PSIBLAST alignment of GI: 254780399 and protein with PDB id: 3h4l

>gi|290560158|pdb|3H4L|A Chain A, Crystal Structure Of N Terminal Domain Of A Dna Repair Prote Length = 367
>gi|290560159|pdb|3H4L|B Chain B, Crystal Structure Of N Terminal Domain Of A Dna Repair Prote Length = 367
 Score =  230 bits (587), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 85/363 (23%), Positives = 159/363 (43%), Gaps = 32/363 (8%)

Query: 1   MK-IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDN 59
           M  I ++++  +++I +G++I   + A+KEL++NS+DA ++++E +    G    + +DN
Sbjct: 3   MTQIHQINDIDVHRITSGQVITDLTTAVKELVDNSIDANANQIEIIFKDYGLESIECSDN 62

Query: 60  GFGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNT 117
           G G+          +H TSKI+   D + + T GFRGEAL S+  ++ L++++       
Sbjct: 63  GDGIDPSNYEFLALKHYTSKIAKFQDVAKVQTLGFRGEALSSLCGIAKLSVITTTSPPKA 122

Query: 118 GAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPAR-LNFLKSEQVETNLITDVIRRMA 176
                     I+S    + N GT V V  LF  +P R   F K+ + +      VI+  A
Sbjct: 123 DKLEYDMVGHITSKTTTSRNKGTTVLVSQLFHNLPVRQKEFSKTFKRQFTKCLTVIQGYA 182

Query: 177 IAYPKVSFTFSTI--KSNRYKMNFQSTNGNFPERISQVIG----------------EDFI 218
           I    + F+   I  K  +  +     N +  + IS V G                  F 
Sbjct: 183 IINAAIKFSVWNITPKGKKNLILSTMRNSSMRKNISSVFGAGGMRGLEEVDLVLDLNPFK 242

Query: 219 NNAVELNEK-------SNEITLQGYTGIPTFNR--GNANQFYVFINGRTVQDKFILSTIR 269
           N  +              +I ++GY    +F     + ++ ++++N R V+   +L    
Sbjct: 243 NRMLGKYTDDPDFLDLDYKIRVKGYISQNSFGCGRNSKDRQFIYVNKRPVEYSTLLKCCN 302

Query: 270 TAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKK 329
             Y     + ++P V L LE+    +DVNV P K  I   N   + +    ++    N++
Sbjct: 303 EVYKTFNNV-QFPAVFLNLELPMSLIDVNVTPDKRVILLHNERAVIDIFKTTLSDYYNRQ 361

Query: 330 GIS 332
            ++
Sbjct: 362 ELA 364