PSIBLAST alignment of GI: 254780399 and protein with PDB id: 2zbk

gi|167745001|pdb|2ZBK|B Chain B, Crystal Structure Of An Intact Type Ii Dna Topoisomerase: Insights Into Dna Transfer Mechanisms Length = 530
>gi|167745003|pdb|2ZBK|D Chain D, Crystal Structure Of An Intact Type Ii Dna Topoisomerase: Insights Into Dna Transfer Mechanisms Length = 530
 Score = 55.8 bits (133), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 18/74 (24%)

Query: 22 RPSIA----IKELIENSLDAESS---------RVETVIAGGGKS--FFQITDNGFGMTSE 66
           P+ A    ++ELIENSLDA  +         ++   +    +      + DNG G+  +
Sbjct: 27 NPARALYQTVRELIENSLDA--TDVHGILPNIKITIDLIDDARQIYKVNVVDNGIGIPPQ 84

Query: 67 EIPMAVQR-HCTSK 79
          E+P A  R   +SK
Sbjct: 85 EVPNAFGRVLYSSK 98