS 183
            GEK   + P A+  GT +EVRDLFF  P RL FL++E+ ET  I D++ R A A    +
Sbjct: 131 GGEKTRDLSPEALPCGTSIEVRDLFFATPTRLKFLRTEKAETQSIVDLMYRFATARFSTA 190

Query: 184 FTFSTIKSNRYKMNFQSTNGNFPERISQV--IGEDFINNAVELNEKSNEITLQGYTGIPT 241
           F+ +      +K   +    +   R+ ++   G+ F   ++E+   S+ I + GY  +PT
Sbjct: 191 FSLTIADKQIFKYPARE---DLMSRLWEMKPFGDAFREQSLEVRFHSDAINITGYISVPT 247

Query: 242 FNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHP 301
           FNR   +  Y F+NGR V     +  I++AY+E IP  R+PVVV+ +EI P  VDVNVHP
Sbjct: 248 FNRSRPDMIYTFVNGRPVHSTLFMGAIKSAYSEFIPRDRHPVVVMCMEILPGDVDVNVHP 307

Query: 302 AKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKM---------ISSFHQDNAPK 352
           +K  +RFRN   + + +++++  A+       SS + +++         +  F  DN P 
Sbjct: 308 SKLEVRFRNRKQVYSVVVEALATAL-------SSNVYRELPPRTPVGGGLDHFAVDNTPV 360

Query: 353 THLPKYATSL---TNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVE------------ 397
              P Y            KL +Q+       L     P ++ +N P              
Sbjct: 361 LDTPHYGKVHDYGVAVGPKLSVQQTGGGGEFL---SKPEHAIENPPRAAELFSFLGSGSS 417

Query: 398 ----------ESEA------THYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFE 441
                     +SEA          LG A  Q+   YI+S+  D ++IVDQHAAHERL +E
Sbjct: 418 RRTTRPVLSYDSEAHIVPLIEELPLGNAVCQLFDRYIVSRAGDHVIIVDQHAAHERLTYE 477

Query: 442 KMRQDFNSTKITSQTLLTPEIIDLL-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREI 500
            M++      +  Q LL PE+++L  E E  L+ E+ E L + G+  E  G   +A+RE+
Sbjct: 478 YMKKVTADEGMKRQVLLMPELVELDNEYELELLGEYKEKLLKFGLVIEPMGSMVVAVREV 537

Query: 501 PAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRL 560
           PAIL   ++  ++  I++ I++      ++++I+++  T+ACY SIRSGR ++  EMN L
Sbjct: 538 PAILGVFDVKAMIAKIVESIVEVGDALFMREKIKHVCGTIACYSSIRSGRTLKLEEMNSL 597

Query: 561 LREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LR+ME  P+S QCNHGRPT++KL LS+I+KLF R
Sbjct: 598 LRQMEDTPHSGQCNHGRPTYVKLSLSEIDKLFER 631


>gi|254670262|emb|CBA05521.1| DNA mismatch repair protein MutL [Neisseria meningitidis alpha153]
          Length = 658

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 224/660 (33%), Positives = 360/660 (54%), Gaps = 73/660 (11%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  + GGG     ++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELDGGGIRLIHVSDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS        GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAATHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  S  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSGSGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI--NKKGISTS------------SVLSKKM---- 341
           HP K+ IRFR+   +   +  ++ KA+   +  ++ S             V+S  M    
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRANLTESVGNAGEVLHDITGVVSTPMPSEN 358

Query: 342 --------ISSFHQDNAPKTH-----------LPKYATSLTNTQEKLFLQENRLSTN--- 379
                   +S++   N   TH           +P Y ++    Q  L L+E+R + N   
Sbjct: 359 DSENLFDSVSNYPTGNKSDTHNAFGSSGKTAPMP-YQSAYAPQQRSLSLRESRAAMNTYA 417

Query: 380 ---------DL------------LPSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQ 415
                    DL            +PS+ P    D  P+ +   S++    LG A AQ+  
Sbjct: 418 ELYKKTDDIDLELSRFEQARFGNMPSETPAPQTDT-PLSDGIPSQSELPPLGFAIAQLLG 476

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIM 474
            YI++Q  D L+++D HAA ER+ +EKM RQ   + ++ SQ LL P        ECA + 
Sbjct: 477 IYILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGRLQSQRLLIPVTFAASHEECAALA 536

Query: 475 EHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIE 534
           +H + L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++   
Sbjct: 537 DHADALAGFGLELSDMGGNTLAVRTVPAMLGKADVVSLAKDVLGELAQVGSSQTIEEHEN 596

Query: 535 NILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            ILATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 597 RILATMSCHGSVRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|294650010|ref|ZP_06727398.1| enzyme in methyl-directed mismatch repair [Acinetobacter
           haemolyticus ATCC 19194]
 gi|292824103|gb|EFF82918.1| enzyme in methyl-directed mismatch repair [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 657

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 225/649 (34%), Positives = 352/649 (54%), Gaps = 57/649 (8%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L   + NQIAAGE+IERPS  +KEL+ENS+DA ++ +   +A GG +  +I DNG 
Sbjct: 8   RIHTLDAALANQIAAGEVIERPSSVVKELLENSIDAGATELIIRVAQGGATLIEIIDNGN 67

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  E++P+AV RH TSKI  +DD   I + GFRGEAL SI AVS LTL S   +   G 
Sbjct: 68  GIHPEDLPLAVMRHATSKIQTADDLHAIVSLGFRGEALASIAAVSRLTLTSSQDEQGVGY 127

Query: 120 QIAISGEKIS--SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           Q+ ++G       ++ VA   GT + V+DLFF +PAR  FLK    E   I +++RR+A+
Sbjct: 128 QVEVNGTAFDHQQIQAVAAQKGTHIRVQDLFFNVPARRKFLKKPSTEFGHIEEIVRRLAL 187

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            + ++ F      + R  +    +     +R+ Q++G+ FI NA  ++ +S  + L G+ 
Sbjct: 188 THFEIRFVLEHNDNIRLNLPVADSGELRYQRVQQLLGQQFIQNAYWIDAESINMRLSGWL 247

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G P+  R  A+  YV++NGR V+DK I   +R AY   +   ++   +L LE+DP  +DV
Sbjct: 248 GHPSDARAQADLQYVYVNGRIVKDKTISHALRMAYEGILHGHQHSSYLLFLEVDPENIDV 307

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKM-ISSFHQDNAPKTHLP 356
           NVHP K  IRF N   +  F ++   KA+  +  + S+ L++ M +       A     P
Sbjct: 308 NVHPTKHEIRFLNQREVHEF-VRHYAKAMLSQFQTASADLAQAMKVDETDHQAAQYQPQP 366

Query: 357 KYATSL---------------TNTQEKLFLQ---------------------------EN 374
           KY                   T+   +LF +                            N
Sbjct: 367 KYQEQFNLHKAVVTEPLSDQQTDISTELFTEFNQSRPQAVHYTSGQSQQPRYNGSGQLNN 426

Query: 375 RLST--NDLLPSDDPTYSED--NDPVE----ESEATHYQLGIACAQIHQNYIISQTTDGL 426
            L T    L  SD PT + D  ND V+    +S    + LGIA AQ+H  YI++Q T+GL
Sbjct: 427 ALKTYLAPLRESDVPTTAFDSGNDTVDRDVAQSRVDEFPLGIAIAQLHGIYILAQNTEGL 486

Query: 427 VIVDQHAAHERLIFEKMRQDFNSTKI-TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGI 485
           +IVD HAAHER++ ++M+  ++  +   SQ LL P+++ +   +   I E    L RLG+
Sbjct: 487 IIVDMHAAHERILLQQMKAAWDKPEFWVSQQLLIPKVVPITRMQATRIEELQPQLQRLGL 546

Query: 486 KAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGS 545
           + +++G   + +R +PAIL K +   L+ ++++++  +     L  + + +LA MAC+G+
Sbjct: 547 EIDQYGDEQVIVRGVPAILHKADFSNLIPELLNDLDPNDEARGLLQKRDELLAGMACHGA 606

Query: 546 IRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +R+ R++   EMN LLR+ME+   +SQCNHGRPT+    L  ++KLF R
Sbjct: 607 VRAHRQLSLSEMNALLRQMEQTEFASQCNHGRPTWRAFPLHQLDKLFAR 655


>gi|262375385|ref|ZP_06068618.1| DNA mismatch repair ATPase [Acinetobacter lwoffii SH145]
 gi|262309639|gb|EEY90769.1| DNA mismatch repair ATPase [Acinetobacter lwoffii SH145]
          Length = 655

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 222/650 (34%), Positives = 353/650 (54%), Gaps = 62/650 (9%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR L   + NQIAAGE+IERP+  +KEL+ENS+DA ++ +   +  GG +  +I DNG 
Sbjct: 9   RIRALDPALANQIAAGEVIERPASVVKELLENSIDAGATELIIRVEQGGSTLIEIIDNGR 68

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  E++P+AV RH TSKI  +D+   I + GFRGEAL SI AVS LT++S       G 
Sbjct: 69  GIHHEDLPLAVMRHATSKIQSADELYAISSLGFRGEALASIAAVSRLTMISSQSDEGIGY 128

Query: 120 QIAISGEKI--SSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           Q+ ++G       ++ VA + GT + V+DLFF +PAR  FLK    E   I +++RRMA+
Sbjct: 129 QVEVNGTAFDHQEIQAVAASKGTHIRVQDLFFNVPARRKFLKKPGTEFGHIEEIVRRMAL 188

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            +  + F     +S +  +    +     +R+ Q++G  F  NA  ++  S  + L G+ 
Sbjct: 189 THFDIRFVLEHNESIKLNLPVADSGALRFQRVQQLLGRQFTENAYWIDADSINMRLSGWL 248

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G P+  R  A+  YV++NGR V+DK I   +R AY   +   ++   +L LE+DP  VDV
Sbjct: 249 GHPSDARAQADLQYVYVNGRIVKDKTISHALRMAYDGILHGHQHAAYLLFLEVDPENVDV 308

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL-- 355
           NVHP K  IRF N   +  F+     +   K+ ++     +  +  +  QD  P      
Sbjct: 309 NVHPTKHEIRFLNQREVHEFV-----RHYAKETLAQFQTATADLAEAMKQDEQPGLTAPQ 363

Query: 356 PKYATSLT-----NTQEKLFLQENRLS---TNDLL---PSDDPT---YSEDN-------- 393
           P+Y    +     ++Q ++    + LS   T+D+L    S  P    YS+D         
Sbjct: 364 PRYQEQFSLHQTAHSQPQVVRTTSALSENETSDVLTDFASSGPQTVHYSQDYRKSYSGSQ 423

Query: 394 ----------DPVEESEAT------------------HYQLGIACAQIHQNYIISQTTDG 425
                      P+ ES  T                   + LGIA AQ+H  YI++Q T+G
Sbjct: 424 QLNNALQSYLAPLRESSETEIFSPEQSFQTHVNTKVDEHPLGIAIAQLHGIYILAQNTEG 483

Query: 426 LVIVDQHAAHERLIFEKMRQDFNSTKI-TSQTLLTPEIIDLLEGECALIMEHDEDLHRLG 484
           L+IVD HAAHER++ ++M+  ++  +  TSQ LL P+++++   +   + E  E L RLG
Sbjct: 484 LIIVDMHAAHERIVLQQMKSAWDKPEFWTSQQLLIPKVVNISRMQAMRVEELKEQLARLG 543

Query: 485 IKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYG 544
           ++ +++G   I +R +PAIL K +   L+ ++++++       +L  + + ILA MAC+G
Sbjct: 544 LEIDQYGDEQIIVRGVPAILHKADFDALIPELLNDLDPGDQAQSLLQKRDQILAGMACHG 603

Query: 545 SIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ++R+ R +   EMN LLR+ME+   +SQCNHGRPT+    L+ ++KLF R
Sbjct: 604 AVRAHRILSLSEMNALLRQMEQTEFASQCNHGRPTWRAFPLAQLDKLFAR 653


>gi|222474963|ref|YP_002563378.1| DNA mismatch repair protein (mutL) [Anaplasma marginale str.
           Florida]
 gi|222419099|gb|ACM49122.1| DNA mismatch repair protein (mutL) [Anaplasma marginale str.
           Florida]
          Length = 632

 Score =  382 bits (981), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 221/634 (34%), Positives = 346/634 (54%), Gaps = 58/634 (9%)

Query: 6   LSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTS 65
           L  K +N+IAAGE+I+ P+  +KEL+ENS+DA ++ +  +I  GG++   + D+G G+  
Sbjct: 11  LDAKTVNKIAAGEVIDCPASVVKELVENSIDAGATTINVLIDKGGRNLISVIDDGCGIPR 70

Query: 66  EEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAI- 123
           +E+  A   H TSK+ D D +NI + GFRGE L SI AV+   ++S+         I + 
Sbjct: 71  DEMERAFICHATSKLPDNDLNNIRSMGFRGEGLTSIAAVARTKMVSKYRGCTEAWSIVLE 130

Query: 124 SGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVS 183
            GEK   + P A+  GT +EVRDLFF  P RL FL++E+ ET  I D++ R A A    +
Sbjct: 131 GGEKTRDLSPEALPCGTSIEVRDLFFATPTRLKFLRTEKAETQSIVDLMYRFATARFSTA 190

Query: 184 FTFSTIKSNRYKMNFQSTNGNFPERISQV--IGEDFINNAVELNEKSNEITLQGYTGIPT 241
           F+ +      +K   +    +   R+ ++   G+ F   ++E+   S+ I + GY  +PT
Sbjct: 191 FSLTIADKQIFKYPARE---DLMSRLWEMKPFGDAFREQSLEVRFHSDAINITGYISVPT 247

Query: 242 FNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHP 301
           FNR   +  Y F+NGR V     +  I++AY+E IP  R+PVVV+ +EI P  VDVNVHP
Sbjct: 248 FNRSRPDMIYTFVNGRPVHSTLFMGAIKSAYSEFIPRDRHPVVVMCMEILPGDVDVNVHP 307

Query: 302 AKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKM---------ISSFHQDNAPK 352
           +K  +RFRN   + + +++++  A+       SS + +++         +  F  DN P 
Sbjct: 308 SKLEVRFRNRKQVYSVVVEALATAL-------SSNVYRELPPRTPVGGGLDHFAVDNTPV 360

Query: 353 THLPKYATSL---TNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVE------------ 397
              P Y            KL +Q+          S  P ++ +N P              
Sbjct: 361 LDTPHYGKVHDYGVAVGPKLSVQQTGGGGEF---SSKPEHAIENPPRAAELFSFLGSGSS 417

Query: 398 ----------ESEA------THYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFE 441
                     +SEA          LG A  Q+   YI+S+  D ++IVDQHAAHERL +E
Sbjct: 418 RRTTRPVLSYDSEAHIVPLIEELPLGNAVCQLFDRYIVSRAGDHVIIVDQHAAHERLTYE 477

Query: 442 KMRQDFNSTKITSQTLLTPEIIDLL-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREI 500
            M++      +  Q LL PE+++L  E E  L+ E+ E L + G+  E  G   +A+RE+
Sbjct: 478 YMKKVTADEGMKRQVLLMPELVELDNEYELELLGEYKEKLLKFGLVIEPMGSMVVAVREV 537

Query: 501 PAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRL 560
           PAIL   ++  ++  I++ I++      ++++I+++  T+ACY SIRSGR ++  EMN L
Sbjct: 538 PAILGVFDVKAMIAKIVESIVEVGDALFMREKIKHVCGTIACYSSIRSGRTLKLEEMNSL 597

Query: 561 LREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LR+ME  P+S QCNHGRPT++KL LS+I++LF R
Sbjct: 598 LRQMEDTPHSGQCNHGRPTYVKLSLSEIDRLFER 631


>gi|42520375|ref|NP_966290.1| DNA mismatch repair protein MutL-2 [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|42410113|gb|AAS14224.1| DNA mismatch repair protein MutL-2 [Wolbachia endosymbiont of
           Drosophila melanogaster]
          Length = 598

 Score =  382 bits (981), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 232/620 (37%), Positives = 354/620 (57%), Gaps = 49/620 (7%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I  L  K IN+IAAGE+IERP+  +KEL+EN++DA SS +E  I  GG++   + D+G
Sbjct: 1   MAIILLDTKTINRIAAGEVIERPASLVKELVENAIDAGSSEIEIKIESGGRNLITVIDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            G+   ++ +A+ RH TSK+SD +   I   GFRGEALPSI AVS + L S+     +GA
Sbjct: 61  NGIEKNDLELALMRHATSKLSDSELIEIRHLGFRGEALPSIAAVSRMKLSSKA----SGA 116

Query: 120 QIAIS-----GEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRR 174
           + A S     GEKI  + P ++  GT +EVRDLFF  P RL FLK+E+ ET  I D++  
Sbjct: 117 KEAWSIRYEGGEKIREITPCSLLQGTYIEVRDLFFATPNRLKFLKTERAETQSIVDIVNN 176

Query: 175 MAIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQ 234
           +A+    + FT ++      K   Q++  N   R+ + I E+F +N++E+ E+   I L+
Sbjct: 177 LAMINYSIGFTLTSGNKKLLKYVKQTSLFN---RLCE-IEEEFQSNSLEVKEEEEGIKLK 232

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           G+   P  NRGN+ Q Y F+NGR ++D  ++  IR AY + IP  RYP  VL LE+   Q
Sbjct: 233 GHICKPNVNRGNSTQIYTFVNGRPIKDNLLVGAIRYAYHDFIPNNRYPFAVLHLEVPYDQ 292

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMI-----SSFHQDN 349
           VDVNVHP KS +RF+N  +I   + + I K ++ +  +    + +++I     S    D+
Sbjct: 293 VDVNVHPNKSEVRFQNKRLIYEIVRRGIIKTLSTRFAAGDQGIEEELIFNDSKSQEQVDS 352

Query: 350 APKTHLPKYATSLTNTQEKLFLQE------------NRLSTNDLLPSDDPTYSEDN--DP 395
             K    ++     +  E   ++E                  + LP       E    D 
Sbjct: 353 QEKKDQKEFYEKRPSLLENRLMKEFNAPDERRQSLPETFKYGESLPQKGTMVLERKQIDL 412

Query: 396 VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQ 455
           VE+     + LG A  Q+H  YII++  D L+IVDQHAA+ERLI+E ++Q    + I  Q
Sbjct: 413 VED-----HPLGYARCQVHNTYIIAEAGDRLIIVDQHAAYERLIYECLKQ---KSSIKRQ 464

Query: 456 TLLTPEIIDLL-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLR 514
            LL PE +++  +    ++  + ++L  +G   E    + + I+EIPAIL   +I ++L 
Sbjct: 465 KLL-PETVEIKNQAGMGMVKTYKDELFEMGFDIEIQSEDKVTIKEIPAILGTIDIKEMLV 523

Query: 515 DIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCN 574
           DI+D++++   T  ++D++  I AT+AC+G   +GRKM+  EMN +LR++EK P S    
Sbjct: 524 DIVDKLMEMEDTLPIEDKVNKISATIACHG---AGRKMKLEEMNEILRQIEKTPYSG--- 577

Query: 575 HGRPTFIKLKLSDIEKLFGR 594
           H RPT+I++KL DIEKLF R
Sbjct: 578 HERPTYIEMKLIDIEKLFER 597


>gi|240014088|ref|ZP_04721001.1| DNA mismatch repair protein [Neisseria gonorrhoeae DGI18]
 gi|240016522|ref|ZP_04723062.1| DNA mismatch repair protein [Neisseria gonorrhoeae FA6140]
 gi|240115743|ref|ZP_04729805.1| DNA mismatch repair protein [Neisseria gonorrhoeae PID18]
 gi|240121649|ref|ZP_04734611.1| DNA mismatch repair protein [Neisseria gonorrhoeae PID24-1]
 gi|268601421|ref|ZP_06135588.1| DNA mismatch repair protein [Neisseria gonorrhoeae PID18]
 gi|268585552|gb|EEZ50228.1| DNA mismatch repair protein [Neisseria gonorrhoeae PID18]
          Length = 654

 Score =  382 bits (980), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 223/662 (33%), Positives = 349/662 (52%), Gaps = 81/662 (12%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ V+  + GGG    ++ DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAVDVELEGGGIRLIRVGDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  ++ + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSGNSALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL LE+ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLELPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRANLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 341 -------MISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTNDLLP 383
                    S+    N P          KT    Y  +    Q  L L+E+R + +    
Sbjct: 359 DGENLFDSASNHPTGNKPDIRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMD---- 414

Query: 384 SDDPTYSE-----DNDPVEESEATHYQLG-------------------------IACAQI 413
               TY+E     DN  +E S+    + G                          A AQ+
Sbjct: 415 ----TYAELYKKTDNIDLELSQFEQARFGNMPSESSTNNVSDGIGQASELPPLGFAIAQL 470

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECAL 472
              YI++Q  D L+++D HAA ER+ +EKM RQ   +  + SQ LL P        ECA 
Sbjct: 471 LGIYILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQHLLIPVTFAASHEECAA 530

Query: 473 IMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDR 532
           + +H E L   G++    G N +A+R  P +L K ++  L RD++ E+    ++ T+   
Sbjct: 531 LADHAETLAGFGLELSDMGGNTLAVRAAPVMLGKSDVVSLARDVLGELAQVGSSQTIASH 590

Query: 533 IENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLF 592
              ILATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF
Sbjct: 591 ENRILATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDTLF 650

Query: 593 GR 594
            R
Sbjct: 651 LR 652


>gi|293399028|ref|ZP_06643193.1| DNA mismatch repair protein mutL [Neisseria gonorrhoeae F62]
 gi|291610442|gb|EFF39552.1| DNA mismatch repair protein mutL [Neisseria gonorrhoeae F62]
          Length = 654

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 223/662 (33%), Positives = 349/662 (52%), Gaps = 81/662 (12%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ V+  + GGG    ++ DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAVDVELEGGGIRLIRVGDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  ++ + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSGNSALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL LE+ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLELPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRANLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 341 -------MISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTNDLLP 383
                    S+    N P          KT    Y  +    Q  L L+E+R + +    
Sbjct: 359 DGENLFDSASNHPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMD---- 414

Query: 384 SDDPTYSE-----DNDPVEESEATHYQLG-------------------------IACAQI 413
               TY+E     DN  +E S+    + G                          A AQ+
Sbjct: 415 ----TYAELYKKTDNIDLELSQFEQARFGNMPSESSTNNVSDGIGQASELPPLGFAIAQL 470

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECAL 472
              YI++Q  D L+++D HAA ER+ +EKM RQ   +  + SQ LL P        ECA 
Sbjct: 471 LGIYILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQHLLIPVTFAASHEECAA 530

Query: 473 IMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDR 532
           + +H E L   G++    G N +A+R  P +L K ++  L RD++ E+    ++ T+   
Sbjct: 531 LADHAETLAGFGLELSDMGGNTLAVRAAPVMLGKSDVVSLARDVLGELAQVGSSQTIASH 590

Query: 533 IENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLF 592
              ILATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF
Sbjct: 591 ENRILATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDTLF 650

Query: 593 GR 594
            R
Sbjct: 651 LR 652


>gi|262372217|ref|ZP_06065496.1| DNA mismatch repair protein MutL [Acinetobacter junii SH205]
 gi|262312242|gb|EEY93327.1| DNA mismatch repair protein MutL [Acinetobacter junii SH205]
          Length = 657

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 223/656 (33%), Positives = 350/656 (53%), Gaps = 71/656 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L   + NQIAAGE+IERPS  +KEL+ENS+DA ++ +   +A GG +  +I DNG 
Sbjct: 8   RIHTLDAALANQIAAGEVIERPSSVVKELLENSIDAGATELIIRVAQGGSTLIEIIDNGH 67

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ S+++P+AV RH TSKI  S+D   I + GFRGEAL SI AVS LTL S       G 
Sbjct: 68  GIHSDDLPLAVMRHATSKIKTSEDLHAIVSLGFRGEALASIAAVSRLTLTSSQDDQGIGY 127

Query: 120 QIAISGEKIS--SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           Q+ ++G       V+ VA   GT + V+DLFF +PAR  FLK    E   I +++RR+A+
Sbjct: 128 QVEVNGTAFDHQQVQAVAAQKGTHIRVQDLFFNVPARRKFLKKPSTEFGHIEEIVRRLAL 187

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            +  + F      + R  +    +     +R+ Q++G+ FI NA  ++ +S  + L G+ 
Sbjct: 188 THFDIRFVLEHNDNIRLNLPVADSGELRYQRVQQLLGQQFIQNAYWIDAESINMRLSGWL 247

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G P+  R  A+  YV++NGR V+DK I   +R AY   +   ++   +L LE+DP  +DV
Sbjct: 248 GHPSDARAQADLQYVYVNGRIVKDKTISHALRMAYDGILHGHQHSSYLLFLEVDPENIDV 307

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPK 357
           NVHP K  IRF N   +  F+    ++ +++   + S+ LS+ M       N      PK
Sbjct: 308 NVHPTKHEIRFLNQREVHEFVRHYAKETLSQFQ-TASADLSQAMKVEESTTNFNYQSQPK 366

Query: 358 YATSLTNTQEKLFLQENRLST-----------NDLLPS---------------DDPTYS- 390
           Y       QE+  L  N + T            DLL                  +P+Y+ 
Sbjct: 367 Y-------QEQFNLHRNHVETEFSINDQNQISTDLLTEFNQSRPQAVQYNSVPQEPSYNG 419

Query: 391 ------------------------EDNDPVE-------ESEATHYQLGIACAQIHQNYII 419
                                   ED   V+       ++    + LGIA AQ+H  YI+
Sbjct: 420 SFQLNNALKTYLAPLRDEKTSFEHEDTSSVKNGDLEGFKTRVDEFPLGIAIAQLHGIYIL 479

Query: 420 SQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI-TSQTLLTPEIIDLLEGECALIMEHDE 478
           +Q T+GL+IVD HAAHER++ ++M+  ++  +  TSQ LL P+++ +   +   I E   
Sbjct: 480 AQNTEGLIIVDMHAAHERILLQQMKSAWDKPEFWTSQQLLIPKVVSITRMQAVRIEELQS 539

Query: 479 DLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILA 538
            L RLG++  ++G   + +R +PAIL K +  +L+ ++++++  +     L  + + +LA
Sbjct: 540 QLQRLGLEINQYGDEQVIVRGVPAILQKADFDRLIPELLNDLDPNDEARGLLQKRDELLA 599

Query: 539 TMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            MAC+G++R+ R++   EMN LLR+ME+   +SQCNHGRPT+    L  ++KLF R
Sbjct: 600 GMACHGAVRAHRQLSLSEMNALLRQMEQTEFASQCNHGRPTWRAFPLHQLDKLFAR 655


>gi|207721715|ref|YP_002252154.1| DNA mismatch repair protein MutL [Ralstonia solanacearum MolK2]
 gi|206586877|emb|CAQ17462.1| dna mismatch repair protein mutl [Ralstonia solanacearum MolK2]
          Length = 644

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 210/637 (32%), Positives = 346/637 (54%), Gaps = 54/637 (8%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR L +++I+QIAAGE++ERP+  +KEL+EN+LDA +++++  +  GG     ITDNG G
Sbjct: 15  IRPLPDQLISQIAAGEVVERPASVVKELLENALDAGATQLQIKLEEGGVRRIAITDNGGG 74

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  +E+P+A+ RH TSKI   ++  ++ T GFRGEAL SI +V+ LTL SR        Q
Sbjct: 75  IPVDELPVALMRHATSKIGSLEELESVATLGFRGEALASIASVAELTLTSRTADAAHATQ 134

Query: 121 I-AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           I A SG     ++P +   GT V+V+ L+F  PAR  FLKSEQ E     +VIRR A+A 
Sbjct: 135 ILAQSGR----LQPASGGVGTTVDVQHLYFNTPARRKFLKSEQTELGHCLEVIRRTALAR 190

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V+   S   + +   ++ +   +   R + V+G +F    +   E + E+ L G+ G+
Sbjct: 191 PDVAI--SVHHNGKPLEHWNAAQAD--TRTAAVLGTEFARARLPFEEAAGELRLFGFAGL 246

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT +RG A+  + ++NGR V+D+ +   +R+AY + +   R+P  VL LE+ P  VDVNV
Sbjct: 247 PTASRGRADHQFFYVNGRFVRDRLLTHAVRSAYEDVLHGDRFPAYVLCLELPPEAVDVNV 306

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDN--------AP 351
           HP+K  +RFR+   +  F+  ++Q+A+++        L   +  +             AP
Sbjct: 307 HPSKIEVRFRDSRAVHQFVYHAVQRALSRHAGEQGDSLRTDIAEAADAPGQPGTTATPAP 366

Query: 352 KTHLPKYATSLTNTQEKLFLQENRL-------STNDLLPSDDPTY--------------- 389
             +  ++   +   Q  L + + R         ++  LPS  P +               
Sbjct: 367 ADNTTRWINQMAARQTSLGIAQPRAEYLAMMRGSSTPLPSSRPAWMADVPSTATLFDGAT 426

Query: 390 -SEDNDPVE-----------ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHER 437
            + D  PV+           +++  H  LG A AQ+H  Y+++Q   G+V+VD HAAHER
Sbjct: 427 ATTDEAPVQAPVPVAAPQTDDADDAH-PLGFAIAQLHGIYVLAQNARGMVLVDMHAAHER 485

Query: 438 LIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAI 497
           +++E+++    + ++  Q LL P  +     E     E  + L  LG       P  +A+
Sbjct: 486 ILYEQLKTALEARRVEVQPLLIPVTLAASPVEIGTAEEFRDTLTLLGFDISAVSPTTLAV 545

Query: 498 REIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEM 557
           R +P +L K +   L RD++ ++     +  L +R   +LAT+AC+ ++R+ R++   EM
Sbjct: 546 RAVPTLLQKADAQALARDVLRDLQAYGGSRVLAERQNELLATLACHSAVRANRRLNLDEM 605

Query: 558 NRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           N LLR+ME    + QCNHGRPT+I+L ++D+++LF R
Sbjct: 606 NALLRQMEATERADQCNHGRPTWIQLTVADLDRLFLR 642


>gi|88607715|ref|YP_505509.1| DNA mismatch repair protein MutL [Anaplasma phagocytophilum HZ]
 gi|123722818|sp|Q2GJE2|MUTL_ANAPZ RecName: Full=DNA mismatch repair protein mutL
 gi|88598778|gb|ABD44248.1| DNA mismatch repair protein MutL [Anaplasma phagocytophilum HZ]
          Length = 634

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 215/637 (33%), Positives = 350/637 (54%), Gaps = 47/637 (7%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I  LS + IN+IAAGE+I+ P+  +KEL+ENS+DA +  +   +  GG++   ++D+G
Sbjct: 1   MPIVVLSAQTINKIAAGEVIDCPASVVKELVENSIDAGAKTINVHVDKGGRNLISVSDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            G+  EE+  A   H TSK+ D D +N+ T GFRGE L ++ +V+ + ++S+        
Sbjct: 61  CGIACEEMEKAFIGHATSKLIDGDLANVKTMGFRGEGLTAVASVARVKMVSKHVDAERAW 120

Query: 120 QIAI-SGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            I    GEK   + P  ++ GT VEVRDLFF  P RL FL++E+ E   I D++ R+A+ 
Sbjct: 121 SITFEGGEKTRDLTPGVLSCGTHVEVRDLFFATPTRLKFLRTEKAEMQNIVDLLNRLAMI 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQV--IGEDFINNAVELNEKSNEITLQGY 236
              ++F+ + ++   +K + Q +     ER+ ++   GE F   ++E+N   + + + G+
Sbjct: 181 NYTIAFSLTIVERQIFKYSAQES---LIERLKEMRAFGEVFCEQSLEINHSIDHVRVYGH 237

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
            G+PTFN+      + F+NGR +    +L  +++AY   IP  R+PVVVL L++ P  VD
Sbjct: 238 IGLPTFNKSKPGMVHTFVNGRPIYSTLLLGAVKSAYHGLIPKDRHPVVVLALDVMPAYVD 297

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGIS--TSSVLSKKMISSFHQDNAPKTH 354
           VNVHP+K  +RF++  ++   ++ ++ +A++    +  + +  + +    F  D+  KT+
Sbjct: 298 VNVHPSKMEVRFQDKRLVYKAVLDALGEALSSNVYARFSPAATTSEGHDHFAMDSIEKTY 357

Query: 355 LPKYATSLTNTQEKLFLQENRLSTN-----------DLLPSDDPTYSEDNDPVEESEATH 403
             K+ +  T     + LQ   L+ N           D   + D  +  D+    +++ + 
Sbjct: 358 -GKFFSEDTEAASTMQLQPEVLNHNIPLLFGSSHVDDSKGTHDTRFCADHTHHNDTKGSV 416

Query: 404 YQ-------------------------LGIACAQIHQNYIISQTTDGLVIVDQHAAHERL 438
           +                          LG A  Q+ + YIIS+  D ++IVDQHAAHERL
Sbjct: 417 HTKSFSARSSSSAESKMEQGCMLEEPPLGYAVCQLFERYIISRAGDYVIIVDQHAAHERL 476

Query: 439 IFEKMRQDFNSTKITSQTLLTPEIIDLL-EGECALIMEHDEDLHRLGIKAERFGPNAIAI 497
           + E +++      I  Q LL PE I+L  E E  L+ E+ E L  LG+  E  G   + +
Sbjct: 477 VCEYIKKVTEQEGIKRQVLLMPEFIELGNEYELELLTEYREKLRDLGLIVEPMGDLTVVV 536

Query: 498 REIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEM 557
           RE+PAI    +   L+  I++ I+       ++ ++ +I  T+ACY SIRSGR M+  EM
Sbjct: 537 REVPAIFGVVDAKALISKILESIMAKGDELFVKGKLSHICGTVACYSSIRSGRIMKLEEM 596

Query: 558 NRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           N LLR ME  P+S QCNHGRPT++KLKLS+I+KLF R
Sbjct: 597 NSLLRHMESTPHSGQCNHGRPTYVKLKLSEIDKLFER 633


>gi|50085465|ref|YP_046975.1| enzyme in methyl-directed mismatch repair, stimulates binding of
           Vsr and MutS to heteroduplex DNA [Acinetobacter sp.
           ADP1]
 gi|49531441|emb|CAG69153.1| enzyme in methyl-directed mismatch repair, stimulates binding of
           Vsr and MutS to heteroduplex DNA [Acinetobacter sp.
           ADP1]
          Length = 653

 Score =  379 bits (972), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 220/646 (34%), Positives = 355/646 (54%), Gaps = 57/646 (8%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L   + NQIAAGE+IERP+  +KEL+EN++DA ++ +   +A GG +  +I DNG 
Sbjct: 10  RIHTLDPALANQIAAGEVIERPASVVKELLENAIDAGATELIIRVAQGGSTLIEIIDNGL 69

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+AV RH TSKI   +D   I + GFRGEAL SI AVS L+LMS    +  G 
Sbjct: 70  GIHPDDLPLAVMRHATSKIKTPEDLHAIVSLGFRGEALASIAAVSRLSLMSSQTDDGVGY 129

Query: 120 QIAISGEKIS--SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           Q+ ++G       ++ +A+  GT + V+DLFF +PAR  FLK    E   I +++RR+A+
Sbjct: 130 QVEVNGTAFDHQEIQAIALRKGTHIRVQDLFFNVPARRKFLKKPSTEFGHIEEIVRRLAL 189

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFP--ERISQVIGEDFINNAVELNEKSNEITLQG 235
            + ++ F      +++ K+N    +      +R+ Q++G+ F  NA  L+ +S  + L G
Sbjct: 190 THFEIRFVLE--HNDQIKLNLPIADSGVLRFQRVQQLLGQQFTQNAYWLDTESISMRLSG 247

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           + G P+  R  A+  YV++NGR V+DK I   +R AY   +   +Y   +L LE+DP QV
Sbjct: 248 WLGHPSDARSQADLQYVYVNGRIVKDKTISHALRMAYDGILHGHQYSAYLLFLEVDPDQV 307

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD---NAPK 352
           DVNVHP K  IRF N   +  F+    ++ + +   + S+ L++ M S+  +D   + PK
Sbjct: 308 DVNVHPTKHEIRFLNQREVHEFVRHHAKETLAQFQ-TASADLAQAMKSNEPKDILRDQPK 366

Query: 353 THLPKYATSLTNTQEKLFLQ---------ENRLSTNDL----------------LPSDDP 387
            H  +++   T+  E   +             LST+ L                +P  DP
Sbjct: 367 -HQEQFSLHRTDATENPVVNRAEDTQIEYRKELSTDLLTEFNASRPKTVEYSTRMPVRDP 425

Query: 388 TYSEDN-----DPVEESEAT-------------HYQLGIACAQIHQNYIISQTTDGLVIV 429
               +       P+ E   +              + LG+A AQ+H  YI++Q T+GL+IV
Sbjct: 426 VQLNNALKTYLAPLREESGSAITASSDVVSGVDEFPLGVAIAQLHGIYILAQNTEGLIIV 485

Query: 430 DQHAAHERLIFEKMRQDFNSTKIT-SQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAE 488
           D HAAHER++ ++M+  ++  +   SQ LL P+II +   + + I +    L RLG+  +
Sbjct: 486 DMHAAHERILLQQMKAAWDKPEFWISQQLLIPKIISITRMQASRIEDLKSQLLRLGLDID 545

Query: 489 RFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRS 548
           ++G     +R +PAIL K N  +L+ +++ ++  +     L  + + ILA MAC+G++R+
Sbjct: 546 QYGDEQAIVRGVPAILQKANFEKLIPELLHDLDPNDEAQALLQKRDTILAGMACHGAVRA 605

Query: 549 GRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            R +   EMN LLR+ME+   +SQCNHGRPT+    L  ++KLF R
Sbjct: 606 HRMLSLSEMNALLRQMEQTEFASQCNHGRPTWRAFPLHQLDKLFAR 651


>gi|240128296|ref|ZP_04740957.1| DNA mismatch repair protein [Neisseria gonorrhoeae SK-93-1035]
 gi|268686693|ref|ZP_06153555.1| DNA mismatch repair protein [Neisseria gonorrhoeae SK-93-1035]
 gi|268626977|gb|EEZ59377.1| DNA mismatch repair protein [Neisseria gonorrhoeae SK-93-1035]
          Length = 654

 Score =  378 bits (971), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 221/662 (33%), Positives = 349/662 (52%), Gaps = 81/662 (12%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ V+  + GGG    ++ DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAVDVELEGGGIRLIRVGDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKS+  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSKNTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS +    ERI+ ++G+DF   ++E++  ++ + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQSLH----ERIAAIVGDDFQTASLEIDSGNSALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------NKKGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                   +  G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRANLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 341 -------MISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTNDLLP 383
                    S+    N P          KT    Y  +    Q  L L+E+R + +    
Sbjct: 359 DSENLFDSASNHPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMD---- 414

Query: 384 SDDPTYSE-----DNDPVEESEATHYQLG-------------------------IACAQI 413
               TY+E     DN  +E S+    + G                          A AQ+
Sbjct: 415 ----TYAELYKKTDNIDLELSQFEQARFGNMPSESSTNNVSDGIGQASELPPLGFAIAQL 470

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECAL 472
              YI++Q  D L+++D HAA ER+ +EKM RQ   +  + SQ LL P        ECA 
Sbjct: 471 LGIYILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQHLLIPVTFAASHEECAA 530

Query: 473 IMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDR 532
           + +H E L   G++    G N +A+R  P +L K ++  L RD++ E+    ++ T+   
Sbjct: 531 LADHAETLAGFGLELSDMGGNTLAVRAAPVMLGKSDVVSLARDVLGELAQVGSSQTIASH 590

Query: 533 IENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLF 592
              ILATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF
Sbjct: 591 ENRILATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDTLF 650

Query: 593 GR 594
            R
Sbjct: 651 LR 652


>gi|299769558|ref|YP_003731584.1| DNA mismatch repair ATPase [Acinetobacter sp. DR1]
 gi|298699646|gb|ADI90211.1| DNA mismatch repair ATPase [Acinetobacter sp. DR1]
          Length = 649

 Score =  378 bits (971), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 224/643 (34%), Positives = 354/643 (55%), Gaps = 55/643 (8%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L   + NQIAAGE+IERPS  +KEL+ENS+DA ++ +   IA GG +  +I DNG 
Sbjct: 10  RIHTLDAALANQIAAGEVIERPSSVVKELLENSIDAGATELIVRIAQGGSTLIEIIDNGH 69

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ SE++ +AV RH TSKI  ++D   I + GFRGEAL SI AVS LTL S   ++  G 
Sbjct: 70  GIHSEDLALAVMRHATSKIKTAEDLHAIVSLGFRGEALASIAAVSRLTLTSSQDESGIGH 129

Query: 120 QIAISGEKIS--SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           Q+ ++G       V+ VA   GT + V+DLFF +PAR  FLK    E   I +++RR+A+
Sbjct: 130 QVEVNGTAFDHQEVQAVAAQKGTHIRVQDLFFNVPARRKFLKKPTTEFGHIEEIVRRLAL 189

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            +  + F      + R  +    +     +R+ Q++G  F+ NA  ++ +S  + L G+ 
Sbjct: 190 THFDIRFVLEHNDNIRINLPIADSGELRFQRVQQLLGSQFVQNAYWMDAESISMRLSGWL 249

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G P+  R  A+  YV++NGR V+DK I   +R AY   +   ++   +L LE+DP  +DV
Sbjct: 250 GHPSDARAQADMQYVYVNGRIVKDKTISHALRMAYDGILHGHQHSSYLLFLEVDPENIDV 309

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMIS-------------- 343
           NVHP K  IRF N   +  F+    ++ +++   +++ +     +               
Sbjct: 310 NVHPTKHEIRFLNQREVHEFVRHYAKETLSQFQTASADLAQAMKVDEQSDYSVQPQPKYQ 369

Query: 344 ---SFHQ-------DNAPKT-HLP---------------KYA--TSLTNTQEKLFLQENR 375
              S H+       D+ P+T H P                YA  T   N   +L    N 
Sbjct: 370 EQFSLHRANETLNADSEPQTQHAPTELLTDFNASRPQAVHYADQTPKYNGSAQL---NNA 426

Query: 376 LSTNDLLPSDDP-TYS--EDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQH 432
           L T      D P T+S  E+ +PV  ++   + LGIA AQ+H  YI++Q T+GL+IVD H
Sbjct: 427 LKTYLAPLRDQPATFSLNENIEPV--TKFDEFPLGIAIAQLHGIYILAQNTEGLIIVDMH 484

Query: 433 AAHERLIFEKMRQDFNSTKI-TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFG 491
           AAHER++ ++M+  ++  +  TSQ LL P++I +   +   + E    L RLG++ + +G
Sbjct: 485 AAHERILLQQMKNAWDKPEFWTSQQLLIPKVISISRMQAVRVEELKPQLERLGLEIDLYG 544

Query: 492 PNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRK 551
              + +R +PAIL K +   L+ ++++++  +     L  + + +LA MAC+G++R+ R+
Sbjct: 545 DEQVIVRGVPAILQKADFENLIPELLNDLDPNDEAQGLLQKRDELLAGMACHGAVRAHRQ 604

Query: 552 MQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +   EMN LLR+ME+   +SQCNHGRPT+    LS ++KLF R
Sbjct: 605 LSLSEMNALLRQMEQTEFASQCNHGRPTWRAFPLSQLDKLFAR 647


>gi|300703174|ref|YP_003744776.1| methyl-directed mismatch repair protein [Ralstonia solanacearum
           CFBP2957]
 gi|299070837|emb|CBJ42138.1| methyl-directed mismatch repair protein [Ralstonia solanacearum
           CFBP2957]
          Length = 644

 Score =  378 bits (971), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 208/636 (32%), Positives = 341/636 (53%), Gaps = 52/636 (8%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR L +++I+QIAAGE++ERP+  +KEL+EN+LDA +++++  +  GG     ITDNG G
Sbjct: 15  IRPLPDQLISQIAAGEVVERPASVVKELLENALDAGATQLQIKLEEGGVRRIAITDNGGG 74

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  +E+P+A+ RH TSKI   ++  ++ T GFRGEAL SI +V+ LTL SR        Q
Sbjct: 75  IPVDELPVALMRHATSKIGSLEELESVATLGFRGEALASIASVAELTLTSRTADAAHATQ 134

Query: 121 I-AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           I A SG     ++P +   GT V+V+ L+F  PAR  FLKSEQ E     +VIRR A+A 
Sbjct: 135 ILAQSGR----LQPASGGVGTTVDVQHLYFNTPARRKFLKSEQTELGHCLEVIRRTALAR 190

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V+   S   + +   ++ +   +   R + V+G +F    +   E + E+ L G+ G+
Sbjct: 191 PDVAI--SVHHNGKPLEHWNAAQAD--TRTAAVLGTEFARARLPFEEAAGELRLFGFAGL 246

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT +RG A+  + ++NGR V+D+ +   +R+AY + +   R+P  VL LE+ P  VDVNV
Sbjct: 247 PTASRGRADHQFFYVNGRFVRDRLLTHAVRSAYEDVLHGDRFPAYVLCLELPPEAVDVNV 306

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKT------ 353
           HP+K  +RFR+   +  F+  ++Q+A+++        L   +  +      P T      
Sbjct: 307 HPSKIEVRFRDSRAVHQFVYHAVQRALSRHAGEQGDSLRTDIAEAADAPGQPGTAATPTP 366

Query: 354 --HLPKYATSLTNTQEKLFLQENRL-------STNDLLPSDDPTYSED------------ 392
             +  ++   +   Q  L + + R         ++  LPS  P +  D            
Sbjct: 367 ADNTTRWINQMAARQTSLGIAQPRAEYLAMMRGSSTPLPSSRPAWMADVPSAATLFDGAA 426

Query: 393 --------------NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERL 438
                           P  +     + LG A AQ+H  Y+++Q   G+V+VD HAAHER+
Sbjct: 427 DDADEAPVQAPVPVAAPQTDDADDAHPLGFAIAQLHGIYVLAQNARGMVLVDMHAAHERI 486

Query: 439 IFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIR 498
           ++E+++    + ++  Q LL P  +     E     E  + L  LG       P  +A+R
Sbjct: 487 LYEQLKTALEARRVEVQPLLIPVTLAASPVEIGTAEEFRDTLTLLGFDISAVSPTTLAVR 546

Query: 499 EIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMN 558
            +P +L K +   L RD++ ++     +  L +R   +LAT+AC+ ++R+ R++   EMN
Sbjct: 547 AVPTLLQKADAQALARDVLRDLQAYGGSRVLAERQNELLATLACHSAVRANRRLNLDEMN 606

Query: 559 RLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            LLR+ME    + QCNHGRPT+I+L ++D+++LF R
Sbjct: 607 ALLRQMEATERADQCNHGRPTWIQLTVADLDRLFLR 642


>gi|262279503|ref|ZP_06057288.1| DNA mismatch repair ATPase [Acinetobacter calcoaceticus RUH2202]
 gi|262259854|gb|EEY78587.1| DNA mismatch repair ATPase [Acinetobacter calcoaceticus RUH2202]
          Length = 649

 Score =  378 bits (971), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 222/646 (34%), Positives = 347/646 (53%), Gaps = 61/646 (9%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L   + NQIAAGE+IERPS  +KEL+ENS+DA ++ +   IA GG +  +I DNG 
Sbjct: 10  RIHTLDAALANQIAAGEVIERPSSVVKELLENSIDAGATELIVRIAQGGSTLIEIIDNGH 69

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ SE++ +AV RH TSKI  ++D   I + GFRGEAL SI AVS LTL S   ++  G 
Sbjct: 70  GIHSEDLALAVMRHATSKIKTAEDLHAIVSLGFRGEALASIAAVSRLTLTSSQDESGIGH 129

Query: 120 QIAISGEKIS--SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           Q+ ++G       V+ VA   GT + V+DLFF +PAR  FLK    E   I +++RR+A+
Sbjct: 130 QVEVNGTAFDHQEVQAVAAQKGTHIRVQDLFFNVPARRKFLKKPTTEFGHIEEIVRRLAL 189

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            +  + F      + R  +    +     +R+ Q++G  F+ NA  ++ +S  + L G+ 
Sbjct: 190 THFDIRFVLEHNDNIRINLPIADSGELRFQRVQQLLGSQFVQNAYWMDAESISMRLSGWL 249

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G P+  R  A+  YV++NGR V+DK I   +R AY   +   ++   +L LE+DP  +DV
Sbjct: 250 GHPSDARAQADMQYVYVNGRIVKDKTISHALRMAYDGILHGHQHSSYLLFLEVDPENIDV 309

Query: 298 NVHPAKSYIRFRN-------------------------------------------PTII 314
           NVHP K  IRF N                                           P   
Sbjct: 310 NVHPTKHEIRFLNQREVHEFVRHYAKETLSQFQTASADLAQAMKVDETSDYSVQPQPKYQ 369

Query: 315 RNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA--TSLTNTQEKLFLQ 372
             F +    +A+N    + +     ++++ F   NA +     YA  T   N   +L   
Sbjct: 370 EQFALHRANEALNPDNEARAQNAPTELLTDF---NASRPQAVHYADQTPRYNGSPQL--- 423

Query: 373 ENRLSTNDLLPSDDP---TYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIV 429
            N L T      D P   + +ED +PV  ++   + LGIA AQ+H  Y+++Q T+GL+IV
Sbjct: 424 NNALKTYLAPLRDQPANFSVNEDIEPV--TKVDEFPLGIAIAQLHGIYVLAQNTEGLIIV 481

Query: 430 DQHAAHERLIFEKMRQDFNSTKI-TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAE 488
           D HAAHER++ ++M+  ++  +  TSQ LL P++I +   +   + E    L RLG++ +
Sbjct: 482 DMHAAHERILLQQMKNAWDKPEFWTSQQLLIPKVISISRMQAMRVEELKPQLERLGLEID 541

Query: 489 RFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRS 548
            +G   I +R +PAIL K +   L+ ++++++  +     L  + + +LA MAC+G++R+
Sbjct: 542 LYGDEQIIVRGVPAILQKADFENLIPELLNDLDPNDEAQGLLQKRDELLAGMACHGAVRA 601

Query: 549 GRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            R++   EMN LLR+ME+   +SQCNHGRPT+    LS ++KLF R
Sbjct: 602 HRQLSLSEMNALLRQMEQTEFASQCNHGRPTWRAFPLSQLDKLFAR 647


>gi|300690568|ref|YP_003751563.1| methyl-directed mismatch repair protein [Ralstonia solanacearum
           PSI07]
 gi|299077628|emb|CBJ50264.1| methyl-directed mismatch repair protein [Ralstonia solanacearum
           PSI07]
          Length = 637

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 208/632 (32%), Positives = 338/632 (53%), Gaps = 47/632 (7%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR L +++I+QIAAGE++ERP+  +KEL+EN+LDA +++++  +  GG     ITDNG G
Sbjct: 11  IRPLPDQLISQIAAGEVVERPASVVKELLENALDAGATQLQIKLEEGGVRRIAITDNGGG 70

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           + ++E+P+A+ RH TSKI   ++   + T GFRGEAL SI +V+ LTL SR  ++    Q
Sbjct: 71  IPADELPVALMRHATSKIGSLEELEAVATLGFRGEALASIASVAELTLTSRTARDAHATQ 130

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I     +    +P +   GT V+V+ L+F  PAR  FLK+EQ E     +VIRR A+A P
Sbjct: 131 IIA---QTGRTQPASGGIGTTVDVQHLYFNTPARRKFLKTEQTELGHCLEVIRRTALARP 187

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V+ +   +  N   +   +       R + V+G +F    +   E + E+ L G+ G+P
Sbjct: 188 DVAIS---VHHNGKPLEHWNAAQAD-ARTAAVLGTEFARARLPFEEAAGELRLFGFAGLP 243

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           T +RG A+  + ++NGR V+D+ +   +R+AY + +   R+P  VL LE+ P  VDVNVH
Sbjct: 244 TASRGRADHQFFYVNGRFVRDRLLTHAVRSAYEDVLHGDRFPAYVLCLELPPEAVDVNVH 303

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLP---- 356
           P+K  +RFR+   +  F+  ++Q+A+ +        L   +  +  Q     T  P    
Sbjct: 304 PSKIEVRFRDSRAVHQFVYHAVQRALARHAGEQGDSLRTDIADAPDQPGTAATPSPADNT 363

Query: 357 -KYATSLTNTQEKLFLQENRL-------STNDLLPSDDPTYSED---------------- 392
            ++   +   Q  L + + R          N  LPS  P +  D                
Sbjct: 364 TRWINQMAARQTSLGIAQPRAEYLAMMRGGNAPLPSSRPAWMADVPSAATLFDGTAAPAA 423

Query: 393 NDPVEES----------EATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEK 442
           + PV+ S              + LG A AQ+H  Y+++Q   G+V+VD HAAHER+++E+
Sbjct: 424 DAPVQASIPAAAPPADGSDDEHPLGFAVAQLHGIYVLAQNARGMVLVDMHAAHERILYEQ 483

Query: 443 MRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPA 502
           ++    + ++  Q LL P        E     E  + L  LG       P  +A+R +P 
Sbjct: 484 LKTALEARRVEVQPLLIPVTFAASPVEIGTAEEFRDTLTLLGFDISAVSPTTLAVRAVPT 543

Query: 503 ILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLR 562
           +L K +   L RD++ ++     +  L +R   +LAT+AC+ ++R+ R++   EMN LLR
Sbjct: 544 LLQKADAHALARDVLRDLQAYGGSRVLAERQNELLATLACHSAVRANRRLNLDEMNALLR 603

Query: 563 EMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +ME    + QCNHGRPT+I+L ++D+++LF R
Sbjct: 604 QMEATERADQCNHGRPTWIQLTVADLDRLFLR 635


>gi|332867099|ref|ZP_08437396.1| DNA mismatch repair protein [Acinetobacter baumannii 6013113]
 gi|332734292|gb|EGJ65421.1| DNA mismatch repair protein [Acinetobacter baumannii 6013113]
          Length = 650

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 219/648 (33%), Positives = 348/648 (53%), Gaps = 64/648 (9%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L   + NQIAAGE+IERPS  +KEL+ENS+DA ++ +   IA GG +  +I DNG 
Sbjct: 10  RIHTLDAALANQIAAGEVIERPSSVVKELLENSIDAGATELIVRIAQGGSTLIEIIDNGH 69

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+AV RH TSKI  ++D   I + GFRGEAL SI AVS LTL S   ++  G 
Sbjct: 70  GIHPDDLPLAVMRHATSKIKTAEDLHAIVSLGFRGEALASIAAVSRLTLTSSQDESGIGH 129

Query: 120 QIAISGEKIS--SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           Q+ ++G       V+ VA   GT + V+DLFF +PAR  FLK    E   I +++RR+A+
Sbjct: 130 QVEVNGTAFDHQQVQAVAAQKGTHIRVQDLFFNVPARRKFLKKPTTEFGHIKEIVRRLAL 189

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            +  + F      + R  +    +     +R+ Q++G+ F+ NA  ++ +S  + L G+ 
Sbjct: 190 THFDIRFVLEHNDNIRINLPIADSGELRFQRVQQLLGQQFVQNAYWIDAESINMRLSGWL 249

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G P+  R  A+  YV++NGR V+DK I   +R AY   +   ++   +L LE+DP  +DV
Sbjct: 250 GHPSDARAQADLQYVYVNGRIVKDKTISHALRMAYDGILHGHQHSSYLLFLEVDPENIDV 309

Query: 298 NVHPAKSYIRFRN-------------------------------------------PTII 314
           NVHP K  IRF N                                           P   
Sbjct: 310 NVHPTKHEIRFLNQREVHEFVRHYAKETLAQFQTASADLAQAMKADDTQASFVQSQPKYQ 369

Query: 315 RNFIIQSIQKAINKKGISTSSVL-SKKMISSFHQDNAPKTHL----PKY-ATSLTNTQEK 368
             F +    +A++     +SS   S ++++ F+       H     PKY  ++  N   K
Sbjct: 370 EQFTLHRTDQAVDTTLDKSSSYQPSTELLTDFNNSRPQAVHYAEQTPKYNGSAQLNNALK 429

Query: 369 LFLQENRLSTNDLLPSDDPT-YSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLV 427
            +L   R         D PT +S D +    ++   + LGIA AQ+H  YI++Q T+GL+
Sbjct: 430 TYLAPLR---------DQPTNFSVDENIESVAKVDEFPLGIAIAQLHGIYILAQNTEGLI 480

Query: 428 IVDQHAAHERLIFEKMRQDFNSTKI-TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIK 486
           IVD HAAHER++ ++M+  ++  +  TSQ LL P++I +   +   + +    L RLG++
Sbjct: 481 IVDMHAAHERILLQQMKNAWDKPEFWTSQQLLIPKVISISRMQAIRVEDLKPQLERLGLE 540

Query: 487 AERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSI 546
            + +G   + +R +PAIL K +   L+ ++++++  +     L  + + +LA MAC+G++
Sbjct: 541 IDLYGDEQVIVRGVPAILQKADFENLIPELLNDLDPNDEAQGLLQKRDELLAGMACHGAV 600

Query: 547 RSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           R+ R++   EMN LLR+ME+   +SQCNHGRPT+    LS ++KLF R
Sbjct: 601 RAHRQLSLSEMNALLRQMEQTEFASQCNHGRPTWRAFPLSQLDKLFAR 648


>gi|260549350|ref|ZP_05823569.1| DNA mismatch repair ATPase [Acinetobacter sp. RUH2624]
 gi|260407459|gb|EEX00933.1| DNA mismatch repair ATPase [Acinetobacter sp. RUH2624]
          Length = 651

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 217/647 (33%), Positives = 352/647 (54%), Gaps = 61/647 (9%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L   + NQIAAGE+IERPS  +KEL+ENS+DA ++ +   IA GG +  +I DNG 
Sbjct: 10  RIHTLDAALANQIAAGEVIERPSSVVKELLENSIDAGATELIVRIAQGGSTLIEIIDNGH 69

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+AV RH TSKI  ++D   I + GFRGEAL SI AVS LTL S   ++  G 
Sbjct: 70  GIHPDDLPLAVMRHATSKIKTAEDLHAIVSLGFRGEALASIAAVSRLTLTSSQDESGIGH 129

Query: 120 QIAISGEKIS--SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           Q+ ++G       V+ VA   GT + V+DLFF +PAR  FLK    E   I +++RR+A+
Sbjct: 130 QVEVNGTAFDHQQVQAVAAQKGTHIRVQDLFFNVPARRKFLKKPTTEFGHIEEIVRRLAL 189

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            +  + F      + R  +    +     +R+ Q++G+ F+ NA  ++ +S  + L G+ 
Sbjct: 190 THFDIRFVLEHNDNIRINLPIADSGELRFQRVQQLLGQQFVQNAYWIDAESINMRLSGWL 249

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G P+  R  A+  YV++NGR V+DK I   +R AY   +   ++   +L LE+DP  +DV
Sbjct: 250 GHPSDARAQADLQYVYVNGRIVKDKTISHALRMAYDGILHGHQHSSYLLFLEVDPENIDV 309

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAI------------------------------- 326
           NVHP K  IRF N   +  F+    ++ +                               
Sbjct: 310 NVHPTKHEIRFLNQREVHEFVRHYAKETLAQFQTASADLAQAMKVDDTQNLSVQPQPKYQ 369

Query: 327 -------NKKGIST------SSVLSKKMISSFHQDNAPKTHL----PKY-ATSLTNTQEK 368
                   ++ + T      SS  S ++++ F+       H     PKY  ++  N   K
Sbjct: 370 EQFTLHRTEQAVDTTLDKPNSSQPSTELLTDFNNSRPQAVHYAEQTPKYNGSAQLNNALK 429

Query: 369 LFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVI 428
            +L   R       P+ + +  E+ +PV  ++   + LGIA AQ+H  YI++Q T+GL+I
Sbjct: 430 TYLAPLRDQ-----PATNFSVDENVEPV--AKIDEFPLGIAIAQLHGIYILAQNTEGLII 482

Query: 429 VDQHAAHERLIFEKMRQDFNSTKI-TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKA 487
           VD HAAHER++ ++M+  ++  +  TSQ LL P++I +   +   + +    L RLG++ 
Sbjct: 483 VDMHAAHERILLQQMKNAWDKPEFWTSQQLLIPKVISISRMQAVRVEDLKSQLERLGLEI 542

Query: 488 ERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIR 547
           + +G   + +R +PAIL K +   L+ ++++++  +     L  + + +LA MAC+G++R
Sbjct: 543 DLYGDEQVIVRGVPAILQKADFENLIPELLNDLDPNDEAQGLLQKRDELLAGMACHGAVR 602

Query: 548 SGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           + R++   EMN LLR+ME+   +SQCNHGRPT+    LS ++KLF R
Sbjct: 603 AHRQLSLSEMNALLRQMEQTEFASQCNHGRPTWRAFPLSQLDKLFAR 649


>gi|91775737|ref|YP_545493.1| DNA mismatch repair protein MutL [Methylobacillus flagellatus KT]
 gi|91709724|gb|ABE49652.1| DNA mismatch repair protein MutL [Methylobacillus flagellatus KT]
          Length = 613

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 205/615 (33%), Positives = 337/615 (54%), Gaps = 30/615 (4%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L +++I+QIAAGE++ERP+ A+KE++ENSLDA S+ V   +  GG    ++TDNG G
Sbjct: 4   IKLLPDQLISQIAAGEVVERPASALKEILENSLDAGSTDVAVALQAGGIKQIKVTDNGGG 63

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  +E+ +A+ RH TSKI+  +D   + + GFRGEAL SI A+S   + S  P      +
Sbjct: 64  IARDELRLALTRHATSKIASLEDLECVASLGFRGEALASIAAISRTQITSYHPDERHAWR 123

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA  G  ++ + P A++ GTIV+++DL+F  PAR  FLK+E  E     +  RR+A++ P
Sbjct: 124 IASEGSFLTDIEPAALDAGTIVDIQDLYFNTPARRKFLKTENTEFGHCEEAFRRIALSCP 183

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V+     +  +  +   +   G+  +R   ++G++F   A  L+E +  + + G    P
Sbjct: 184 DVNM----LLQHNGRAVARLAAGSADKRFEDILGQEFAAEAFYLDEVAAGLRVWGMAAKP 239

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TF+R   +  YV++NGR V+DK I   IR AY + +   R+P  VL LE+DP  VDVNVH
Sbjct: 240 TFSRHARDTQYVYVNGRFVRDKLISHAIRQAYQDVLHHDRHPAFVLFLELDPALVDVNVH 299

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           P+K+ +RFR+   +  FI  ++ K++        S++    +++  +  AP    P Y  
Sbjct: 300 PSKTEVRFRDGQSVHRFIFHALHKSLATPVGLPGSLMPG--LATGEKAAAP-AQAPSYPR 356

Query: 361 SLTNTQ-----------EKLFL------QENRLSTNDLLPSDDPTYSEDNDPVEESEATH 403
             +N             + LF       Q    S +D++ +   + +       + E   
Sbjct: 357 FQSNIDLRASEASGGFYQALFGNLSQVPQRQAESADDVITAQSTSVATAMGEGGQVEVED 416

Query: 404 YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEII 463
           + LG A AQIH  YI++Q   GL++VD HAAHER+++EK++   +++++  Q LL P   
Sbjct: 417 FPLGFAVAQIHGVYILAQNKLGLIVVDMHAAHERIMYEKLKNALDASRVAMQPLLLPVSF 476

Query: 464 DLLEGECALIMEH----DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDE 519
                E A + E     +  L +LG       P  +A+R IP +L   +   L RD++ +
Sbjct: 477 QADRLEVATVEEQQALAENGLAQLGFDIAVLSPTTLAVRAIPVMLKDADAVALARDVLAD 536

Query: 520 IIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPT 579
           +     +    +R   +L TMAC+ ++R+ R +   EMN LLR+ME    S QCNHGRPT
Sbjct: 537 LRQYGASRAFTERRNALLGTMACHAAVRANRTLTIPEMNALLRDMEATERSGQCNHGRPT 596

Query: 580 FIKLKLSDIEKLFGR 594
           + ++ + +++K+F R
Sbjct: 597 WFQMTMGELDKMFMR 611


>gi|169795562|ref|YP_001713355.1| enzyme in methyl-directed mismatch repair, stimulates binding of
           Vsr and MutS to heteroduplex DNA [Acinetobacter
           baumannii AYE]
 gi|213158497|ref|YP_002319795.1| DNA mismatch repair protein MutL [Acinetobacter baumannii AB0057]
 gi|215483049|ref|YP_002325254.1| DNA mismatch repair protein MutL family protein [Acinetobacter
           baumannii AB307-0294]
 gi|301347865|ref|ZP_07228606.1| DNA mismatch repair protein MutL family protein [Acinetobacter
           baumannii AB056]
 gi|301510580|ref|ZP_07235817.1| DNA mismatch repair protein MutL family protein [Acinetobacter
           baumannii AB058]
 gi|301596368|ref|ZP_07241376.1| DNA mismatch repair protein MutL family protein [Acinetobacter
           baumannii AB059]
 gi|332850620|ref|ZP_08432867.1| DNA mismatch repair protein [Acinetobacter baumannii 6013150]
 gi|169148489|emb|CAM86355.1| enzyme in methyl-directed mismatch repair, stimulates binding of
           Vsr and MutS to heteroduplex DNA [Acinetobacter
           baumannii AYE]
 gi|213057657|gb|ACJ42559.1| DNA mismatch repair protein MutL [Acinetobacter baumannii AB0057]
 gi|213988182|gb|ACJ58481.1| DNA mismatch repair protein MutL family protein [Acinetobacter
           baumannii AB307-0294]
 gi|332730457|gb|EGJ61773.1| DNA mismatch repair protein [Acinetobacter baumannii 6013150]
          Length = 650

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 219/648 (33%), Positives = 348/648 (53%), Gaps = 64/648 (9%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L   + NQIAAGE+IERPS  +KEL+ENS+DA ++ +   IA GG +  +I DNG 
Sbjct: 10  RIHTLDAALANQIAAGEVIERPSSVVKELLENSIDAGATELIVRIAQGGSTLIEIIDNGH 69

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+AV RH TSKI  ++D   I + GFRGEAL SI AVS LTL S   ++  G 
Sbjct: 70  GIHPDDLPLAVMRHATSKIKTAEDLHAIVSLGFRGEALASIAAVSRLTLTSSQDESGIGH 129

Query: 120 QIAISGEKIS--SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           Q+ ++G       V+ VA   GT + V+DLFF +PAR  FLK    E   I +++RR+A+
Sbjct: 130 QVEVNGTAFDHQQVQAVAAQKGTHIRVQDLFFNVPARRKFLKKPTTEFGHIEEIVRRLAL 189

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            +  + F      + R  +    +     +R+ Q++G+ F+ NA  ++ +S  + L G+ 
Sbjct: 190 THFDIRFVLEHNDNIRINLPIADSGELRFQRVQQLLGQQFVQNAYWIDAESINMRLSGWL 249

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G P+  R  A+  YV++NGR V+DK I   +R AY   +   ++   +L LE+DP  +DV
Sbjct: 250 GHPSDARAQADLQYVYVNGRIVKDKTISHALRMAYDGILHGHQHSSYLLFLEVDPENIDV 309

Query: 298 NVHPAKSYIRFRN-------------------------------------------PTII 314
           NVHP K  IRF N                                           P   
Sbjct: 310 NVHPTKHEIRFLNQREVHEFVRHYAKETLAQFQTASADLAQAMKADDTQASFVQSQPKYQ 369

Query: 315 RNFIIQSIQKAINKKGISTSSVL-SKKMISSFHQDNAPKTHL----PKY-ATSLTNTQEK 368
             F +    +A++     +SS   S ++++ F+       H     PKY  ++  N   K
Sbjct: 370 EQFTLHRTDQAVDTTLDKSSSYQPSTELLTDFNNSRPQAVHYAEQTPKYNGSAQLNNALK 429

Query: 369 LFLQENRLSTNDLLPSDDPT-YSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLV 427
            +L   R         D PT +S D +    ++   + LGIA AQ+H  YI++Q T+GL+
Sbjct: 430 TYLAPLR---------DQPTNFSVDENIESVAKVDEFPLGIAIAQLHGIYILAQNTEGLI 480

Query: 428 IVDQHAAHERLIFEKMRQDFNSTKI-TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIK 486
           IVD HAAHER++ ++M+  ++  +  TSQ LL P++I +   +   + +    L RLG++
Sbjct: 481 IVDMHAAHERILLQQMKNAWDKPEFWTSQQLLIPKVISISRMQAIRVEDLKPQLERLGLE 540

Query: 487 AERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSI 546
            + +G   + +R +PAIL K +   L+ ++++++  +     L  + + +LA MAC+G++
Sbjct: 541 IDLYGDEQVIVRGVPAILQKADFENLIPELLNDLDPNDEAQGLLQKRDELLAGMACHGAV 600

Query: 547 RSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           R+ R++   EMN LLR+ME+   +SQCNHGRPT+    LS ++KLF R
Sbjct: 601 RAHRQLSLSEMNALLRQMEQTEFASQCNHGRPTWRAFPLSQLDKLFAR 648


>gi|241664014|ref|YP_002982374.1| DNA mismatch repair protein [Ralstonia pickettii 12D]
 gi|240866041|gb|ACS63702.1| DNA mismatch repair protein MutL [Ralstonia pickettii 12D]
          Length = 635

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 204/637 (32%), Positives = 341/637 (53%), Gaps = 59/637 (9%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR L +++I+QIAAGE++ERP+  +KEL+EN+LDA +++++  +  GG     ITDNG G
Sbjct: 11  IRPLPDQLISQIAAGEVVERPASVVKELLENALDAGATQLQIKLEEGGVRRIAITDNGVG 70

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120