PSIBLAST alignment of GI: 254780399 and protein with PDB id: 1mx0

>gi|28373805|pdb|1MX0|A Chain A, Structure Of Topoisomerase Subunit Length = 472
>gi|28373806|pdb|1MX0|B Chain B, Structure Of Topoisomerase Subunit Length = 472
>gi|28373807|pdb|1MX0|C Chain C, Structure Of Topoisomerase Subunit Length = 472
>gi|28373808|pdb|1MX0|D Chain D, Structure Of Topoisomerase Subunit Length = 472
>gi|28373809|pdb|1MX0|E Chain E, Structure Of Topoisomerase Subunit Length = 472
>gi|28373810|pdb|1MX0|F Chain F, Structure Of Topoisomerase Subunit Length = 472
 Score = 55.8 bits (133), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 18/74 (24%)

Query: 22  RPSIA----IKELIENSLDAESS---------RVETVIAGGGKS--FFQITDNGFGMTSE 66
            P+ A    ++ELIENSLDA  +         ++   +    +      + DNG G+  +
Sbjct: 29  NPARALYQTVRELIENSLDA--TDVHGILPNIKITIDLIDDARQIYKVNVVDNGIGIPPQ 86

Query: 67  EIPMAVQR-HCTSK 79
           E+P A  R   +SK
Sbjct: 87  EVPNAFGRVLYSSK 100