PSIBLAST alignment of GI: 254780399 and protein with PDB id: 1b62

>gi|157838229|pdb|1B62|A Chain A, Mutl Complexed With Adp Length = 355
 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 128/348 (36%), Positives = 195/348 (56%), Gaps = 4/348 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ L  ++ NQIAAGE++ERP+  +KEL+ENSLDA ++R++  I  GG    +I DNG
Sbjct: 7   MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDIDIERGGAKLIRIRDNG 66

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  +E+ +A+ RH TSKI+  DD   I + GFRGEAL SI +VS LTL SR  +    
Sbjct: 67  CGIKKDELALALARHATSKIASLDDLEAIISLGFRGEALASISSVSRLTLTSRTAEQQEA 126

Query: 119 AQIAISGEKIS-SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
            Q    G  ++ +V+P A   GT +EV DLF+  PAR  FL++E+ E N I ++IRR+A+
Sbjct: 127 WQAYAEGRDMNVTVKPAAHPVGTTLEVLDLFYNTPARRKFLRTEKTEFNHIDEIIRRIAL 186

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           A   V+   S       +       G    R+  + G  F+  A+ +  +  ++TL+G+ 
Sbjct: 187 ARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAIEWQHGDLTLRGWV 246

Query: 238 GIPTFNRGN-ANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
             P       A   Y ++NGR ++D+ I   IR A  + +   + P  VL LEIDP QVD
Sbjct: 247 ADPNHTTPALAEIQYCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVD 306

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISS 344
           VNVHPAK  +RF    ++ +FI Q +   + ++  +   +  +   + 
Sbjct: 307 VNVHPAKHEVRFHQSRLVHDFIYQGVLSVLQQQLETPLPLDDEPQPAP 354