BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780399|ref|YP_003064812.1| DNA mismatch repair protein
[Candidatus Liberibacter asiaticus str. psy62]
         (594 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780399|ref|YP_003064812.1| DNA mismatch repair protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040076|gb|ACT56872.1| DNA mismatch repair protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 594

 Score =  627 bits (1617), Expect = e-177,   Method: Composition-based stats.
 Identities = 594/594 (100%), Positives = 594/594 (100%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG
Sbjct: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ
Sbjct: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP
Sbjct: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
           KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP
Sbjct: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH
Sbjct: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT
Sbjct: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360

Query: 361 SLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIIS 420
           SLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIIS
Sbjct: 361 SLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIIS 420

Query: 421 QTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDL 480
           QTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDL
Sbjct: 421 QTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDL 480

Query: 481 HRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATM 540
           HRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATM
Sbjct: 481 HRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATM 540

Query: 541 ACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR
Sbjct: 541 ACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594


>gi|53804020|ref|YP_114135.1| DNA mismatch repair protein [Methylococcus capsulatus str. Bath]
 gi|53757781|gb|AAU92072.1| DNA mismatch repair protein MutL [Methylococcus capsulatus str.
           Bath]
          Length = 611

 Score =  587 bits (1514), Expect = e-165,   Method: Composition-based stats.
 Identities = 217/598 (36%), Positives = 345/598 (57%), Gaps = 5/598 (0%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M+IR+L  ++INQIAAGE+IERP+  +KEL+EN+ DA + +VE  +  GG    ++ D+G
Sbjct: 13  MRIRRLPPQLINQIAAGEVIERPASVVKELVENAFDAGARQVEVDVEQGGVRLIRVRDDG 72

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  E++ +A+ RH TSKI+  +D   + + GFRGEALPSI AV+ LTL SR      G
Sbjct: 73  CGIDREDLGLALSRHATSKIASLEDLERVASMGFRGEALPSISAVARLTLTSRTADVPCG 132

Query: 119 AQIAISGEK-ISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
            Q++  G +    ++P     GT VEVRDLF+  PAR  FL++E+ E   I  +++RMA+
Sbjct: 133 WQVSADGSESDFDIQPAQHAQGTTVEVRDLFYNTPARRKFLRAEKTEFGHIQTLVQRMAL 192

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           A   V F     +    ++   +  G  PERI  + G DF+  A+ +  +++ + L G+ 
Sbjct: 193 ARFDVGFRLRHNQREVLRLQPDAEEGGRPERIGALCGPDFLEQALRVEFEASGLRLHGWV 252

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PTF+R  A+  + ++N R ++DK +   IR AY + +   R PV VL LEIDP  VDV
Sbjct: 253 GLPTFSRSQADLQFFYVNHRPIRDKLVGHAIRQAYQDVLYHQRQPVYVLYLEIDPALVDV 312

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPK 357
           N HPAK  +RFR   ++ +F+  ++ +AI       ++ +     +      A +    +
Sbjct: 313 NAHPAKLEVRFREGRMVHDFLFSALHRAIAGHRPGRTASVVAAPATEHPAPLAEQPQQSQ 372

Query: 358 YA-TSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQN 416
                +  T ++ +L      T   L     + S  N     +E     LG A A +   
Sbjct: 373 QPLFRVAETPQRPYLSSGDSETLGDLRRL-YSVSLPNPTETRAEQEIPPLGYALAHLKGV 431

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEH 476
           YI+++   GL++VD HAAHER+ +E+M++ + +  I SQ LL P  I L   +  L  E+
Sbjct: 432 YILAENAQGLILVDGHAAHERITYERMKRQYQAGGIASQPLLLPVRIRLSRADADLAEEY 491

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L RLGI+  R G  ++ +R +PA+L   ++ +L+RD + ++ +  ++  LQ+ +  +
Sbjct: 492 GEHLARLGIELRRTGEGSVLVRSVPALLEGSDVERLVRDTLADLREHGSSGRLQETLNTV 551

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LA+MAC+GS+R+GRK+   EMN LLREME    + QCNHGRPT+++L    +++LF R
Sbjct: 552 LASMACHGSVRAGRKLTVPEMNALLREMEATERAGQCNHGRPTWVQLDTQALDRLFLR 609


>gi|83648044|ref|YP_436479.1| DNA mismatch repair protein [Hahella chejuensis KCTC 2396]
 gi|83636087|gb|ABC32054.1| DNA mismatch repair enzyme (predicted ATPase) [Hahella chejuensis
           KCTC 2396]
          Length = 612

 Score =  587 bits (1514), Expect = e-165,   Method: Composition-based stats.
 Identities = 214/608 (35%), Positives = 354/608 (58%), Gaps = 15/608 (2%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI  LS ++ NQIAAGE++ERPS  +KEL+EN+LDA + ++E  I  GG    +I D+G 
Sbjct: 3   KIHLLSPRLANQIAAGEVVERPSSVVKELVENALDAGARKIEVDIENGGVKLIRIRDDGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  E++P+A+ RH TSKI   +D   + T GFRGEAL SI +VS L L SRP       
Sbjct: 63  GIPREDLPLALSRHATSKIETLEDLEAVATLGFRGEALASICSVSRLALTSRPQNQGEAW 122

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           ++ + G ++     P A  PGT VEVRDLF+  PAR  F+++E+ E   I ++I+R A+ 
Sbjct: 123 KVEVEGREMKPEISPAAHTPGTTVEVRDLFYNTPARRKFMRTEKTEFGHIEEIIKRQALG 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+FT    +   +++   ++  +   RI Q+ G +FI +A+ +N  ++ ++L G+  
Sbjct: 183 RLSVAFTLRHNQKVVHQLRPAASEEDHIRRIGQLCGANFIESAIPINVSASGLSLTGWVA 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            PTF+R  A+  Y F+NGR ++DK +   +R AY + +  GR+P  VL LE+DP  VDVN
Sbjct: 243 KPTFSRSQADLQYFFVNGRVIRDKLVAHAVRQAYQDVLYHGRHPAFVLYLELDPATVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH-------QDNAP 351
           VHP K  +RFR   ++ +F+ +S+ +A+ +     ++V +  ++           QD  P
Sbjct: 303 VHPTKHEVRFREGRMVHDFLFRSLHRALAEVKPQAAAVETLPVVEQERPVMQWPTQDALP 362

Query: 352 KTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE-----SEATHYQL 406
               P  +              +++S    L              E+      +A    L
Sbjct: 363 LRQQPAASGFSMTGNPPASAVRDQISAYGQLHDKSGLSDMFGAAPEKVLSVVDDAVEAPL 422

Query: 407 GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLL 466
           G A AQ+H  ++++Q   G+V+VD HAAHER+++E+M++  +++ +T+Q +L P  + + 
Sbjct: 423 GYAIAQLHGVFVLAQNAQGMVLVDMHAAHERIVYERMKRSLHNSGVTTQPMLVPMNLAVS 482

Query: 467 EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTT 526
             E   + E+ E L +LG++    G  +I +R++PA+L   N+  L+RD+I E+ +  +T
Sbjct: 483 RRESLAVEENAETLRQLGLEITAAGAESIIVRQVPALLRNANVEALVRDVIAELAEHGST 542

Query: 527 YTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLS 586
             +++ +  +L TMAC+G++R+ R++   EMN LLR+ME    S QCNHGRPT+++L +S
Sbjct: 543 RKVEETMNELLGTMACHGAVRANRQLTIAEMNALLRDMEDTERSGQCNHGRPTWVQLTMS 602

Query: 587 DIEKLFGR 594
           +++KLF R
Sbjct: 603 ELDKLFLR 610


>gi|327482309|gb|AEA85619.1| DNA mismatch repair protein [Pseudomonas stutzeri DSM 4166]
          Length = 625

 Score =  583 bits (1504), Expect = e-164,   Method: Composition-based stats.
 Identities = 218/618 (35%), Positives = 351/618 (56%), Gaps = 25/618 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R+E  +  GG    ++ D+G 
Sbjct: 6   RIQLLSPRLANQIAAGEVVERPASVIKELLENSLDSGAGRIEVDVEQGGVKLLRVRDDGC 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+A+ RH TSKI D  D   + + GFRGEAL SI +VS LTL SR    +   
Sbjct: 66  GIPPDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVSRLTLTSRTADASEAW 125

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G ++ +  +P A   GT VEVRDLFF  PAR  FL++E+ E + + +VI+R+A+A
Sbjct: 126 QVETEGREMEARVQPAAHPVGTSVEVRDLFFNTPARRKFLRTEKTEFDHLQEVIKRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++  + +     R++ V G  F+  A+ +  + N + L G+ G
Sbjct: 186 RFDVAFHLRHNGKGVLALHQANDDSARARRVAAVCGPAFLEQALPIEIERNGLRLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y ++NGR V+DK +   +R AY + +  GR+P  VL L++DP  VDVN
Sbjct: 246 LPTFSRSQADLQYFYVNGRMVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLDVDPAVVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      ++     S     ++      + A +
Sbjct: 306 VHPTKHEVRFRDSRMVHDFLYGTLHRALGDVRPEDQLAAPASVAPMTQVSGLAAGEFAGQ 365

Query: 353 THLPKYATSLTNTQEKLFL--------QENRLSTNDLLPSDDPTYSEDNDPVEES----- 399
           + +   A+ L   Q +           Q  R ++          Y E   P+ ES     
Sbjct: 366 SEMSLSASVLERPQGETSAWRGAGAGYQAPRPASAGYTAEAQGAYREFFTPLPESAAAPL 425

Query: 400 ---EATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQT 456
              +     LG A AQ+   YI+++   G+V+VD HAAHER+ +E+++    S  +  Q 
Sbjct: 426 PASQDDVPPLGYALAQLKGVYILAENAQGMVLVDMHAAHERITYERLKTAMASEGLRGQP 485

Query: 457 LLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDI 516
           LL PE I L + E     EH +    LG + +R GP  +AIR+IP++L +    QL+RD+
Sbjct: 486 LLVPESIALSQREADCAEEHAQWFQMLGFELQRLGPETLAIRQIPSLLKQAEATQLVRDV 545

Query: 517 IDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHG 576
           + ++++  T+  +Q  +  +LATMAC+G++R+ R++   EMN LLR+ME    S QCNHG
Sbjct: 546 LADLLEYGTSDRIQAHLNELLATMACHGAVRANRRLTLPEMNALLRDMEHTERSGQCNHG 605

Query: 577 RPTFIKLKLSDIEKLFGR 594
           RPT+ +L + D++KLF R
Sbjct: 606 RPTWTQLGMDDLDKLFLR 623


>gi|146283982|ref|YP_001174135.1| DNA mismatch repair protein [Pseudomonas stutzeri A1501]
 gi|167017345|sp|A4VQP2|MUTL_PSEU5 RecName: Full=DNA mismatch repair protein mutL
 gi|145572187|gb|ABP81293.1| DNA mismatch repair protein MutL [Pseudomonas stutzeri A1501]
          Length = 625

 Score =  583 bits (1502), Expect = e-164,   Method: Composition-based stats.
 Identities = 218/618 (35%), Positives = 350/618 (56%), Gaps = 25/618 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R+E  +  GG    ++ D+G 
Sbjct: 6   RIQLLSPRLANQIAAGEVVERPASVIKELLENSLDSGAGRIEVDVEQGGVKLLRVRDDGC 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+A+ RH TSKI D  D   + + GFRGEAL SI +VS LTL SR    +   
Sbjct: 66  GIPPDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVSRLTLTSRTADASEAW 125

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G ++ +  +P A   GT VEVRDLFF  PAR  FL++E+ E + + +VI+R+A+A
Sbjct: 126 QVETEGREMEARVQPAAHPVGTSVEVRDLFFNTPARRKFLRTEKTEFDHLQEVIKRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++  + +     R++ V G  F+  A+ +  + N + L G+ G
Sbjct: 186 RFDVAFHLRHNGKGVLALHQANDDSARARRVAAVCGPAFLEQALPIEIERNGLRLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y ++NGR V+DK +   +R AY + +  GR+P  VL L++DP  VDVN
Sbjct: 246 LPTFSRSQADLQYFYVNGRMVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLDVDPAVVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      ++     S     ++      + A +
Sbjct: 306 VHPTKHEVRFRDSRMVHDFLYGTLHRALGDVRPEDQLAAPASVAPMTQVSGLAAGEFAGQ 365

Query: 353 THLPKYATSLTNTQEK--------LFLQENRLSTNDLLPSDDPTYSEDNDPVEES----- 399
             +   A+ L   Q +           Q  R ++          Y E   P+ ES     
Sbjct: 366 NEMSLSASVLERPQGETPAWRGAGAGYQAPRPASAGYTAEAQGAYREFFTPLPESAAAPL 425

Query: 400 ---EATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQT 456
              +     LG A AQ+   YI+++   G+V+VD HAAHER+ +E+++    S  +  Q 
Sbjct: 426 PASQDDVPPLGYALAQLKGVYILAENAQGMVLVDMHAAHERITYERLKTAMASEGLRGQP 485

Query: 457 LLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDI 516
           LL PE I L + E     EH +    LG + +R GP  +AIR+IP++L +    QL+RD+
Sbjct: 486 LLVPESIALSQREADCAEEHAQWFQMLGFELQRLGPETLAIRQIPSLLKQAEATQLVRDV 545

Query: 517 IDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHG 576
           + ++++  T+  +Q  +  +LATMAC+G++R+ R++   EMN LLR+ME    S QCNHG
Sbjct: 546 LADLLEYGTSDRIQAHLNELLATMACHGAVRANRRLTLPEMNALLRDMEHTERSGQCNHG 605

Query: 577 RPTFIKLKLSDIEKLFGR 594
           RPT+ +L + D++KLF R
Sbjct: 606 RPTWTQLGMDDLDKLFLR 623


>gi|146305668|ref|YP_001186133.1| DNA mismatch repair protein [Pseudomonas mendocina ymp]
 gi|145573869|gb|ABP83401.1| DNA mismatch repair protein MutL [Pseudomonas mendocina ymp]
          Length = 623

 Score =  578 bits (1489), Expect = e-162,   Method: Composition-based stats.
 Identities = 216/619 (34%), Positives = 340/619 (54%), Gaps = 26/619 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+   KEL+ENSLD+ + R++  +  GG    ++ D+G 
Sbjct: 3   RIHLLSPRLANQIAAGEVVERPASVAKELLENSLDSGARRIDVEVEQGGVKLLKVRDDGG 62

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++++P+A+ RH TSKI +  D   + + GFRGEAL SI +VS LTL SR    +   
Sbjct: 63  GIAADDLPLALARHATSKIRELEDLEAVLSMGFRGEALASISSVSRLTLTSRTADADQAW 122

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  +    +P A   GT VEVRDLFF  PAR  FL++E+ E + + +VI+R+A+A
Sbjct: 123 QVETEGRDMQPRVQPAAHPVGTSVEVRDLFFNTPARRKFLRAEKTEFDHLQEVIKRLALA 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F         + ++      +   R++ V G  F+  A+ +  +   + L G+ G
Sbjct: 183 RFDVAFHLRHNGKTVFALHEAGDEISRARRVAAVCGPAFLEQALPIEIERGGLRLWGWVG 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y ++NGR V+DK +   +R AY + +  GR+P  VL LEIDP  VDVN
Sbjct: 243 LPTFSRSQADLQYFYVNGRMVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLEIDPSTVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMIS----------SFHQD 348
           VHP K  +RFR+  ++ +F+  ++ +A+              ++            F   
Sbjct: 303 VHPTKHEVRFRDSRMVHDFLYGTLHRALADVRPEDQVAAPAAVMPMVRATGLAAGEFGPQ 362

Query: 349 NAPKTHLPKYATSLTNTQEK-----LFLQENRLSTNDLLPSDDPTYSED--------NDP 395
                      T + N Q          Q+   S    +      Y E           P
Sbjct: 363 GEMGLAASVLETPVANPQPAWRGAGAGYQQPAGSPGVPVAEAQAAYREYFAPLPGAQPAP 422

Query: 396 VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQ 455
           + + +     LG A AQ+   YI+++   G+V+VD HAAHER+ +E+++Q   S  +  Q
Sbjct: 423 LPQEQGDIPPLGYAVAQLKGVYILAENAQGMVVVDMHAAHERITYERLKQAMASEGLRGQ 482

Query: 456 TLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRD 515
            LL PE I L + E     EH E   RLG + +R G   +AIR+IPA+L +    QL+RD
Sbjct: 483 PLLVPESIALSQREADCAEEHGEWFQRLGFELQRLGEETVAIRQIPALLKQAEATQLVRD 542

Query: 516 IIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNH 575
           ++ ++++  T+  +Q  +  +LATMAC+G++R+ R++   EMN LLR+ME+   S QCNH
Sbjct: 543 VLADLLEYGTSDRIQAHLNELLATMACHGAVRANRRLTLPEMNALLRDMEQTERSGQCNH 602

Query: 576 GRPTFIKLKLSDIEKLFGR 594
           GRPT+ +L + D++KLF R
Sbjct: 603 GRPTWTQLGMDDLDKLFLR 621


>gi|192359923|ref|YP_001983535.1| DNA mismatch repair protein [Cellvibrio japonicus Ueda107]
 gi|238692427|sp|B3PDC3|MUTL_CELJU RecName: Full=DNA mismatch repair protein mutL
 gi|190686088|gb|ACE83766.1| DNA mismatch repair protein MutL [Cellvibrio japonicus Ueda107]
          Length = 626

 Score =  577 bits (1487), Expect = e-162,   Method: Composition-based stats.
 Identities = 222/619 (35%), Positives = 333/619 (53%), Gaps = 26/619 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI+ LS ++ NQIAAGE++ERPS  IKEL+ENSLDA ++R++  I  GG    ++ DNG 
Sbjct: 6   KIKLLSPRLANQIAAGEVVERPSSVIKELLENSLDAGATRLDIEIEDGGIKLMRVRDNGG 65

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+A+ RH TSKI   DD   + T GFRGEAL SI +V+ L L+S   +++ G 
Sbjct: 66  GIDKDDLPLALSRHATSKIYELDDLEAVATLGFRGEALASISSVARLALVSSTSEDSAGW 125

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  + +   P     GT VEVRDLFF  PAR  FL+SE+ E   + DV++R+A++
Sbjct: 126 QVVAEGRDMETQISPAPHPRGTTVEVRDLFFNTPARRKFLRSEKTEYTHLEDVVKRLALS 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F         Y      +      R++QV G  F+ NAV +  +   + L G+  
Sbjct: 186 RFDVAFNLRHNGRAIYAWRAGDSQLEQERRVAQVCGPAFMENAVFIEMERGSLRLWGWVA 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            PTF+R  A+  + ++NGR ++DK +   +R AY + +  GR+P  VL LE+DP  VDVN
Sbjct: 246 QPTFSRSQADLQHFYVNGRAIRDKLVSHAVRQAYQDVLYHGRHPAFVLYLELDPSTVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RFR+   + +FI  S+  A+ K     +       +       AP    P+ 
Sbjct: 306 VHPTKHEVRFRDNRTVHDFIYSSLHHALAKVRPEDTLARKAADLGEDTPGIAPYAVSPRP 365

Query: 359 --------------ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE------ 398
                         A S   +    +       +   +     TY E     E       
Sbjct: 366 LVEGIAAGEFKGQGAMSFAPSTSGGYRPGYTSVSPGTIREQMHTYGELLASAEPVTARAL 425

Query: 399 ---SEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQ 455
                     LG A AQ+   YI+++   GL++VD HAAHER+ +E+M+  +    + +Q
Sbjct: 426 PQTPTEDIPPLGYALAQLKGIYILAENAQGLIVVDMHAAHERITYERMKAAYAHGGLQTQ 485

Query: 456 TLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRD 515
            LL PE I + E E     +  +    LG + +R GP  + IR++P IL++    QL+RD
Sbjct: 486 PLLVPESIAVSEKEADCAEQFADIFKTLGFELQRAGPETLLIRQLPVILNRAQAEQLVRD 545

Query: 516 IIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNH 575
           ++ ++I+  T+  +Q  I  ILATMAC+GS+R+ RK+   EMN LLR+ME    S QCNH
Sbjct: 546 VLSDLIEHGTSERIQHHINEILATMACHGSVRANRKLTIPEMNALLRDMEATERSGQCNH 605

Query: 576 GRPTFIKLKLSDIEKLFGR 594
           GRPT+    L +++KLF R
Sbjct: 606 GRPTWFLQSLDELDKLFMR 624


>gi|254787458|ref|YP_003074887.1| DNA mismatch repair protein [Teredinibacter turnerae T7901]
 gi|237684748|gb|ACR12012.1| DNA mismatch repair protein MutL [Teredinibacter turnerae T7901]
          Length = 613

 Score =  576 bits (1485), Expect = e-162,   Method: Composition-based stats.
 Identities = 218/609 (35%), Positives = 346/609 (56%), Gaps = 16/609 (2%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI  LS ++ NQIAAGE++ERP+  IKEL+ENSLDA +++++  +  GG    ++ DNG 
Sbjct: 3   KIFTLSPRLANQIAAGEVVERPASVIKELVENSLDAGATQLDVEVEQGGVKLIRVRDNGH 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++ E++P+A+ RH TSKI   DD   + T GFRGEAL SI +V+ L L S   +  +G 
Sbjct: 63  GISKEDLPLALSRHATSKIINLDDLEAVVTLGFRGEALASISSVARLRLTSNTGEEESGW 122

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +   G  + +   P     GT VEVRDLFF  PAR  FL++E+ E   + DV++R+A++
Sbjct: 123 CVEAEGRDMEARLAPAGHPQGTSVEVRDLFFNTPARRKFLRTERTEYGRVEDVLKRLALS 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
                F+        +     +T      R++Q+ G  F+ NAV ++     + L G+  
Sbjct: 183 RFAQGFSLKNNGRVVHSWRPATTQPEQERRVAQICGPAFMENAVHVDIDRAGLRLWGWVA 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  + ++NGR ++DK +   IR AY + +  GR+P  VL LE+DP  VDVN
Sbjct: 243 LPTFSRSQADLQHFYVNGRAIRDKLVSHAIRQAYQDVLYHGRHPAFVLYLELDPGNVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAIN--KKGISTSSVLSKKMISSFHQDNAPKTHLP 356
           VHP K  +RFR+  ++ +F+ +S+ KA+   + G   S+       +    + + + + P
Sbjct: 303 VHPTKHEVRFRDSRLVHDFLFRSLHKALADVRPGNEPSAQEDIGAEADTASELSAQQYSP 362

Query: 357 KYATSLT---NTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHY--------Q 405
                L+      E   + E   S +    S     S+       +              
Sbjct: 363 TEQPGLSFSAQRSEPSAVAERAPSWSPTYTSAGSATSKRPSMGSPASVMPPASDNETVPP 422

Query: 406 LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDL 465
           LG A AQ+   YI+++  DG+V+VD HAAHER+ +E+M++   + KI SQ LL P+ + +
Sbjct: 423 LGYAVAQLKGIYILAENADGMVVVDMHAAHERITYERMKEQQQAQKIQSQPLLVPQAMAV 482

Query: 466 LEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSST 525
            E E     E  +    LG + ER GP ++ IR++P IL++ N+ QL+RD++ ++I+  +
Sbjct: 483 SEKEADYADEFADIFVNLGFELERAGPESLLIRQLPVILNRANVEQLVRDVLSDLIEYGS 542

Query: 526 TYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKL 585
           +  +Q  I  IL TMAC+GS+R+ R++   EMN LLR+ME    S QCNHGRPT+ ++ L
Sbjct: 543 SQRIQQNINEILGTMACHGSVRANRRLNIAEMNALLRDMEATERSGQCNHGRPTWTQMSL 602

Query: 586 SDIEKLFGR 594
           ++++KLF R
Sbjct: 603 AELDKLFMR 611


>gi|23015547|ref|ZP_00055320.1| COG0323: DNA mismatch repair enzyme (predicted ATPase)
           [Magnetospirillum magnetotacticum MS-1]
          Length = 600

 Score =  576 bits (1485), Expect = e-162,   Method: Composition-based stats.
 Identities = 250/601 (41%), Positives = 372/601 (61%), Gaps = 9/601 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR L   ++NQIAAGE++ERP+ A+KEL+EN++DA ++R++ V+A GG+S   ++D+G
Sbjct: 1   MSIRLLPPTLVNQIAAGEVVERPASAVKELVENAIDAGATRIDVVLAEGGQSLIAVSDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM  +E+ +AV+RH TSK+ DD    I+  GFRGEALPSIG+V+ LTL SRP    +  
Sbjct: 61  CGMAPDEMMLAVERHATSKLPDDDLVRINFLGFRGEALPSIGSVARLTLTSRPRGAESAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            +++ G       P A   GT +EVRDLF+  PARL FLK+ + E     DVI R+ +A+
Sbjct: 121 SLSVEGGVKGRPVPAAHPFGTRIEVRDLFYATPARLKFLKAARTELAHACDVIERLGMAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPE--RISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P ++F+ S        +  +          RI+QV+G +F  NA+ L+   + + L G+ 
Sbjct: 181 PGIAFSLSDGGRKVLDLAAKRGEPEAARLARIAQVVGREFEPNALALDALRDGVRLTGWA 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PT+NR  +   Y+++NGR V+D+ ++  +R AY + +   R+PVV L L+++P QVDV
Sbjct: 241 GLPTYNRATSAAQYLYVNGRPVKDRLVIGAVRGAYQDVLARDRHPVVALFLDLEPDQVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKT---- 353
           NVHPAK+ +RFR+  ++R  I+ +I+ A+   G   SS L+   + +    + P +    
Sbjct: 301 NVHPAKAEVRFRDSGLVRGLIVGAIRHALAGAGHRASSTLTGVALGALGSPSQPPSSFFG 360

Query: 354 HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQI 413
           H P    SL   +  +  Q         L  D P  +   +   E   T Y LG A AQ+
Sbjct: 361 HHPPPRPSLPLVRAAIEAQSPFGLAEQSLSLDLPPAAPVTET--EEFTTDYPLGAAKAQL 418

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
           H  YI+++T DGLVIVDQHAAHERL+FE+++      ++  Q LL PE++DL E   A +
Sbjct: 419 HDTYIVAETKDGLVIVDQHAAHERLVFERLKLGLEDGRVARQGLLLPEVVDLGEAGAARV 478

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRI 533
            E   DL RLG+  E FGP A+ +RE+PA+L + ++  L+RD+ DE+ +   +  L++R+
Sbjct: 479 AERAPDLARLGLVVEPFGPGAVVVREVPALLGEGDVQGLVRDLADELAEWGASTALEERL 538

Query: 534 ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFG 593
            ++ ATMAC+GS+R+GR++   EMN LLR ME  P S QCNHGRPT I L L+DIEKLFG
Sbjct: 539 LHVCATMACHGSVRAGRRLGIPEMNALLRRMEATPLSGQCNHGRPTHISLSLADIEKLFG 598

Query: 594 R 594
           R
Sbjct: 599 R 599


>gi|120555682|ref|YP_960033.1| DNA mismatch repair protein [Marinobacter aquaeolei VT8]
 gi|120325531|gb|ABM19846.1| DNA mismatch repair protein MutL [Marinobacter aquaeolei VT8]
          Length = 629

 Score =  576 bits (1484), Expect = e-162,   Method: Composition-based stats.
 Identities = 220/629 (34%), Positives = 352/629 (55%), Gaps = 37/629 (5%)

Query: 1   MK-IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDN 59
           M  I+ LS ++ NQIAAGE++ERP+  +KEL+EN+LDA +SRV+  I  GG    ++ D+
Sbjct: 1   MPHIQLLSPRLANQIAAGEVVERPASVVKELVENALDAGASRVDVEIEQGGAKLIRVRDD 60

Query: 60  GFGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNT 117
           G G+   ++P+A+ RH TSKI   DD   + + GFRGEAL SI +VS LTL SR      
Sbjct: 61  GSGIEEADLPLALSRHATSKILTLDDLEAVASLGFRGEALASISSVSRLTLTSRTELQEA 120

Query: 118 GAQIAISGEKIS-SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMA 176
            A++ + G  +   + P A   GT VEVRDLFF  PAR  FL++E+ E N + + +RR A
Sbjct: 121 AARVEVEGRDMDARISPAAHPVGTTVEVRDLFFNTPARRKFLRTEKTEFNHVEECVRRQA 180

Query: 177 IAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
           +      FT    +     +    T+ +   RI  + G+ FI+NAV ++ ++  + L G+
Sbjct: 181 LGRFDTGFTLRHNQRVVQSLRPAETDLDKERRIGSLCGQQFIDNAVVIDAEATGLRLWGW 240

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
             +PTF+R  A+  Y F+NGR ++DK +   +R AY + +   R+P  VL LE+DP  VD
Sbjct: 241 VALPTFSRSQADLQYFFVNGRVIRDKLVAHAVRQAYRDVLYNNRHPAFVLYLEVDPATVD 300

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD-------- 348
           VNVHP K  +RFR+  ++ +FI +++ +A+    +     L      SF ++        
Sbjct: 301 VNVHPTKHEVRFRDGRLVHDFIFRTLHRALA--DVRPDDHLRGAAAQSFGRESAVVEPEH 358

Query: 349 -------------NAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPS----------D 385
                           ++    Y +S   + ++ +   ++++    L             
Sbjct: 359 SAGGFSAPGTSGPWPTQSRTEAYPSSPGQSPQQEWRASDQMAFYQSLNEGGGVSTPVARA 418

Query: 386 DPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQ 445
           +   +  +      +A    LG A AQ+H  YI++Q+  GL++VD HAAHER+ +E+M++
Sbjct: 419 EMPAASASVTPPRDDAEEPPLGYAIAQLHGIYILAQSRAGLIVVDMHAAHERITYERMKR 478

Query: 446 DFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILS 505
                 + SQ LL P  + + + E AL   H E+L +LG++ ER GP  +A+R+IPA+L 
Sbjct: 479 ALVEQDLKSQPLLVPLSLAVSQKEAALAESHGEELQQLGLQIERIGPETLAVRQIPALLR 538

Query: 506 KKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREME 565
             +  QL+RD++ ++I+   +  ++     +L TMAC+GS+R+ R++   EMN LLR+ME
Sbjct: 539 GADTEQLVRDVLADLIEHGQSDRVEAVTHELLGTMACHGSVRANRQLTIPEMNSLLRDME 598

Query: 566 KNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
               S QCNHGRPT+  + LS+++KLF R
Sbjct: 599 ATERSGQCNHGRPTWTLVTLSELDKLFLR 627


>gi|331005105|ref|ZP_08328508.1| DNA mismatch repair protein MutL [gamma proteobacterium IMCC1989]
 gi|330421074|gb|EGG95337.1| DNA mismatch repair protein MutL [gamma proteobacterium IMCC1989]
          Length = 619

 Score =  575 bits (1483), Expect = e-162,   Method: Composition-based stats.
 Identities = 215/617 (34%), Positives = 341/617 (55%), Gaps = 26/617 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI+ L  ++ NQIAAGE++ERP+  IKE++ENSLDA +SR++  I  GG    +I DNG 
Sbjct: 3   KIKLLPPRLANQIAAGEVVERPASVIKEMLENSLDAGASRIDIDIENGGIKTMRIRDNGH 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++ +A+ RH TSKI   DD   + T GFRGEAL S+ +VS LTL S    +  G 
Sbjct: 63  GIDQDDLALALSRHATSKIYVLDDLEAVGTLGFRGEALASVSSVSRLTLTSSVNDSAQGW 122

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
                G+++S+   P     GT VEVRDLFF  PAR  FL++E+ E N I +V++R+A+A
Sbjct: 123 AAKAEGQEMSTELTPAPHQQGTTVEVRDLFFNTPARRKFLRTEKTEFNRIEEVVKRLALA 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F     +   + +   ++      R++Q+ G  F+ NA+ ++ + + + L G+  
Sbjct: 183 NFDVTFELRHNQRTIHSLRAGTSEAEKNRRVAQICGPAFMENALTVDIERSGLRLWGWVA 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  + ++NGR ++D+ +   ++ AY++ +  GR+P  VL LEIDP  VDVN
Sbjct: 243 LPTFSRSQADLQHFYVNGRAIKDRLVSHAVKQAYSDVLYHGRHPAFVLYLEIDPATVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGI---------------------STSSVL 337
           VHP K  +RFR+   + +FI  S+  A+                             +++
Sbjct: 303 VHPTKHEVRFRDGRNVHSFIYSSLHHALADVRPDDQLTTASSLAVAAGIGTDASQQQTIV 362

Query: 338 SKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVE 397
            ++ +S            P  A S             ++   + L       S   +   
Sbjct: 363 DQQSMSLAASTLVNTAGNPSPAYSSAPHYPPTDTDTPQI--REALNFYGQAASLSPESAT 420

Query: 398 ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTL 457
           E+      LG A AQ+   YI+S+   GL++VD HAAHER+++E+M+  F+   + +Q L
Sbjct: 421 ETSHEVPPLGYAIAQLKGIYILSENAQGLIVVDMHAAHERVVYERMKSAFDQGNVQAQPL 480

Query: 458 LTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDII 517
           L P+ + + E E A I  H E   +LG   E  GP ++ IR+IP  L   N+ QL+RD++
Sbjct: 481 LVPQTLAVSEKEVACIESHQEVFQQLGFVVETAGPESLLIRQIPVSLKNANVEQLVRDVL 540

Query: 518 DEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGR 577
            ++I   ++  ++  I  +L+TMAC+GS+R+ R +   EMN LLR+ME    S QCNHGR
Sbjct: 541 SDLIQYGSSDRIKQHINELLSTMACHGSVRANRTLSVPEMNALLRDMEATERSGQCNHGR 600

Query: 578 PTFIKLKLSDIEKLFGR 594
           PT++   L++I+K F R
Sbjct: 601 PTWMHFSLAEIDKWFMR 617


>gi|119474825|ref|ZP_01615178.1| DNA mismatch repair protein [marine gamma proteobacterium HTCC2143]
 gi|119451028|gb|EAW32261.1| DNA mismatch repair protein [marine gamma proteobacterium HTCC2143]
          Length = 617

 Score =  575 bits (1482), Expect = e-162,   Method: Composition-based stats.
 Identities = 214/613 (34%), Positives = 341/613 (55%), Gaps = 20/613 (3%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I++LS ++ NQIAAGE++ERP+  IKEL+ENS+DA +SR++  I  GG    ++ DNG 
Sbjct: 3   QIKRLSPRLANQIAAGEVVERPASVIKELVENSMDAGASRIDIDIEAGGVKLMRVRDNGV 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  E++P+A+ RH TSKI   DD  N+ T GFRGEAL SI +VS LT+MS   +   G 
Sbjct: 63  GIEQEDMPLALSRHATSKIIELDDLENVRTLGFRGEALASISSVSRLTIMSNTEEQGAGW 122

Query: 120 QIAISGEKI-SSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           +    G  +   V P     GT VEVRDLFF  PAR  FL++E+ E N + +V++R +++
Sbjct: 123 KAQTEGRDMGVEVSPTPHLRGTSVEVRDLFFNTPARRKFLRTEKTEFNHLEEVVKRQSLS 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V F  +      + +   ++      R++ V G  F+ NA+ ++ ++  + L G+  
Sbjct: 183 RFDVGFYLNHNGRAIHALKPCASQLERERRVASVCGPAFMQNALHIDTEAAGLKLWGWVA 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  ++  + F+NGR ++DK +   +R AY + +  GR+P  VL LE++P  VDVN
Sbjct: 243 LPTFSRSQSDLQHFFVNGRVIRDKLVTHAVRQAYRDVLFHGRHPAFVLYLEVNPSIVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINK--------KGISTSSVLSKKMISSFHQDNA 350
           VHP K  +RFR+   + +F+ +S+ + + +             S+   +  I++      
Sbjct: 303 VHPTKHEVRFRDGRTVHDFLFRSLHRLLAEVRPEDQLAPASINSAEGQQGGIAAGEFQQQ 362

Query: 351 PKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYS---------EDNDPVEESEA 401
                    T     Q     +E     + L    +   S                + + 
Sbjct: 363 QTIAWRADTTPQRPGQSPASFREQAAGYSALYGRGENVGSHGRSAGALGSGATMAPQEDG 422

Query: 402 THYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPE 461
               LG A AQ+   YI+++   GLV+VD HAAHER+ +E+M+       I SQ LL PE
Sbjct: 423 EVPPLGYAIAQLKGIYILAEGEHGLVLVDMHAAHERITYERMKTARQGVGIQSQPLLVPE 482

Query: 462 IIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEII 521
            + + + E     E       LG+  ER GP ++ +REIP IL   N+ QL+RD++ ++I
Sbjct: 483 SMAVSQREADCAEESSNVFRDLGVGIERAGPESLVVREIPVILQDSNVEQLVRDVLSDLI 542

Query: 522 DSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFI 581
           +  ++  ++  I+ IL+TMAC+GS+R+ R++   EMN LLR+ME+   S QCNHGRPT+ 
Sbjct: 543 EHGSSDRIEAHIDEILSTMACHGSVRANRRLTIPEMNALLRDMEETERSGQCNHGRPTWT 602

Query: 582 KLKLSDIEKLFGR 594
           +L L ++++LF R
Sbjct: 603 QLSLDELDRLFMR 615


>gi|330501621|ref|YP_004378490.1| DNA mismatch repair protein [Pseudomonas mendocina NK-01]
 gi|328915907|gb|AEB56738.1| DNA mismatch repair protein [Pseudomonas mendocina NK-01]
          Length = 623

 Score =  575 bits (1481), Expect = e-161,   Method: Composition-based stats.
 Identities = 209/619 (33%), Positives = 337/619 (54%), Gaps = 26/619 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+   KEL+ENSLD+ + R++  +  GG    ++ D+G 
Sbjct: 3   RIHLLSPRLANQIAAGEVVERPASVAKELLENSLDSGARRIDVEVEQGGVKLLKVRDDGG 62

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ + ++P+A+ RH TSKI +  D   + + GFRGEAL SI +VS LTL SR    +   
Sbjct: 63  GIAAGDLPLALARHATSKIRELEDLEAVLSMGFRGEALASISSVSRLTLTSRTADADQAW 122

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  +    +P A   GT VEVRDLFF  PAR  FL++E+ E + + +VI+R+A+A
Sbjct: 123 QVETEGRDMEPRVQPAAHPVGTSVEVRDLFFNTPARRKFLRAEKTEFDHLQEVIKRLALA 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V F         + ++  +   +   R++ V G  F+  A+ +  +   + L G+ G
Sbjct: 183 RFDVGFHLRHNGKTVFSLHEAADEISRARRVASVCGPAFLEQALPIEIERGGLRLWGWVG 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y ++NGR V+DK +   +R AY + +  GR+P  VL LEIDP  VDVN
Sbjct: 243 LPTFSRSQADLQYFYVNGRMVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLEIDPATVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ----------- 347
           VHP K  +RFR+  ++ +F+  ++ +A+              +                 
Sbjct: 303 VHPTKHEVRFRDSRMVHDFLYGTLHRALADVRPEDQVAAPAAVSPMLRPTGLAAGEFGPQ 362

Query: 348 ----------DNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTY--SEDNDP 395
                     +       P +  +    Q+ +       +       +  +   +     
Sbjct: 363 GEMGLAASVLETPVAIPQPAWRGAGAGYQQPVGNPGVPAAEAQAAYREYFSPLPTAQAQS 422

Query: 396 VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQ 455
           V + +     LG A AQ+   YI+++   G+V+VD HAAHER+ +E+++Q   S  +  Q
Sbjct: 423 VPQEQGDIPPLGYAVAQLKGVYILAENAQGMVVVDMHAAHERITYERLKQAMASEGLRGQ 482

Query: 456 TLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRD 515
            LL PE I L + E     EH E   RLG + +R G  ++AIR+IPA+L +    QL+RD
Sbjct: 483 PLLVPESIALSQREADCAEEHGEWFQRLGFELQRLGEESVAIRQIPALLKQAEATQLVRD 542

Query: 516 IIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNH 575
           ++ ++++  T+  +Q  +  +LATMAC+G++R+ R++   EMN LLR+ME+   S QCNH
Sbjct: 543 VLADLLEYGTSDRIQAHLNELLATMACHGAVRANRRLTIPEMNGLLRDMEQTERSGQCNH 602

Query: 576 GRPTFIKLKLSDIEKLFGR 594
           GRPT+ +L +  ++KLF R
Sbjct: 603 GRPTWTQLSMDQLDKLFMR 621


>gi|154250749|ref|YP_001411573.1| DNA mismatch repair protein [Parvibaculum lavamentivorans DS-1]
 gi|154154699|gb|ABS61916.1| DNA mismatch repair protein MutL [Parvibaculum lavamentivorans
           DS-1]
          Length = 602

 Score =  574 bits (1480), Expect = e-161,   Method: Composition-based stats.
 Identities = 245/601 (40%), Positives = 392/601 (65%), Gaps = 10/601 (1%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR+LSE  IN+IAAGE++ERP+ A+KEL+EN+LDA +  ++ VI GGG+   ++TD+G 
Sbjct: 3   RIRRLSEGTINRIAAGEVVERPASAVKELVENALDAGARHIDIVIDGGGRDLIRVTDDGI 62

Query: 62  GMTSEEIPMAVQRHCTSKIS------DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQN 115
           GM +EE+ +AV+RH TSK+       +D  +I T GFRGEALPSIGAV+ L+++SR    
Sbjct: 63  GMNAEELALAVERHATSKLRIDAGGQEDLHDIATLGFRGEALPSIGAVARLSIVSRTRDA 122

Query: 116 NTGAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRM 175
           ++  +I++ G +++ V P +   GT +EVRDLF+  PARL F+KSE+ ET  ++DV++R+
Sbjct: 123 DSAERISVEGGRVTDVEPASGRAGTQIEVRDLFYATPARLKFMKSERAETLAVSDVVKRL 182

Query: 176 AIAYPKVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQ 234
           A+A+P+V FT ++ + N  ++  +   +     R+  ++G DF  NA+ ++    EI L 
Sbjct: 183 AMAHPEVGFTLTSAERNLLRLEPELPGDAGRLMRLGAIMGRDFAENAIAIDAMREEIGLA 242

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           G+ G+PT+NRG A   Y+F+NGR V+DK ++  +R AYA+ +   R+P V L + IDPR 
Sbjct: 243 GFAGLPTYNRGTAQMQYLFVNGRPVRDKLLVGAVRGAYADFLARDRHPAVALFVTIDPRD 302

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAK+ +RFR+  ++R  I+ ++++A+ + G   S+ ++   + +   + A  + 
Sbjct: 303 VDVNVHPAKAEVRFRDAGLVRGLIVGALKRALAEAGHRASTTVAGATLDALRPEMAAAS- 361

Query: 355 LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESE-ATHYQLGIACAQI 413
            P Y  +        F +E              +   +  P   +E A  + LG+A  Q+
Sbjct: 362 -PAYTGTWRPEPRPGFAEERGAWQGAFAGLAAQSARVEPLPESGAETAAGFALGVARGQL 420

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
           H+ Y+I+QT DG+VIVDQHAAHERL++E+M++   +  ++ Q LL PE+++L E E   +
Sbjct: 421 HETYVIAQTADGIVIVDQHAAHERLVYERMKKAMAAQGVSRQMLLIPEVVELDEAEAERL 480

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRI 533
                +L  LG   E FG  A+ +RE+P+I  K ++  L+RD+ D++ +     +L++++
Sbjct: 481 AARVGELAELGFVLEAFGTGAVVVREVPSIFGKLDVQALVRDLADDLTELDEALSLKEKL 540

Query: 534 ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFG 593
           E +  T+AC+GS+R+GR++ + EMN LLREME  P+S QCNHGRPT+++LKLSDIE+LFG
Sbjct: 541 EEVCGTIACHGSVRAGRRLTAEEMNALLREMEATPHSGQCNHGRPTYVELKLSDIERLFG 600

Query: 594 R 594
           R
Sbjct: 601 R 601


>gi|89094654|ref|ZP_01167591.1| DNA mismatch repair protein [Oceanospirillum sp. MED92]
 gi|89081124|gb|EAR60359.1| DNA mismatch repair protein [Oceanospirillum sp. MED92]
          Length = 627

 Score =  574 bits (1479), Expect = e-161,   Method: Composition-based stats.
 Identities = 214/623 (34%), Positives = 349/623 (56%), Gaps = 30/623 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKE++ENSLDA +++V+  +  GG    +I DNGF
Sbjct: 3   RIHLLSPRLANQIAAGEVVERPASVIKEILENSLDAGANKVDVDVEQGGVKLMRIRDNGF 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+A+ RH TSKI+  +D   + + GFRGEAL SI +VS LTL SR    +   
Sbjct: 63  GIEKDDLPLALSRHATSKITLLEDLEAVGSLGFRGEALASISSVSRLTLTSRQADQDNAW 122

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  + +   P A   GT VEV+DLFF  PAR  FLK+E+ E   + +V++R+A++
Sbjct: 123 QVQTEGRDMEAQLEPAAHPTGTTVEVKDLFFNTPARRKFLKTEKTEFRHLDEVVKRLALS 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNE--KSNEITLQGY 236
              V+F         ++++   +      R++ + G  FI+NAV+ +   +++ + L G+
Sbjct: 183 RFDVAFQLRHNGKVIHQLHQADSELEQERRVASICGSAFIDNAVKADVIAEASGLRLWGW 242

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
            G+PTF+R  A+  Y F+NGR ++DK +   +R AYA+ +  GR+P  VL LE+DP  VD
Sbjct: 243 VGLPTFSRSQADLQYFFVNGRMIRDKVVTHAVRQAYADVLYHGRHPAYVLYLELDPALVD 302

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLP 356
           VNVHP K  +RFR   ++ +F+ +++ + I            ++  +S +     +    
Sbjct: 303 VNVHPTKHEVRFRESRLVHDFLFRTLHRLIADMRPQDQMASPEQAEASVNLQPQVQPVQQ 362

Query: 357 KYATSLTNTQEKLFLQEN-------------------------RLSTNDLLPSDDPTYSE 391
            Y  +         +  N                         ++S    L       S 
Sbjct: 363 NYEQNRIAFSSAQNVSGNAGFNSSVRGGGYTPPSAPSGGQIREQISGYAALHPQSDVQSV 422

Query: 392 DNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK 451
            ++  E+   T   +G A AQ+H  YI+++   GLV+VD HAAHER+++E+M+Q +    
Sbjct: 423 SDNTAEQGSETCPPMGYAIAQLHGVYILAENEQGLVVVDMHAAHERIVYERMKQSYEQDV 482

Query: 452 ITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQ 511
           + SQ LL P  + +   E     E  E   RLG +  R G   + +R++P  L+K N+ Q
Sbjct: 483 VRSQPLLVPLSLAVSAREADCAEEQAETFKRLGFELARMGEETLVVRQVPVSLAKGNVEQ 542

Query: 512 LLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSS 571
           L+RD++ +++    +  ++  I  +LATMAC+G++R+ R++   EMN LLR+ME+   S 
Sbjct: 543 LIRDVLSDMLVYGESKRVEQHINELLATMACHGAVRANRQLTIPEMNALLRDMEQTERSG 602

Query: 572 QCNHGRPTFIKLKLSDIEKLFGR 594
           QCNHGRPT+ ++ +SD++KLF R
Sbjct: 603 QCNHGRPTWSQMSMSDLDKLFMR 625


>gi|319787568|ref|YP_004147043.1| DNA mismatch repair protein MutL [Pseudoxanthomonas suwonensis
           11-1]
 gi|317466080|gb|ADV27812.1| DNA mismatch repair protein MutL [Pseudoxanthomonas suwonensis
           11-1]
          Length = 617

 Score =  573 bits (1478), Expect = e-161,   Method: Composition-based stats.
 Identities = 214/617 (34%), Positives = 346/617 (56%), Gaps = 25/617 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR L + +INQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    +I D+G
Sbjct: 1   MPIRPLPDTLINQIAAGEVVERPASVVKELVENALDAGATRVDIDLEEGGIRLIRIRDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  EE+P+A+ RH TSKI+  DD   + T GFRGEALPSI +VS   L SRP     G
Sbjct: 61  GGIPPEELPLAISRHATSKIASLDDLEAVATLGFRGEALPSIASVSRFMLASRPRDAEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           A + + G ++  + P A  PGT VEVR+LF+ +PAR  FL++E+ E   I + +R +A+A
Sbjct: 121 AALHVDGGRVGEIVPKAHAPGTTVEVRELFYNVPARRKFLRAERTELGHIEEWLRSLALA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P V    S       +      + +   R+ + +GEDF  +A+ ++     + L G+  
Sbjct: 181 RPDVELRVSHNGKPSRRYRA--GDLDAAARLGETLGEDFARSALRIDHSGAGLRLHGWIA 238

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P ++R +A+Q Y+++NGR V+D+ +   ++ AY + +  GR P  VL LE+DP +VDVN
Sbjct: 239 QPHYSRASADQQYLYVNGRAVRDRSVAHAVKLAYQDVLYHGRQPAYVLFLELDPTRVDVN 298

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINK---------------------KGISTSSVL 337
           VHPAK  +RFR+  +I +F+ +++Q+A+ +                        S S+  
Sbjct: 299 VHPAKHEVRFRDARLIHDFVFRTLQEALAQTRAGVETGVAASAMPGQAPMGWQPSASAAP 358

Query: 338 SKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVE 397
           S     +  +   P T  P+      +     +        N    S  P     +  + 
Sbjct: 359 SPLDNGAGARPFVPWTPAPQPLGLRVDEAAGAYAALYGEPGNSSGASAMPVLPRQDMALP 418

Query: 398 ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTL 457
           E++     LG A AQ+H  YI+++  +GLV+VD HAAHER+ +E+++   +   + +Q L
Sbjct: 419 EAQGEVPPLGYAIAQLHGIYILAENAEGLVVVDMHAAHERIGYERLKTAHDGIGLRAQPL 478

Query: 458 LTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDII 517
           L P  + + E +  +     E L +LG +  R GP  +A+R +PA+L+  +   LLRD++
Sbjct: 479 LVPLSLAVGERDADVAERESETLVQLGFEVTRSGPQTLAVRSVPALLAHADPEALLRDVL 538

Query: 518 DEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGR 577
            ++ +   T  +    + +L+TMAC+G++R+ R++   EMN LLR+ME    S QCNHGR
Sbjct: 539 ADLREHGATRRVAAARDELLSTMACHGAVRANRRLTIPEMNALLRDMEATERSGQCNHGR 598

Query: 578 PTFIKLKLSDIEKLFGR 594
           PT+ +  L +I++ F R
Sbjct: 599 PTWARFSLGEIDRWFLR 615


>gi|254281638|ref|ZP_04956606.1| DNA mismatch repair protein MutL [gamma proteobacterium NOR51-B]
 gi|219677841|gb|EED34190.1| DNA mismatch repair protein MutL [gamma proteobacterium NOR51-B]
          Length = 605

 Score =  572 bits (1474), Expect = e-161,   Method: Composition-based stats.
 Identities = 213/601 (35%), Positives = 342/601 (56%), Gaps = 8/601 (1%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR L  +I NQIAAGE+++RP+  +KE +ENSLDA + R++  I  GG    ++ D+G 
Sbjct: 3   RIRSLDPRIANQIAAGEVVDRPASVVKEALENSLDAGARRIDIDIEAGGSQLIRVRDDGL 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQN-NTG 118
           G+  +++ +A++RH TSKIS  +D   + T GFRGEAL SI +VS +TL S    + + G
Sbjct: 63  GIGRDDLTLALERHATSKISTIEDLEAVATLGFRGEALASIASVSRMTLTSNASDSVSDG 122

Query: 119 AQIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
                 G  +S   RP     GT +EVRDLF+  PAR  FL++E+ E   I +V+RR A+
Sbjct: 123 CCAVAEGRDMSVTLRPAPHPRGTSLEVRDLFYNTPARRKFLRTEKTEFGHIDEVVRRQAL 182

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           +   VSFT          +     +G    R+S V GE F+   V +  ++  + LQG+ 
Sbjct: 183 SRSDVSFTLRHNNKVVRSLPAADDDGLLLRRLSGVCGEAFMAQCVSIEREAGALMLQGWV 242

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PTF+R  A+  Y F+NGR ++DK +   I+ AY + +  GR+P  VL L + P +VDV
Sbjct: 243 GLPTFSRSQADLQYFFVNGRVIRDKLVSHAIKQAYRDVLFHGRHPAYVLFLSLPPARVDV 302

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMI-SSFHQDNAPKTHLP 356
           NVHP K  +RFR+   + +F+  ++ +A+       S+      I ++     AP+    
Sbjct: 303 NVHPTKHEVRFRDGREVHSFLFSTLHRALADIRPGESAPSVAPDIVAALSSGAAPQQAAM 362

Query: 357 KYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEES---EATHYQLGIACAQI 413
              T      E +  Q++ LS     P            + E    E     LG A AQ+
Sbjct: 363 HIPTPAAVDPELVAAQQSALSALYARPMPAADRGALPSSIAEPDSGEEEVPPLGFALAQL 422

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
              YI+++   G+V+VD HAAHER+ +E+++Q    + I  Q LL P+ + +   E  ++
Sbjct: 423 SGVYILAENAHGMVLVDMHAAHERITYERLKQRSADSGIRRQPLLVPQTLAVSPREARMV 482

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRI 533
            EH   L  +G+  +  G   + +RE+PA+L+  N+ QL+RD++ ++++  ++  ++   
Sbjct: 483 AEHQALLLEMGLVIDGVGEEQVVLRELPAVLAGSNVDQLVRDVLSDLVEYGSSERIRGHF 542

Query: 534 ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFG 593
           +++L+TMAC+GSIR+ R++   EMN LLR+ME    S QCNHGRPT+++L L++++KLF 
Sbjct: 543 DDVLSTMACHGSIRANRRLTITEMNALLRDMEHTERSGQCNHGRPTWVQLTLAELDKLFL 602

Query: 594 R 594
           R
Sbjct: 603 R 603


>gi|254448141|ref|ZP_05061604.1| 2-polyprenylphenol 6-hydroxylase [gamma proteobacterium HTCC5015]
 gi|198262267|gb|EDY86549.1| 2-polyprenylphenol 6-hydroxylase [gamma proteobacterium HTCC5015]
          Length = 615

 Score =  571 bits (1473), Expect = e-161,   Method: Composition-based stats.
 Identities = 204/614 (33%), Positives = 344/614 (56%), Gaps = 21/614 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M+I++L  K+INQIAAGE+IERP+  +KEL+ENS+DA ++ V   +  GG    +I DNG
Sbjct: 1   MRIQRLPNKLINQIAAGEVIERPASVVKELLENSIDAGATEVHIDLEQGGLKRIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            GM  EEIPMA++RH TSKI   +D  ++ + GFRGEALPS+ +VSHLT+ S       G
Sbjct: 61  CGMNREEIPMALERHATSKIGSLEDLESVRSMGFRGEALPSMASVSHLTVTSCAEGEEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
             ++    +  +++P A + GT +E+RDLFF +PAR  F+++E+ E      +++R+A+ 
Sbjct: 121 WCVSPET-EGGAMKPAAHSQGTTIELRDLFFNVPARRKFMRTERTEYKHTETLVKRIALG 179

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P +  T         ++          +R++++ G  F+   + +  ++  + LQG+ G
Sbjct: 180 APYLGLTLRHNGKVTCQLRPAGNRAEMEKRVAELCGSAFMEQCLYVEHEAAGLKLQGWVG 239

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y ++NGR V+DK +   ++  Y + +  GR+P  VL LE+DP+ VDVN
Sbjct: 240 LPTFSRSQADLQYFYVNGRIVRDKLVTHAVKQGYQDVLYHGRHPAYVLHLELDPKLVDVN 299

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAIN-------KKGISTSSVLSKKMISSFH---QD 348
            HP K  +RFR+  ++ +F+ +++ + +        + G +    + +    +       
Sbjct: 300 AHPTKYEVRFRDGQLVHSFLFRTLHQVLADTRAGSYEGGAAQRDDIHRAGQGAEQGGLDA 359

Query: 349 NAPKTHLPKYATSLTNTQE--------KLFLQENRLSTNDLLPSDDPTYSEDNDPVEESE 400
            + +  +P   +                   +   +  + + P    T S  N  V    
Sbjct: 360 FSTQAAMPLRVSDGEMASNAGLGAGAIPSDSRNGSVGGSVIPPEYYRTASSPNPDVVAET 419

Query: 401 ATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTP 460
              + LG A AQ+H  Y+++Q   GL+IVD HAAHER+ +EK++  +    I +Q LL P
Sbjct: 420 EQQHPLGYALAQLHGLYVLAQNQSGLIIVDTHAAHERVTYEKLKAAYEQQGIQTQPLLVP 479

Query: 461 EIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEI 520
             I++ E E  +  EH  +  +LG +  R  P A+ IR++P +L++ +   L+RD++ ++
Sbjct: 480 VSINVSEAEADMAEEHAAEFLKLGFELSRSAPEALRIRQVPVLLNQADAEALVRDVLSDL 539

Query: 521 IDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTF 580
                +  +++ +  +L+TMAC+GS+R+ R +   EMN LLREME    S QCNHGRPT+
Sbjct: 540 TAHGHSERIREALNEVLSTMACHGSVRANRLLTLPEMNALLREMEATERSGQCNHGRPTW 599

Query: 581 IKLKLSDIEKLFGR 594
            +L +  ++KLF R
Sbjct: 600 TQLTVDQLDKLFMR 613


>gi|83313515|ref|YP_423779.1| DNA mismatch repair protein [Magnetospirillum magneticum AMB-1]
 gi|123767885|sp|Q2VYV5|MUTL_MAGMM RecName: Full=DNA mismatch repair protein mutL
 gi|82948356|dbj|BAE53220.1| DNA mismatch repair enzyme [Magnetospirillum magneticum AMB-1]
          Length = 607

 Score =  571 bits (1472), Expect = e-160,   Method: Composition-based stats.
 Identities = 253/608 (41%), Positives = 371/608 (61%), Gaps = 16/608 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR L   ++NQIAAGE++ERP+ A+KEL+EN++DA +SR++ V+A GG+S   ++D+G
Sbjct: 1   MSIRLLPPTLVNQIAAGEVVERPASAVKELVENAIDAGASRIDVVLAEGGQSLIAVSDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM+ +E+ +AV+RH TSK+ DD    I   GFRGEALPSIG+V+ LTL SRP   ++  
Sbjct: 61  CGMSPDEMMLAVERHATSKLPDDDLVRIRFLGFRGEALPSIGSVARLTLTSRPRGADSAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            +++ G       P A   GT +EVRDLF+  PARL FLK+ + E     DVI R+ +A+
Sbjct: 121 SLSVEGGAKGRPVPAAHPQGTRIEVRDLFYATPARLKFLKAARTELTHAADVIERLGMAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTN--GNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P ++F+ S        +  +          RI+QV+G +F  NA+ L+ + + + L G+ 
Sbjct: 181 PDIAFSLSDGGRKVLDLAAKRGEPGAALLSRIAQVVGREFEPNALALDAERDGVRLTGWA 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PT+NR  +   Y+F+NGR V+D+ ++  +R AY + +   R+PVV L LE+DP QVDV
Sbjct: 241 GLPTYNRATSAAQYLFVNGRPVKDRLVIGAVRGAYQDVLARDRHPVVALFLELDPDQVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSF-----HQDNAPK 352
           NVHPAK+ +RFR+  ++R  I+ +I+ A+   G   SS L+   + +      +      
Sbjct: 301 NVHPAKAEVRFRDSGLVRGLIVGAIRHALAGAGHRASSTLTGVALGALGGGGGNSPPPSF 360

Query: 353 THLPKYATSLT------NTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQL 406
            H P    SL         Q  L L E  L  +    +          P E S    Y L
Sbjct: 361 AHYPPPRPSLPLIRAGIGAQAPLGLAEQGLGLHLPPAAPVAPPEAREGPGEAS--VDYPL 418

Query: 407 GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLL 466
           G A AQ+H  YI+++T DGLVIVDQHAAHERL+FE+++      ++  Q LL PE++DL 
Sbjct: 419 GAAKAQLHDTYIVAETADGLVIVDQHAAHERLVFERLKLGLTEGQVARQGLLLPEVVDLG 478

Query: 467 EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTT 526
           +   A + E   DL RLG+  + FGP A+ +RE+PA+L   ++  L+RD+ DE+ +   +
Sbjct: 479 DAGAARVTERAGDLARLGLVIDSFGPGAVVVREVPALLGDDDVQGLVRDLADELAEWGAS 538

Query: 527 YTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLS 586
             L++R+ +I ATMAC+GS+R+GR++   EMN LLR ME  P S QCNHGRPT + L L+
Sbjct: 539 TVLEERLLHICATMACHGSVRAGRRLSVPEMNALLRRMEATPLSGQCNHGRPTHVSLSLN 598

Query: 587 DIEKLFGR 594
           DIEKLFGR
Sbjct: 599 DIEKLFGR 606


>gi|260432213|ref|ZP_05786184.1| DNA mismatch repair protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416041|gb|EEX09300.1| DNA mismatch repair protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 618

 Score =  570 bits (1469), Expect = e-160,   Method: Composition-based stats.
 Identities = 259/604 (42%), Positives = 390/604 (64%), Gaps = 13/604 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+EN++DA ++R+   IA GGK+  ++TD+G G
Sbjct: 15  IRQLDEAAINRIAAGEVVERPASAVKELVENAIDAGATRIAIDIADGGKTLIRVTDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           +  E++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR P     AQI
Sbjct: 75  IAPEDLPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLTITSRAPGAE-AAQI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            ++G K+  V+P A+  GT+VE+RDLF+  PARL F+++++ E   I+D ++R+A+A P 
Sbjct: 134 RVAGGKMEPVKPAALRAGTVVELRDLFYATPARLKFMRTDRAEAQAISDTVKRLAMAEPS 193

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           ++FT    S     R        NG+  +    R+++++G +F  NA+ ++     I L 
Sbjct: 194 ITFTLRDVSGGGEGRVVFRADRENGDLFDALHARLARILGREFAENALRIDATREGIRLY 253

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   ++F+NGR V+DK +   +R AY + +   R+P   L ++ +P  
Sbjct: 254 GYAALPTYSRGAAVAQFLFVNGRPVRDKMLTGALRAAYFDFLSRDRHPAAALFIDCEPTL 313

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR+P + R  I+ S++ A+ + G   S+ ++   + +   + AP   
Sbjct: 314 VDVNVHPAKSEVRFRDPGVARGLIVSSLRHALAEAGHRASTTVANATLGAMRPEPAPVAP 373

Query: 355 LPKYATSLTNTQEKLFLQENRLS-TNDLLPSDDPTYSED---NDPVEESEATHYQLGIAC 410
              Y     +   +    + +     DL  +   +  E        +++   H  LG A 
Sbjct: 374 ARVYQMDRPSPAARAMAYQAQAPGFADLANAYSGSVVEPVAEPAQPDQTPPEHLPLGAAR 433

Query: 411 AQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGEC 470
            Q+H+NYII+QT DG+VIVDQHAAHERL++EK+++      + +Q LL PEI++L EG+C
Sbjct: 434 GQVHENYIIAQTADGMVIVDQHAAHERLVYEKLKKQMAENGVAAQALLIPEIVELSEGDC 493

Query: 471 ALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQ 530
           A ++   +DL RLG+  E FG  A+A+RE PAIL + N   ++ DI+DE+ D   + T+Q
Sbjct: 494 ARLIAVADDLSRLGLTIEPFGGGAVAVRETPAILGEVNARAMILDILDELADQGESQTVQ 553

Query: 531 DRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEK 590
            RIE IL+ +AC+GS+RSGR+M++ EMN LLREME  P+S QCNHGRPT+++LKLSDIE+
Sbjct: 554 ARIEAILSRVACHGSVRSGRRMRAEEMNALLREMEATPHSGQCNHGRPTYVELKLSDIER 613

Query: 591 LFGR 594
           LFGR
Sbjct: 614 LFGR 617


>gi|90022314|ref|YP_528141.1| DNA mismatch repair protein [Saccharophagus degradans 2-40]
 gi|89951914|gb|ABD81929.1| DNA mismatch repair protein MutL [Saccharophagus degradans 2-40]
          Length = 630

 Score =  570 bits (1469), Expect = e-160,   Method: Composition-based stats.
 Identities = 219/628 (34%), Positives = 348/628 (55%), Gaps = 34/628 (5%)

Query: 1   MK-IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDN 59
           M  I+KLS ++ NQIAAGE++ERP+  IKEL+ENS+DA + +++  I  GG    ++ DN
Sbjct: 1   MPEIKKLSPRLANQIAAGEVVERPASVIKELVENSVDAGAKQLDVEIENGGVKLMRVRDN 60

Query: 60  GFGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNT 117
           G G+   ++P+A+ RH TSKI   DD   + T GFRGEAL SI +V+ L L S   Q +T
Sbjct: 61  GCGIGKNDLPLALSRHATSKIYHLDDLEAVGTLGFRGEALASISSVARLKLTSNDGQQDT 120

Query: 118 GAQIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMA 176
                  G  + +   P A   GT VEVRDLFF  PAR  FL++E+ E + I D+++R+A
Sbjct: 121 AWCAQAEGRDMEAELSPAAHPQGTTVEVRDLFFNTPARRKFLRTEKTEYSRIEDILKRIA 180

Query: 177 IAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
           ++  ++ F+        +     ++      R++Q+ G  F+ NAV ++     + L G+
Sbjct: 181 LSRFELGFSLKNNGKVVHNWRPANSLAEQERRVAQICGPAFMENAVHVDINRTGLRLWGW 240

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
             +PTF+R  A+  + ++NGR ++D+ +   ++ AY + +  GR+P  VL LE+DP  VD
Sbjct: 241 VALPTFSRSQADLQHFYVNGRAIKDRLVAHAVKQAYQDVLYHGRHPAYVLYLELDPANVD 300

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMIS------------- 343
           VNVHP K  +RFR+  ++ +F+  S+ KA+     S    ++ +  S             
Sbjct: 301 VNVHPTKHEVRFRDGRLVHDFLFSSLHKALADVRPSAEQPVTYQQPSIASLSQQQPVQSA 360

Query: 344 ---------------SFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPT 388
                          S+H  +           ++ N  E++    N  S      +   T
Sbjct: 361 LGLAGTSNAASNGAGSYHSSSTANYSTAYSPANVGNVSEQITQYANLTSPTGSPSNLQYT 420

Query: 389 YSEDN--DPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQD 446
            S     + ++E  A    LG A AQ+   YI+++  +GL++VD HAAHER+ +E+++Q 
Sbjct: 421 NSSQTPVNNLQEDNAEIPPLGYAIAQLKGIYILAENANGLIVVDMHAAHERITYERLKQQ 480

Query: 447 FNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSK 506
           F+  ++ SQ LL P  + + E E AL  E      RLG   E  GP  I IR++P IL++
Sbjct: 481 FDHEQLASQPLLVPLSMAVSEKEAALAEESASLFARLGFTVETAGPETILIRQVPVILNR 540

Query: 507 KNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEK 566
             +  L+RD++ ++I+  T+  ++  I  IL+TMAC+GS+R+ RK+   EMN LLR+ME 
Sbjct: 541 ATVEDLVRDVLADVIEYGTSSRIEHNINEILSTMACHGSVRANRKLTIPEMNSLLRDMEA 600

Query: 567 NPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
              S QCNHGRPT+ ++ L+ ++KLF R
Sbjct: 601 TERSGQCNHGRPTWSQMTLAQLDKLFMR 628


>gi|110632802|ref|YP_673010.1| DNA mismatch repair protein [Mesorhizobium sp. BNC1]
 gi|123162815|sp|Q11L80|MUTL_MESSB RecName: Full=DNA mismatch repair protein mutL
 gi|110283786|gb|ABG61845.1| DNA mismatch repair protein MutL [Chelativorans sp. BNC1]
          Length = 620

 Score =  570 bits (1468), Expect = e-160,   Method: Composition-based stats.
 Identities = 276/619 (44%), Positives = 391/619 (63%), Gaps = 25/619 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR L++ IINQIAAGE+IERP+  +KEL+EN+LDA + R+E   AGGG +  ++ D+G
Sbjct: 1   MPIRALADIIINQIAAGEVIERPASVVKELVENALDAGAKRIEVATAGGGLNLIRVIDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+  EE+P+AV RHCTSK++ D  +I T GFRGEALPSIG+V  LTL SR P  + GA+
Sbjct: 61  GGIPPEELPLAVARHCTSKLTSDIHDIRTLGFRGEALPSIGSVGRLTLRSRTPDADGGAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I + G K S+V+PVA N GT VEVRDLFF  PARL F+KSE+ E   IT+V++R+A+A+P
Sbjct: 121 ITVDGGKASAVKPVAANRGTTVEVRDLFFATPARLKFMKSERAEAAAITEVVKRIALAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGN-FPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            V F  S       ++   S +G+    R+ Q+IG+DF  NA+ ++ +   + L GY  I
Sbjct: 181 AVRFMLSGTDRTSTELPAVSADGDGLLRRLGQIIGKDFAENALPIDAEREGVFLTGYASI 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+F RGNA   + ++NGR V+DK I   IR AY + +P  R+ V  L + +DP  VDVNV
Sbjct: 241 PSFTRGNALAQFAYVNGRPVRDKLIAGAIRGAYMDALPRDRHAVTALFISLDPALVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPK------- 352
           HPAK+ +RFR+P ++R  I+ +I++A+   G+  ++  +  M+ +F     P        
Sbjct: 301 HPAKADVRFRDPGLVRGLIVGAIRQALEGAGVRAATTGAAAMLQAFRVPEGPSRANGAND 360

Query: 353 --------THLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE------ 398
                   T  P+   S+  +  +        + N    +    +   +    +      
Sbjct: 361 FTGRPFSGTERPRGGWSMELSPSRPLEDAFPPAANGFAEAQQVVFDIGSVVSADARAGTL 420

Query: 399 ---SEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQ 455
              S+     LG A AQ+H+NYI++QT D LVIVDQHAAHERL++E ++   +S  + SQ
Sbjct: 421 EALSDLVGRPLGAARAQVHENYIVAQTEDSLVIVDQHAAHERLVYEALKDAIHSKPLPSQ 480

Query: 456 TLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRD 515
            LL PEI+DL E +   +  H E L RLG   ERFGP AI +RE P++L + +I  L+RD
Sbjct: 481 MLLMPEIVDLPEEDAERLCAHAEFLARLGFGVERFGPGAICVRETPSMLGEVDIAALIRD 540

Query: 516 IIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNH 575
           + DEI D+ T  +L+ RI++I ATMAC+GSIRSGR+++  EMN LLR+ME  P S  CNH
Sbjct: 541 LADEIADNDTANSLKKRIDHIAATMACHGSIRSGRRLKPEEMNALLRQMEATPGSGTCNH 600

Query: 576 GRPTFIKLKLSDIEKLFGR 594
           GRPT+I+LKL+DIE+LFGR
Sbjct: 601 GRPTYIELKLADIERLFGR 619


>gi|116250684|ref|YP_766522.1| DNA mismatch repair protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|123384931|sp|Q1MKU7|MUTL_RHIL3 RecName: Full=DNA mismatch repair protein mutL
 gi|115255332|emb|CAK06407.1| putative DNA mismatch repair protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 600

 Score =  569 bits (1467), Expect = e-160,   Method: Composition-based stats.
 Identities = 301/601 (50%), Positives = 412/601 (68%), Gaps = 9/601 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+LSE +INQIAAGE+IERP+ A KELIEN+LDA ++R+E   +GGGK+  +++DNG
Sbjct: 1   MAIRQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIATSGGGKALLRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM + ++ +AV+RHCTSKIS+   +I T GFRGEALPSIG+V+ L++ SR   +  G +
Sbjct: 61  SGMDAADLELAVRRHCTSKISETLEDIRTLGFRGEALPSIGSVARLSIASRRRDSAGGHE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA++G KI+ +RP A NPGTIVEVRDLFF  PARL FLK+E+ E   IT++++RMAIA+P
Sbjct: 121 IAVAGGKIAHLRPAAANPGTIVEVRDLFFATPARLKFLKTEKAEAGAITEIVKRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V F  S   S+R  + F +T  +   R++QV+G++F +NA+ L+    EI L G+ G+P
Sbjct: 181 AVRFVLS--GSDRTTLEFPATGDDHLGRMAQVLGKEFRDNAIALDAVREEIALTGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+   Y F+NGR VQDK ILS IR AYAETIP GRYPV VL + +DP  VDVNVH
Sbjct: 239 TFNRGNSAHQYAFVNGRPVQDKLILSAIRGAYAETIPSGRYPVAVLSITLDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           PAKS +RFR+P ++R  I+ +I++A+ + G   ++  +  M+ SF     P +  P+ A 
Sbjct: 299 PAKSDVRFRDPGLVRGLIVGAIREALARDGSRAATTGASDMLRSFRPGFPPNSQRPQTAW 358

Query: 361 SLTNTQEKL------FLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQL-GIACAQI 413
           S   +  +       F +  + S + L         + +     +E       G A AQI
Sbjct: 359 SAETSSSRPYQPATGFGERPQASFDGLSMPTARAEPQFSPQPAAAEPNARYPLGAARAQI 418

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
           H NYI++QT DGLVIVDQHAAHERL+FE MR+  +S ++ SQ LL PEI+D+ E +C  +
Sbjct: 419 HANYIVAQTEDGLVIVDQHAAHERLVFEAMRKALHSKRLASQVLLIPEIVDIPEEDCDRL 478

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRI 533
           M+H  +L  LG+  ERFGP AIA+RE PA+L + +   L+R + DEI +  T   L  ++
Sbjct: 479 MQHAAELSELGLAIERFGPGAIAVRETPAMLGEVDAHGLIRQLADEIAEWDTASGLSAKL 538

Query: 534 ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFG 593
           E + ATMAC+GS+RSGR+++  EMN LLREME  P S QCNHGRPT+I+LKLSDIE+LFG
Sbjct: 539 EYVAATMACHGSVRSGRRLRPEEMNALLREMEVTPGSGQCNHGRPTYIELKLSDIERLFG 598

Query: 594 R 594
           R
Sbjct: 599 R 599


>gi|241203286|ref|YP_002974382.1| DNA mismatch repair protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240857176|gb|ACS54843.1| DNA mismatch repair protein MutL [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 600

 Score =  569 bits (1467), Expect = e-160,   Method: Composition-based stats.
 Identities = 301/601 (50%), Positives = 412/601 (68%), Gaps = 9/601 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+LSE +INQIAAGE+IERP+ A KELIEN+LDA ++R+E   +GGGK+  +++DNG
Sbjct: 1   MAIRQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIATSGGGKALLRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM + ++ +AV+RHCTSKIS+   +I T GFRGEALPSIG+V+ L++ SR   +  G +
Sbjct: 61  SGMDAADLELAVRRHCTSKISETLEDIRTLGFRGEALPSIGSVARLSIASRRRDSTGGHE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA++G KI+ +RP A NPGTIVEVRDLFF  PARL FLK+E+ E   IT++++RMAIA+P
Sbjct: 121 IAVAGGKIAHMRPAAANPGTIVEVRDLFFATPARLKFLKTEKAEAGAITEIVKRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V F  S   S+R  + F +T  +   R++QV+G++F +NA+ L+    EI L G+ G+P
Sbjct: 181 AVRFVLS--GSDRTTLEFPATGDDHLARMAQVLGKEFRDNAIALDAVREEIALTGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+   Y F+NGR VQDK ILS IR AYAETIP GRYPV VL + +DP  VDVNVH
Sbjct: 239 TFNRGNSAHQYAFVNGRPVQDKLILSAIRGAYAETIPSGRYPVAVLAITLDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           PAKS +RFR+P+++R  I+ +I++A+ + G   ++  +  M+ SF     P    P+ A 
Sbjct: 299 PAKSDVRFRDPSLVRGLIVGAIREALARDGSRAATTGASDMLRSFRPGFQPNNQRPQTAW 358

Query: 361 SLTNTQEKL------FLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQL-GIACAQI 413
           S   +  +       F +  + S + L         + +     +E       G A AQI
Sbjct: 359 SAETSPSQPYQPATGFGERPQASFDGLSMPTARAEPQFSPQPAVAEPNTRYPLGAARAQI 418

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
           H NYI++QT DGLVIVDQHAAHERL+FE MR+  +S ++ SQ LL PEI+D+ E +C  +
Sbjct: 419 HANYIVAQTEDGLVIVDQHAAHERLVFEAMRKALHSKRLASQVLLIPEIVDIPEEDCDRL 478

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRI 533
           M+H  +L  LG+  ERFGP AIA+RE PA+L + +   L+R + DEI +  T   L  ++
Sbjct: 479 MQHAAELSELGLAIERFGPGAIAVRETPAMLGEVDAHGLIRQLADEIAEWDTASGLSAKL 538

Query: 534 ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFG 593
           E + ATMAC+GS+RSGR+++  EMN LLREME  P S QCNHGRPT+I+LKLSDIE+LFG
Sbjct: 539 EYVAATMACHGSVRSGRRLRPEEMNALLREMEVTPGSGQCNHGRPTYIELKLSDIERLFG 598

Query: 594 R 594
           R
Sbjct: 599 R 599


>gi|149377526|ref|ZP_01895267.1| DNA mismatch repair protein MutL [Marinobacter algicola DG893]
 gi|149358218|gb|EDM46699.1| DNA mismatch repair protein MutL [Marinobacter algicola DG893]
          Length = 636

 Score =  569 bits (1466), Expect = e-160,   Method: Composition-based stats.
 Identities = 215/634 (33%), Positives = 349/634 (55%), Gaps = 40/634 (6%)

Query: 1   MK-IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDN 59
           M  IR L+ ++ NQIAAGE++ERP+  +KEL+EN+LDA + RV+  +  GG    ++ D+
Sbjct: 1   MPSIRLLTPRLANQIAAGEVVERPASVVKELVENALDAGARRVDIEVEQGGVKLIRVRDD 60

Query: 60  GFGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNT 117
           G G+   ++P+A+ RH TSKI   +D   + + GFRGEAL SI +VS L L SR  +   
Sbjct: 61  GMGIDETDLPLALSRHATSKIENLEDLEAVASLGFRGEALASISSVSRLALTSRTERQEA 120

Query: 118 GAQIAISGEKIS-SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMA 176
            +++ + G  +  S+ P A   GT VEVRDLFF  PAR  FL++E+ E N + + IRR A
Sbjct: 121 ASRVEVEGRDMDASISPAAHPVGTTVEVRDLFFNTPARRKFLRTEKTEFNHVEECIRRQA 180

Query: 177 IAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
           ++     FT    +     +       +   RI  + G+ FI+NAV ++ ++  + L G+
Sbjct: 181 LSRFDTGFTLRHNQRVVQSLRPAENPLDRERRIGSLCGQQFIDNAVVIDAEATGLKLWGW 240

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
             +PTF+R  A+  Y F+NGR ++D+ +   +R AY + +   R+P  VL LE+DP  VD
Sbjct: 241 VALPTFSRSQADLQYFFVNGRVIRDRLVAHAVRQAYRDVLYNNRHPAFVLYLEVDPANVD 300

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINK--------------KGISTSSVLSKKMI 342
           VNVHP K  +RFR+  ++ +FI +++ KA+                 G    +      +
Sbjct: 301 VNVHPTKHEVRFRDGRLVHDFIFRTLHKALADVRPDDHLKGAVAQSHGREAGTATGGFGV 360

Query: 343 SSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSED---------- 392
            +       +     +A S  ++    F    R S ++    D   + +           
Sbjct: 361 QAAMPGVNHQPASEPFADSGGSSPHAGFSGAPRPSQHEWQARDQMAFYQSLNGGGGTGAQ 420

Query: 393 ------------NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIF 440
                            +  +    LG A AQ+H  YI++Q+  G+++VD HAAHER+ +
Sbjct: 421 PAMADSGDLAVAAPTPPQDSSDEPPLGYAIAQLHGIYILAQSRQGMIVVDMHAAHERITY 480

Query: 441 EKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREI 500
           E+M++   +  + SQ LL P  + + + E AL   H E+L +LG++ ER GP  +A+R++
Sbjct: 481 ERMKRALEAQDLKSQPLLVPVSLAVSQKEAALAETHSEELLQLGLRVERIGPETLAVRQV 540

Query: 501 PAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRL 560
           PA+L   +  QL+RD++ ++I++  +  ++  I  +L TMAC+GS+R+ R++   EMN L
Sbjct: 541 PALLRGADTEQLVRDVLSDLIENGESDRVEAVIHELLGTMACHGSVRANRQLTIPEMNTL 600

Query: 561 LREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LR+ME    S QCNHGRPT+  + LS+++KLF R
Sbjct: 601 LRDMEATERSGQCNHGRPTWTVVTLSELDKLFLR 634


>gi|229588073|ref|YP_002870192.1| DNA mismatch repair protein [Pseudomonas fluorescens SBW25]
 gi|259511148|sp|C3KDW1|MUTL_PSEFS RecName: Full=DNA mismatch repair protein mutL
 gi|229359939|emb|CAY46793.1| DNA mismatch repair protein [Pseudomonas fluorescens SBW25]
          Length = 633

 Score =  569 bits (1466), Expect = e-160,   Method: Composition-based stats.
 Identities = 213/628 (33%), Positives = 346/628 (55%), Gaps = 37/628 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENS+D+ + R++  +  GG    ++ D+G 
Sbjct: 6   RIELLSPRLANQIAAGEVVERPASVIKELLENSIDSGAKRIDVDVEQGGVKLLRVRDDGS 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 66  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 125

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++   +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+R+A+A
Sbjct: 126 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 186 RFDVAFHLRHNGKTILSLHEAHDDAARARRVSAICGAGFLEQALPIEIERNGLRLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 246 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPSVVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKT----- 353
           VHP K  +RFR+  ++ +F+  ++ + +    +     LS  ++++  + + P+      
Sbjct: 306 VHPTKHEVRFRDGRMVHDFLYGTLHRTLG--DVRPDDQLSAPIVTAVVRPSGPEAGEFGP 363

Query: 354 -----------HLPKYATSLT----------------NTQEKLFLQENRLSTNDLLPSDD 386
                        P+   S T                  Q  + + E + +  +      
Sbjct: 364 QGEMSLAANLLQSPQPQPSYTAPGSGSGAGYQYQYTPRPQSAVPVAEAQAAYREFFAPLP 423

Query: 387 PTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQD 446
                    + E       LG A AQ+   YI+++   GLV+VD HAAHER+++E+++  
Sbjct: 424 GAEPGAPVALPEGGGDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIA 483

Query: 447 FNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSK 506
             S  ++ Q LL PE + + + E     EH     +LG + +R GP  +AIR+IPA+L +
Sbjct: 484 MASEGLSGQPLLVPESLAVSQREADCAEEHHSVFQKLGFELQRLGPETLAIRQIPALLKQ 543

Query: 507 KNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEK 566
               +L+ D++ ++++  T+  +Q  I  +L TMAC+G+IR+ R++   EMN LLR+ME 
Sbjct: 544 AEANRLVADVLADLMEYGTSDRIQAHINELLGTMACHGAIRANRRLALPEMNGLLRDMEN 603

Query: 567 NPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
              S QCNHGRPT+ ++ L D++KLF R
Sbjct: 604 TERSGQCNHGRPTWTQMGLDDLDKLFLR 631


>gi|220934074|ref|YP_002512973.1| DNA mismatch repair protein MutL [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995384|gb|ACL71986.1| DNA mismatch repair protein MutL [Thioalkalivibrio sp. HL-EbGR7]
          Length = 611

 Score =  569 bits (1466), Expect = e-160,   Method: Composition-based stats.
 Identities = 204/595 (34%), Positives = 340/595 (57%), Gaps = 7/595 (1%)

Query: 7   SEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTSE 66
             ++INQIAAGE++ERP+  +KEL+ENSLDA + R++  +  GG    +I D+G G+  +
Sbjct: 15  PPQLINQIAAGEVVERPASVVKELLENSLDAGARRIQVDVEQGGVRRIRIRDDGTGIPPD 74

Query: 67  EIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAIS 124
           E+ +A+ RH TSKI+  +D   + + GFRGEALPSI +VS LTL S  P+ ++G  I   
Sbjct: 75  ELSLALSRHATSKIASLEDLERVASLGFRGEALPSIASVSRLTLTSATPEADSGWTIQGD 134

Query: 125 G-EKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVS 183
           G ++  +  P A   GT V+V+DLFF +PAR  FL++E+ E   + +V+RR+A++   V 
Sbjct: 135 GGDRFEAPMPAAHPQGTTVDVKDLFFNVPARRKFLRAERTEFGHLEEVVRRIALSRFGVG 194

Query: 184 FTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFN 243
           F  +  +    ++   S      +R++ + GE F   AV ++ ++  + L G+ G+PT++
Sbjct: 195 FELTHNQKPGLRLPPASDEAGQLDRVAAICGEAFATQAVRIDHEAAGLRLSGWLGLPTYS 254

Query: 244 RGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAK 303
           R  A+  Y ++NGR V+D+ I   +R AY + +  GR+P  VL LE+DP  VDVN HPAK
Sbjct: 255 RSQADLQYFYVNGRMVRDRLISHAVRQAYQDVLFHGRHPAFVLYLELDPALVDVNAHPAK 314

Query: 304 SYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLT 363
             +RFR   ++ +F+ +S+ + + +     +   ++            +           
Sbjct: 315 HEVRFRESRLVHDFLFRSLHRVLAELRPGQAVAPARLETPGREPAAESRAGGDWGGAGWR 374

Query: 364 NTQEKLFLQ-ENRLSTNDLLPSDDPTYSEDNDPV---EESEATHYQLGIACAQIHQNYII 419
            +Q  L L+    + T   L +     +    PV   E        LG A AQ+H  YI+
Sbjct: 375 PSQSGLGLRVAEVMETYASLHTPAAPAAMPMSPVMAFERQAEELPPLGYALAQLHGVYIL 434

Query: 420 SQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDED 479
           +Q  +GLV+VD HAAHER+ +E++++ +    + SQ LL P  +++   E   +    E 
Sbjct: 435 AQNAEGLVLVDMHAAHERITYERLKRGYWGEGLKSQPLLVPATLNVSAREADRVETDAEA 494

Query: 480 LHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILAT 539
             R G + ER GP  + +R +P +L++ +   L+RD++ +++    +  +++ +  +LA 
Sbjct: 495 FSRFGFELERIGPEQLRVRAVPTLLARADTETLVRDVLADLLAHGESSRVEETVNELLAG 554

Query: 540 MACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           MAC+GS+R+ R++   EMN LLR+ME    S QCNHGRPT+++L +  ++KLF R
Sbjct: 555 MACHGSVRANRQLTVPEMNALLRDMEATERSGQCNHGRPTWVQLSMGQLDKLFMR 609


>gi|152988751|ref|YP_001350994.1| DNA mismatch repair protein [Pseudomonas aeruginosa PA7]
 gi|166232101|sp|A6VD59|MUTL_PSEA7 RecName: Full=DNA mismatch repair protein mutL
 gi|150963909|gb|ABR85934.1| DNA mismatch repair protein MutL [Pseudomonas aeruginosa PA7]
          Length = 633

 Score =  568 bits (1464), Expect = e-160,   Method: Composition-based stats.
 Identities = 210/628 (33%), Positives = 334/628 (53%), Gaps = 37/628 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLDA + R++  +  GG    ++ D+G 
Sbjct: 6   RIQLLSPRLANQIAAGEVVERPASVAKELLENSLDAGARRIDVEVEQGGVKLLRVRDDGR 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++++P+A+ RH TSKI +  D   + + GFRGEAL SI +V+ LT+ SR        
Sbjct: 66  GIPADDLPLALARHATSKIRELEDLERVMSLGFRGEALASISSVARLTMTSRTADAGEAW 125

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  +    +P A   GT VEVRDLFF  PAR  FL++E+ E + + +VI+R+A+A
Sbjct: 126 QVETEGRDMQPRVQPAAHPVGTSVEVRDLFFNTPARRKFLRAEKTEFDHLQEVIKRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F         + ++          R+  V G+ F+  A+ +  + N + L G+ G
Sbjct: 186 RFDVAFHLRHNGKTIFALHEARDELARARRVGAVCGQAFLEQALPIEVERNGLHLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R   +  Y ++NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 246 LPTFSRSQPDLQYFYVNGRMVRDKLVAHAVRQAYRDVLYNGRHPTFVLFFEVDPAVVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RFR+  ++ +F+  ++ +A+ +  +     L+    +S  +         ++
Sbjct: 306 VHPTKHEVRFRDSRMVHDFLYGTLHRALGE--VRPDDQLAPPGATSLTEPRPTGAAAGEF 363

Query: 359 ATS--------------------------------LTNTQEKLFLQENRLSTNDLLPSDD 386
                                                 T+ +                  
Sbjct: 364 GPQGEMRLAESVLESPAARVGWSGGASSSGASSGYSAYTRPEAPPSLAEAGGAYKAYFAP 423

Query: 387 PTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQD 446
               E    + ES      LG A AQ+   YI+++   GLV+VD HAAHER+ +E+++  
Sbjct: 424 LPAGEAPAALPESAQDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERITYERLKVA 483

Query: 447 FNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSK 506
             S  +  Q LL PE I + E E     EH     RLG + +R GP  +AIR+IPA+L +
Sbjct: 484 MASEGLRGQPLLVPESIAVSEREADCAEEHSGWFQRLGFELQRLGPETLAIRQIPALLKQ 543

Query: 507 KNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEK 566
               QL+RD+I ++++  T+  +Q  +  +L TMAC+G++R+ R++   EMN LLR+ME 
Sbjct: 544 AEATQLVRDVIADLLEYGTSDRIQAHLNELLGTMACHGAVRANRRLTLPEMNALLRDMEI 603

Query: 567 NPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
              S QCNHGRPT+ +L L +++KLF R
Sbjct: 604 TERSGQCNHGRPTWTQLGLDELDKLFLR 631


>gi|107104045|ref|ZP_01367963.1| hypothetical protein PaerPA_01005118 [Pseudomonas aeruginosa PACS2]
 gi|116053095|ref|YP_793414.1| DNA mismatch repair protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|313109947|ref|ZP_07795875.1| DNA mismatch repair protein MutL [Pseudomonas aeruginosa 39016]
 gi|122256892|sp|Q02F72|MUTL_PSEAB RecName: Full=DNA mismatch repair protein mutL
 gi|115588316|gb|ABJ14331.1| DNA mismatch repair protein MutL [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|310882377|gb|EFQ40971.1| DNA mismatch repair protein MutL [Pseudomonas aeruginosa 39016]
          Length = 633

 Score =  568 bits (1463), Expect = e-159,   Method: Composition-based stats.
 Identities = 211/628 (33%), Positives = 335/628 (53%), Gaps = 37/628 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLDA S R++  +  GG    ++ D+G 
Sbjct: 6   RIQLLSPRLANQIAAGEVVERPASVAKELLENSLDAGSRRIDVEVEQGGIKLLRVRDDGR 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++++P+A+ RH TSKI +  D   + + GFRGEAL SI +V+ LT+ SR        
Sbjct: 66  GIPADDLPLALARHATSKIRELEDLERVMSLGFRGEALASISSVARLTMTSRTADAGEAW 125

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  +    +P A   GT VEVRDLFF  PAR  FL++E+ E + + +VI+R+A+A
Sbjct: 126 QVETEGRDMQPRVQPAAHPVGTSVEVRDLFFNTPARRKFLRAEKTEFDHLQEVIKRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F         + ++          R+  V G+ F+  A+ +  + N + L G+ G
Sbjct: 186 RFDVAFHLRHNGKTIFALHEARDELARARRVGAVCGQAFLEQALPIEVERNGLHLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R   +  Y ++NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 246 LPTFSRSQPDLQYFYVNGRMVRDKLVAHAVRQAYRDVLYNGRHPTFVLFFEVDPAVVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RFR+  ++ +F+  ++ +A+ +  +     L+    +S  +         ++
Sbjct: 306 VHPTKHEVRFRDSRMVHDFLYGTLHRALGE--VRPDDQLAPPGATSLTEPRPTGAAAGEF 363

Query: 359 ATS--------------------------------LTNTQEKLFLQENRLSTNDLLPSDD 386
                                                 T+ +                  
Sbjct: 364 GPQGEMRLAESVLESPAARVGWSGGSSASGGSSGYSAYTRPEAPPSLAEAGGAYKAYFAP 423

Query: 387 PTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQD 446
               E    + ES      LG A AQ+   YI+++   GLV+VD HAAHER+ +E+++  
Sbjct: 424 LPAGEAPAALPESAQDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERITYERLKVA 483

Query: 447 FNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSK 506
             S  +  Q LL PE I + E E     EH     RLG + +R GP ++AIR+IPA+L +
Sbjct: 484 MASEGLRGQPLLVPESIAVSEREADCAEEHSSWFQRLGFELQRLGPESLAIRQIPALLKQ 543

Query: 507 KNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEK 566
               QL+RD+I ++++  T+  +Q  +  +L TMAC+G++R+ R++   EMN LLR+ME 
Sbjct: 544 AEATQLVRDVIADLLEYGTSDRIQAHLNELLGTMACHGAVRANRRLTLPEMNALLRDMEI 603

Query: 567 NPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
              S QCNHGRPT+ +L L +++KLF R
Sbjct: 604 TERSGQCNHGRPTWTQLGLDELDKLFLR 631


>gi|15600139|ref|NP_253633.1| DNA mismatch repair protein [Pseudomonas aeruginosa PAO1]
 gi|218894041|ref|YP_002442910.1| DNA mismatch repair protein [Pseudomonas aeruginosa LESB58]
 gi|254238339|ref|ZP_04931662.1| DNA mismatch repair protein MutL [Pseudomonas aeruginosa C3719]
 gi|20455148|sp|Q9HUL8|MUTL_PSEAE RecName: Full=DNA mismatch repair protein mutL
 gi|226723040|sp|B7V209|MUTL_PSEA8 RecName: Full=DNA mismatch repair protein mutL
 gi|9951226|gb|AAG08331.1|AE004907_9 DNA mismatch repair protein MutL [Pseudomonas aeruginosa PAO1]
 gi|126170270|gb|EAZ55781.1| DNA mismatch repair protein MutL [Pseudomonas aeruginosa C3719]
 gi|218774269|emb|CAW30086.1| DNA mismatch repair protein MutL [Pseudomonas aeruginosa LESB58]
          Length = 633

 Score =  568 bits (1463), Expect = e-159,   Method: Composition-based stats.
 Identities = 211/628 (33%), Positives = 335/628 (53%), Gaps = 37/628 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLDA S R++  +  GG    ++ D+G 
Sbjct: 6   RIQLLSPRLANQIAAGEVVERPASVAKELLENSLDAGSRRIDVEVEQGGIKLLRVRDDGR 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++++P+A+ RH TSKI +  D   + + GFRGEAL SI +V+ LT+ SR        
Sbjct: 66  GIPADDLPLALARHATSKIRELEDLERVMSLGFRGEALASISSVARLTMTSRTADAGEAW 125

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  +    +P A   GT VEVRDLFF  PAR  FL++E+ E + + +VI+R+A+A
Sbjct: 126 QVETEGRDMQPRVQPAAHPVGTSVEVRDLFFNTPARRKFLRAEKTEFDHLQEVIKRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F         + ++          R+  V G+ F+  A+ +  + N + L G+ G
Sbjct: 186 RFDVAFHLRHNGKTIFALHEARDELARARRVGAVCGQAFLEQALPIEVERNGLHLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R   +  Y ++NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 246 LPTFSRSQPDLQYFYVNGRMVRDKLVAHAVRQAYRDVLYNGRHPTFVLFFEVDPAVVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RFR+  ++ +F+  ++ +A+ +  +     L+    +S  +         ++
Sbjct: 306 VHPTKHEVRFRDSRMVHDFLYGTLHRALGE--VRPDDQLAPPGATSLTEPRPTGAAAGEF 363

Query: 359 ATS--------------------------------LTNTQEKLFLQENRLSTNDLLPSDD 386
                                                 T+ +                  
Sbjct: 364 GPQGEMRLAESVLESPAARVGWSGGSSASGGSSGYSAYTRPEAPPSLAEAGGAYKAYFAP 423

Query: 387 PTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQD 446
               E    + ES      LG A AQ+   YI+++   GLV+VD HAAHER+ +E+++  
Sbjct: 424 LPAGEAPAALPESAQDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERITYERLKVA 483

Query: 447 FNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSK 506
             S  +  Q LL PE I + E E     EH     RLG + +R GP ++AIR+IPA+L +
Sbjct: 484 MASEGLRGQPLLVPESIAVSEREADCAEEHSSWFQRLGFELQRLGPESLAIRQIPALLKQ 543

Query: 507 KNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEK 566
               QL+RD+I ++++  T+  +Q  +  +L TMAC+G++R+ R++   EMN LLR+ME 
Sbjct: 544 AEATQLVRDVIADLLEYGTSDRIQAHLNELLGTMACHGAVRANRRLTLPEMNALLRDMEI 603

Query: 567 NPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
              S QCNHGRPT+ +L L +++KLF R
Sbjct: 604 TERSGQCNHGRPTWTQLGLDELDKLFLR 631


>gi|296391786|ref|ZP_06881261.1| DNA mismatch repair protein [Pseudomonas aeruginosa PAb1]
          Length = 633

 Score =  567 bits (1462), Expect = e-159,   Method: Composition-based stats.
 Identities = 215/626 (34%), Positives = 343/626 (54%), Gaps = 33/626 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLDA S R++  +  GG    ++ D+G 
Sbjct: 6   RIQLLSPRLANQIAAGEVVERPASVAKELLENSLDAGSRRIDVEVEQGGIKLLRVRDDGR 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++++P+A+ RH TSKI +  D   + + GFRGEAL SI +V+ LT+ SR        
Sbjct: 66  GIPADDLPLALARHATSKIRELEDLERVMSLGFRGEALASISSVARLTMTSRTADAGEAW 125

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  +    +P A   GT VEVRDLFF  PAR  FL++E+ E + + +VI+R+A+A
Sbjct: 126 QVETEGRDMQPRVQPAAHPVGTSVEVRDLFFNTPARRKFLRAEKTEFDHLQEVIKRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F         + ++          R+  V G+ F+  A+ +  + N + L G+ G
Sbjct: 186 RFDVAFHLRHNGKTIFALHEARDELARARRVGAVCGQAFLEQALPIEVERNGLHLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R   +  Y ++NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 246 LPTFSRSQPDLQYFYVNGRMVRDKLVAHAVRQAYRDVLYNGRHPTFVLFFEVDPAVVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGI-------STSSVLSKKMISSFHQDNAP 351
           VHP K  +RFR+  ++ +F+  ++ +A+ +            +S+   +   +   +  P
Sbjct: 306 VHPTKHEVRFRDSRMVHDFLYGTLHRALGEVRPDDQLAPPGATSLTEPRPTGAAAGEFGP 365

Query: 352 KTHLPKYATSLTNTQEKL--------------FLQENRLSTNDLLPSDDPTYSEDNDPVE 397
           +  +    + L +   ++              +    R  T   L      Y     P+ 
Sbjct: 366 QGEMRLAESVLESPAARVGWSGGSSASGGSSGYSAYTRPETPPSLAEAGGAYKAYFAPLP 425

Query: 398 ---------ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFN 448
                    ES      LG A AQ+   YI+++   GLV+VD HAAHER+ +E+++    
Sbjct: 426 AGEAPAALPESAQDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERITYERLKVAMA 485

Query: 449 STKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKN 508
           S  +  Q LL PE I + E E     EH     RLG + +R GP ++AIR+IPA+L +  
Sbjct: 486 SEGLRGQPLLVPESIAVSEREADCAEEHSSWFQRLGFELQRLGPESLAIRQIPALLKQAE 545

Query: 509 IPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNP 568
             QL+RD+I ++++  T+  +Q  +  +L TMAC+G++R+ R++   EMN LLR+ME   
Sbjct: 546 ATQLVRDVIADLLEYGTSDRIQAHLNELLGTMACHGAVRANRRLTLPEMNALLRDMEITE 605

Query: 569 NSSQCNHGRPTFIKLKLSDIEKLFGR 594
            S QCNHGRPT+ +L L +++KLF R
Sbjct: 606 RSGQCNHGRPTWTQLGLDELDKLFLR 631


>gi|182682515|ref|YP_001830675.1| DNA mismatch repair protein [Xylella fastidiosa M23]
 gi|32129762|sp|Q87AC9|MUTL_XYLFT RecName: Full=DNA mismatch repair protein mutL
 gi|238691108|sp|B2I9E6|MUTL_XYLF2 RecName: Full=DNA mismatch repair protein mutL
 gi|182632625|gb|ACB93401.1| DNA mismatch repair protein MutL [Xylella fastidiosa M23]
 gi|307578792|gb|ADN62761.1| DNA mismatch repair protein [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 619

 Score =  567 bits (1462), Expect = e-159,   Method: Composition-based stats.
 Identities = 217/619 (35%), Positives = 346/619 (55%), Gaps = 27/619 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN++DA ++RV+  +   G    +I DNG
Sbjct: 1   MPIRQLPEILINQIAAGEVVERPASVVKELVENAIDAGATRVDIELEAAGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            GM ++E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TLMSR   +  G
Sbjct: 61  HGMAAQELPLAVLRHATSKIASLDDLEAVATLGFRGEALPSIASVSRFTLMSRRATDEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           A + I G  +  V P A  PGT VEVR+LF+ +PAR  FL++E+ E   I +  R +A+A
Sbjct: 121 AVLQIEGGTLGEVIPHAHAPGTTVEVRELFYNVPARRKFLRAERTELGHIEEWARSLALA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +P +    S       +        +    + +++GEDF + A+ ++     + L G   
Sbjct: 181 HPDLELRLSHNGKLSRRYKPGDWYSDVR--LIEILGEDFAHQALRVDHSGAGLRLHGCIV 238

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P ++R NA+Q Y+++NGR V+D+ +   ++ AY++ +  GR+P  VL LE+DP +VDVN
Sbjct: 239 QPHYSRLNADQQYLYVNGRPVRDRSVAHAVKQAYSDVLYQGRHPAYVLFLELDPARVDVN 298

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHPAK  +RFR+  +I +F+ +++Q  + +    T  +              P  H   +
Sbjct: 299 VHPAKHEVRFRDARLIHDFVYRTVQGTLAQTRAGTPPLAVGVGDVEGEGARPPGRHAVSF 358

Query: 359 AT----------SLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQL-- 406
           +           S + +   L      +S  D   +    Y+     V ++         
Sbjct: 359 SGRRGGASHVLGSYSASTAPLMQGVPSVSVADAPAAYAALYAAPPTQVMDAVPQMQTGLP 418

Query: 407 -----------GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQ 455
                      G A AQ+H  YI+++  DGL++VD HAAHER+ +E++++  +   + +Q
Sbjct: 419 LAAGAGDVPLLGYAIAQLHGIYILAECADGLIVVDMHAAHERIGYERLKRAHDGIGLRTQ 478

Query: 456 TLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRD 515
            LL P  + + E E  +     E L  LG +  R GP ++ +R IPA+LS+     LLRD
Sbjct: 479 PLLVPMTLMVAEREADVAECEAETLANLGFEVTRSGPGSLQVRSIPALLSQAEPEMLLRD 538

Query: 516 IIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNH 575
           ++ ++ +   T  + +  + +LATMAC+G++R+ R++   EMN LLR+ME    S QCNH
Sbjct: 539 VLSDLSEHGHTRRVAEARDTLLATMACHGAVRAHRRLSISEMNALLRDMEATERSGQCNH 598

Query: 576 GRPTFIKLKLSDIEKLFGR 594
           GRPT+ +  L++I++ F R
Sbjct: 599 GRPTWARFSLAEIDRWFLR 617


>gi|28199765|ref|NP_780079.1| DNA mismatch repair protein [Xylella fastidiosa Temecula1]
 gi|28057886|gb|AAO29728.1| DNA mismatch repair protein MutL [Xylella fastidiosa Temecula1]
          Length = 621

 Score =  567 bits (1462), Expect = e-159,   Method: Composition-based stats.
 Identities = 217/619 (35%), Positives = 346/619 (55%), Gaps = 27/619 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN++DA ++RV+  +   G    +I DNG
Sbjct: 3   MPIRQLPEILINQIAAGEVVERPASVVKELVENAIDAGATRVDIELEAAGVRLIRIRDNG 62

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            GM ++E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TLMSR   +  G
Sbjct: 63  HGMAAQELPLAVLRHATSKIASLDDLEAVATLGFRGEALPSIASVSRFTLMSRRATDEHG 122

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           A + I G  +  V P A  PGT VEVR+LF+ +PAR  FL++E+ E   I +  R +A+A
Sbjct: 123 AVLQIEGGTLGEVIPHAHAPGTTVEVRELFYNVPARRKFLRAERTELGHIEEWARSLALA 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +P +    S       +        +    + +++GEDF + A+ ++     + L G   
Sbjct: 183 HPDLELRLSHNGKLSRRYKPGDWYSDVR--LIEILGEDFAHQALRVDHSGAGLRLHGCIV 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P ++R NA+Q Y+++NGR V+D+ +   ++ AY++ +  GR+P  VL LE+DP +VDVN
Sbjct: 241 QPHYSRLNADQQYLYVNGRPVRDRSVAHAVKQAYSDVLYQGRHPAYVLFLELDPARVDVN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHPAK  +RFR+  +I +F+ +++Q  + +    T  +              P  H   +
Sbjct: 301 VHPAKHEVRFRDARLIHDFVYRTVQGTLAQTRAGTPPLAVGVGDVEGEGARPPGRHAVSF 360

Query: 359 AT----------SLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQL-- 406
           +           S + +   L      +S  D   +    Y+     V ++         
Sbjct: 361 SGRRGGASHVLGSYSASTAPLMQGVPSVSVADAPAAYAALYAAPPTQVMDAVPQMQTGLP 420

Query: 407 -----------GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQ 455
                      G A AQ+H  YI+++  DGL++VD HAAHER+ +E++++  +   + +Q
Sbjct: 421 LAAGAGDVPLLGYAIAQLHGIYILAECADGLIVVDMHAAHERIGYERLKRAHDGIGLRTQ 480

Query: 456 TLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRD 515
            LL P  + + E E  +     E L  LG +  R GP ++ +R IPA+LS+     LLRD
Sbjct: 481 PLLVPMTLMVAEREADVAECEAETLANLGFEVTRSGPGSLQVRSIPALLSQAEPEMLLRD 540

Query: 516 IIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNH 575
           ++ ++ +   T  + +  + +LATMAC+G++R+ R++   EMN LLR+ME    S QCNH
Sbjct: 541 VLSDLSEHGHTRRVAEARDTLLATMACHGAVRAHRRLSISEMNALLRDMEATERSGQCNH 600

Query: 576 GRPTFIKLKLSDIEKLFGR 594
           GRPT+ +  L++I++ F R
Sbjct: 601 GRPTWARFSLAEIDRWFLR 619


>gi|209548102|ref|YP_002280019.1| DNA mismatch repair protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|238058936|sp|B5ZS00|MUTL_RHILW RecName: Full=DNA mismatch repair protein mutL
 gi|209533858|gb|ACI53793.1| DNA mismatch repair protein MutL [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 600

 Score =  567 bits (1462), Expect = e-159,   Method: Composition-based stats.
 Identities = 299/601 (49%), Positives = 412/601 (68%), Gaps = 9/601 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+LSE +INQIAAGE+IERP+ A KELIEN+LDA ++R+E   AGGGK+  +++DNG
Sbjct: 1   MAIRQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIATAGGGKALLRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM + ++ +AV+RHCTSK+S+   +I T GFRGEALPSIG+V+ L++ SR   +  G +
Sbjct: 61  SGMDAADLELAVRRHCTSKLSETLEDIRTLGFRGEALPSIGSVARLSIASRRRDSAGGHE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA++  K++ +RP A NPGTIVEVRDLFF  PARL FLK+E+ E   IT++++RMAIA+P
Sbjct: 121 IAVNAGKVAHLRPAAANPGTIVEVRDLFFATPARLKFLKTEKAEAGAITEIVKRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V F  S   S+R  + F +T  +   R++QV+G+DF +NA+ L+    EI+L G+ G+P
Sbjct: 181 AVRFVLS--GSDRTTLEFPATGDDHLARMAQVLGKDFRDNAIALDAVREEISLTGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+   Y F+NGR VQDK ILS IR AYAETIP GR+PV VL + +DP  VDVNVH
Sbjct: 239 TFNRGNSAHQYAFVNGRPVQDKLILSAIRGAYAETIPSGRHPVAVLSITLDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           PAKS +RFR+P ++R  I+ +I++A+ + G   ++  +  M+ SF     P+   P+ A 
Sbjct: 299 PAKSDVRFRDPGLVRGLIVGAIREALARDGSRAATTGASDMLRSFRPGFQPQAQRPQTAW 358

Query: 361 SLTNTQEKL------FLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQL-GIACAQI 413
           S   +  +       F +  + S + L           +     ++ T     G A AQI
Sbjct: 359 SAETSPFRPYQPTTGFSERPQASFDGLSMPTARAEPPFSPQPAAADTTARYPLGAARAQI 418

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
           H NYI++QT DGLVIVDQHAAHERL+FE MR+  +S ++ SQ LL PEI+D+ E +C  +
Sbjct: 419 HANYIVAQTEDGLVIVDQHAAHERLVFEAMRKALHSKRLASQVLLIPEIVDIPEEDCDRL 478

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRI 533
           M+H  +L  LG+  ERFGP AIA+RE PA+L + +   L+R + DEI +  T   L  ++
Sbjct: 479 MQHAAELAELGLAIERFGPGAIAVRETPAMLGEVDAHGLIRQLADEIAEWDTASGLSAKL 538

Query: 534 ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFG 593
           E + ATMAC+GS+RSGR+++  EMN LLREME  P S QCNHGRPT+I+LKLSDIE+LFG
Sbjct: 539 EYVAATMACHGSVRSGRRLRPEEMNALLREMEVTPGSGQCNHGRPTYIELKLSDIERLFG 598

Query: 594 R 594
           R
Sbjct: 599 R 599


>gi|226942900|ref|YP_002797973.1| DNA mismatch repair protein [Azotobacter vinelandii DJ]
 gi|259509928|sp|C1DLQ0|MUTL_AZOVD RecName: Full=DNA mismatch repair protein mutL
 gi|226717827|gb|ACO76998.1| DNA mismatch repair protein [Azotobacter vinelandii DJ]
          Length = 641

 Score =  567 bits (1462), Expect = e-159,   Method: Composition-based stats.
 Identities = 214/634 (33%), Positives = 341/634 (53%), Gaps = 41/634 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLDA + RV+  +  GG    ++ D+G 
Sbjct: 6   RIQLLSLRLANQIAAGEVVERPASVAKELLENSLDAGARRVDIEVEQGGVKLLRVRDDGC 65

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++++P+A+ RH TSKI   +D   + + GFRGEAL SIG+V+ LTL SR        
Sbjct: 66  GIAADDLPLALARHATSKIRELEDLERVASLGFRGEALASIGSVARLTLTSRTADAGQAW 125

Query: 120 QIAISGEKIS-SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  +   V+P A   GT VEVRDLFF  PAR  FL++E+ E   + +V+RR+A+A
Sbjct: 126 QVETEGRDMEARVQPAAYPVGTSVEVRDLFFNTPARRKFLRAEKTEFEHLQEVVRRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F       +   ++          R++ V G  F+  A+ +  +   + L G+ G
Sbjct: 186 RFDVAFHLRHNGRSALALHEAGDETARARRVAAVCGPAFLEQALPIEVERAGLRLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y ++NGR V+DK +   +R AY + +  GR+P  VL LE+DP  VDVN
Sbjct: 246 LPTFSRSQADLQYFYVNGRMVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLEVDPAVVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI-------------------------------- 326
           VHP K  +RFR+  +I +F+  ++ + +                                
Sbjct: 306 VHPTKHEVRFRDSRMIHDFLYGTLHRVLGEVRPEDRLAAPAAVAPPAPASGAAAGEFRGQ 365

Query: 327 NKKGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQ------ENRLSTND 380
            +  +S +    +    +  +        P    + +     ++ +      E R     
Sbjct: 366 EEMPLSATPPAREPARPAAWKGAGAGYQAPSPRPARSAEAGGVYREFFAPLAEPRTEPAT 425

Query: 381 LLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIF 440
               +    S D    + S      LG A AQ+   YI+++   GLV+VD HAAHER+ +
Sbjct: 426 RTGEESGISSGDTSLGDTSPGGIPPLGYALAQLKGIYILAENAQGLVLVDMHAAHERITY 485

Query: 441 EKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREI 500
           E+++    S  +  Q LL PE + L + E     EH E   RLG + +R GP  +AIR+ 
Sbjct: 486 ERLKTAMASEGLRGQPLLVPEGLALSQREADCAEEHAEWFQRLGFELQRLGPETLAIRQT 545

Query: 501 PAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRL 560
           PA+L +    QL+RD++ ++++  ++  ++  +  +LATMAC+GS+R+ R++   EMN L
Sbjct: 546 PALLRQAEAGQLVRDVLADLLEYGSSDRIEAHLNELLATMACHGSVRANRRLTLPEMNAL 605

Query: 561 LREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LR+ME    S QCNHGRPT+ +L ++D++KLF R
Sbjct: 606 LRDMESTERSGQCNHGRPTWTQLGMADLDKLFLR 639


>gi|126666949|ref|ZP_01737925.1| DNA mismatch repair protein [Marinobacter sp. ELB17]
 gi|126628665|gb|EAZ99286.1| DNA mismatch repair protein [Marinobacter sp. ELB17]
          Length = 630

 Score =  567 bits (1461), Expect = e-159,   Method: Composition-based stats.
 Identities = 212/630 (33%), Positives = 349/630 (55%), Gaps = 38/630 (6%)

Query: 1   MK-IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDN 59
           M  I  L  ++ NQIAAGE++ERP+  +KELIEN+LDA +SRV+  I  GG    ++ D+
Sbjct: 1   MPHIHLLPPRLANQIAAGEVVERPASVVKELIENALDAGASRVDVDIEQGGVKLIRVRDD 60

Query: 60  GFGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNT 117
           G G+ +E++ +A+ RH TSKI+  DD   + + GFRGEAL SI +VS L+L SR      
Sbjct: 61  GCGIAAEDLSLALSRHATSKITSLDDLEAVTSLGFRGEALASISSVSRLSLTSRTENQEA 120

Query: 118 GAQIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMA 176
            +++ + G  + +   P A   G+ VEVRDLFF  PAR  FL++E+ E   + + +RR A
Sbjct: 121 ASKVEVEGRDMDAHVSPAAHPVGSTVEVRDLFFNTPARRKFLRTEKTEFGHVEECVRRQA 180

Query: 177 IAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
           ++     F     +     +    +  +   RI+ + G+ FI+NAV ++ ++  + L G+
Sbjct: 181 LSCFDTGFNLRHNQRAVQSLRPALSELDKERRIASLCGQQFIDNAVVISAEATGLKLWGW 240

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
             +PTF+R   +  Y F+NGR ++D+ +   +R AY + +   R+   VL LE+DP  VD
Sbjct: 241 VALPTFSRSQTDLQYFFVNGRVIRDRLVAHAVRQAYRDVLYNNRHAAFVLYLEVDPGSVD 300

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA------ 350
           VNVHP K  +RFR+  ++ +F+ +++ KA+    +     L   +  S  ++NA      
Sbjct: 301 VNVHPTKHEVRFRDGRLVHDFLFRTLHKALA--DVRPDDHLRGAVAQSLGRENAFAAVTG 358

Query: 351 PKTHLPKYATSLTNT-------------------QEKLFLQENRLSTNDLLPSD------ 385
               LP   ++ + +                    +  +   ++L     L +       
Sbjct: 359 SAEGLPSPGSAASESALGYPGGIERTPGQVTHSDPQHQWQASDQLGFYQALNAGGGVSAG 418

Query: 386 -DPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMR 444
              + +     + E       LG A AQ+H  YI++Q+  GL++VD HAAHER+ +E+M+
Sbjct: 419 RQASVAAHPPQMLEDSEQEPPLGYAIAQLHGIYILAQSRTGLIMVDMHAAHERITYERMK 478

Query: 445 QDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAIL 504
           Q      + SQ LL P  + + + E  L+  H ++L +LG+  ER GP  +A+R+IPA+L
Sbjct: 479 QALAQQDLKSQPLLVPLSLAVSQKEAGLVETHGDELQQLGLVIERIGPETLAVRQIPALL 538

Query: 505 SKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREM 564
              +  QL+RD++ ++I+   +  +Q   + +L TMAC+GS+R+ R++   EMN LLR+M
Sbjct: 539 RGADGEQLVRDVLSDLIEHGQSDRVQAVTQELLGTMACHGSVRANRQLTIPEMNSLLRDM 598

Query: 565 EKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           E    S QCNHGRPT+  + L++++KLF R
Sbjct: 599 EATERSGQCNHGRPTWTVMTLAELDKLFLR 628


>gi|104783874|ref|YP_610372.1| DNA mismatch repair protein [Pseudomonas entomophila L48]
 gi|122985730|sp|Q1I447|MUTL_PSEE4 RecName: Full=DNA mismatch repair protein mutL
 gi|95112861|emb|CAK17589.1| DNA mismatch repair protein MutL [Pseudomonas entomophila L48]
          Length = 632

 Score =  567 bits (1461), Expect = e-159,   Method: Composition-based stats.
 Identities = 215/625 (34%), Positives = 340/625 (54%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLD+ + R+E  +  GG    ++ DNG 
Sbjct: 6   RIQLLSPRLANQIAAGEVVERPASVAKELLENSLDSGARRIEVEVEQGGVKLLRVRDNGG 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+A+ RH TSKI +  D   + + GFRGEAL SI +V+ LTL SR        
Sbjct: 66  GIAPDDLPLALARHATSKIRELEDLEGVLSLGFRGEALASISSVARLTLTSRTADAGEAW 125

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++   +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VIRR+A+A
Sbjct: 126 QVETEGRDMTPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIRRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V F         + ++  +       R+  + G  F+  A+ ++ + N + L G+ G
Sbjct: 186 RFDVGFHLRHNGKTIFSLHEATDEMARARRVGTICGPGFLEQALPIDVERNGLRLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL LE DP  VDVN
Sbjct: 246 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLECDPTGVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSK----------KMISSFHQD 348
           VHP K  +RFR   ++ +F+  ++ +A+                       + +  F   
Sbjct: 306 VHPTKHEVRFREGRMVHDFLYGTLHRALADVRPEDQLAAPAAASEIVRPSGQQVGEFGPQ 365

Query: 349 NAPKTHLPKYATSLTNTQEKL-----------FLQENRLSTNDLLPSDDPTYSEDNDPVE 397
              +   P         ++             +    R S    +      Y E   P++
Sbjct: 366 GEMRLASPVLEQPQAEPRQSFTPGSGAGSGYQYQYTPRPSQPLPVAETQAVYREFYAPLD 425

Query: 398 --------ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                   ES+     LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    S
Sbjct: 426 GTAPASLPESQGDIPPLGYALAQLKGIYILAENAVGLVLVDMHAAHERIMYERLKVAMAS 485

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE + L + E     EH +   RLG + +R GP  +AIR+IPA+L +   
Sbjct: 486 EGLSGQPLLVPESLALSQREADCAEEHAQWFQRLGFELQRLGPETVAIRQIPALLKQAEA 545

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L++D++ ++++  T+  +Q  +  +L TMAC+G++R+ R++   EMN LLR+ME    
Sbjct: 546 NRLVQDVLADLMEYGTSDRIQAHLNELLGTMACHGAVRANRRLAIPEMNALLRDMENTER 605

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L D++KLF R
Sbjct: 606 SGQCNHGRPTWTQMGLDDLDKLFLR 630


>gi|71901139|ref|ZP_00683245.1| DNA mismatch repair protein [Xylella fastidiosa Ann-1]
 gi|71729103|gb|EAO31228.1| DNA mismatch repair protein [Xylella fastidiosa Ann-1]
          Length = 621

 Score =  567 bits (1461), Expect = e-159,   Method: Composition-based stats.
 Identities = 219/621 (35%), Positives = 349/621 (56%), Gaps = 29/621 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN++DA ++RV+  +   G    +I DNG
Sbjct: 1   MPIRQLPEILINQIAAGEVVERPASVVKELVENAIDAGATRVDIELEAAGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            GM ++E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TLMSR   +  G
Sbjct: 61  HGMAAQELPLAVLRHATSKIASLDDLEAVATLGFRGEALPSIASVSRFTLMSRRATDEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           A + I G  +  V P A  PGT VEVR+LF+ +PAR  FL++E+ E   I +  R +A+A
Sbjct: 121 AVLQIEGGTLGEVIPHAHAPGTTVEVRELFYNVPARRKFLRAERTELGHIEEWARSLALA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +P +    S       +        +    + +++GEDF + A+ ++     + L G   
Sbjct: 181 HPDLELRLSHNGKLSRRYKPGDWYSDAR--LIEILGEDFAHQALPVDHSGAGLRLHGCIV 238

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P ++R NA+Q Y+++NGR V+D+ +   ++ AY++ +  GR+P  VL LE+DP +VDVN
Sbjct: 239 QPHYSRLNADQQYLYVNGRPVRDRSVAHAVKQAYSDVLYQGRHPAYVLFLELDPARVDVN 298

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKK--GISTSSVLSKKMISSFHQDNAPKTHLP 356
           VHPAK  +RFR+  +I +F+ +++Q  + +   G    +V    +         P  H  
Sbjct: 299 VHPAKHEVRFRDARLIHDFVYRTVQGTLAQTRAGTPPLAVGVGDVEGEGEGARPPGRHAV 358

Query: 357 KYAT----------SLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHY-- 404
            ++           S + +   L      +S  D   +    Y+     V ++       
Sbjct: 359 SFSGRRGGASHVLGSYSASTAPLMQGVPSVSVADAPAAYAALYAAPPTQVMDAVPQMQTG 418

Query: 405 -----------QLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKIT 453
                       LG A AQ+H  YI+++  DGL++VD HAAHER+ +E++++  +   + 
Sbjct: 419 LPLAAGAGDVPPLGYAIAQLHGIYILAECADGLIVVDMHAAHERIGYERLKRAHDGIGLR 478

Query: 454 SQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLL 513
           +Q LL P  + + E E  +     E L  LG +  R GP ++ +R IPA+LS+     LL
Sbjct: 479 TQPLLVPMTLMVAEREADVAECEAETLANLGFEVTRSGPGSLQVRSIPALLSQAEPEMLL 538

Query: 514 RDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQC 573
           RD++ ++ +   T  + +  + +LATMAC+G++R+ R++   EMN LLR+ME    S QC
Sbjct: 539 RDVLSDLSEHGHTRRVAEARDTLLATMACHGAVRAHRRLSISEMNALLRDMEATERSGQC 598

Query: 574 NHGRPTFIKLKLSDIEKLFGR 594
           NHGRPT+ +  L++I++ F R
Sbjct: 599 NHGRPTWARFSLAEIDRWFLR 619


>gi|34496797|ref|NP_901012.1| DNA mismatch repair protein [Chromobacterium violaceum ATCC 12472]
 gi|34102652|gb|AAQ59017.1| DNA mismatch repair protein [Chromobacterium violaceum ATCC 12472]
          Length = 631

 Score =  566 bits (1460), Expect = e-159,   Method: Composition-based stats.
 Identities = 211/631 (33%), Positives = 332/631 (52%), Gaps = 42/631 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I++L + ++NQIAAGE++ERP+ A+KE++ENSLDA ++R+   +A GG    ++TDNG 
Sbjct: 3   RIQRLPDHLVNQIAAGEVVERPASALKEMLENSLDAGATRISVDLAQGGIKLIRVTDNGA 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++++P+A+ RH TSKI+  DD  ++ T GFRGE L S+ +VS LTL SRP   +   
Sbjct: 63  GIAADDLPLALDRHATSKIASLDDLESVSTLGFRGEGLASVASVSRLTLTSRPHDADHAH 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI      +  V P A   GT VEV DL+F  PAR  FLKSE  E         R+A+A+
Sbjct: 123 QIIAIDGTLHPVEPAAHPHGTSVEVVDLYFNTPARRKFLKSENTEYAHCAATFERIALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P+V F         +++  QS      +R++ ++G+DF+  A+ L+ ++  + L G+   
Sbjct: 183 PEVEFLLRHNGKVAWRLPSQSA----EDRVAALLGKDFVAAAIPLDSQAGPLALSGFVAS 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT+++ + +  Y ++NGR V+DK     +R AY + +   R+P   L   ++P  VDVNV
Sbjct: 239 PTYSKASRDAQYFYVNGRFVRDKTAQHALRQAYRDVLHHDRHPAYALFFTLEPSGVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLS-------KKMISSFHQDNAPK 352
           HP K  +RFR    +  F+  S+ KA+       +  +           +          
Sbjct: 299 HPTKIEVRFRESQAVHQFLFHSVHKALAGTSAGAAPTVQVEGAETAAPQLPRGESAPLFA 358

Query: 353 THLPKYATSLTNTQEKLFLQENRLSTN-------------DLLPSDDPTYSEDND----- 394
           +  P+ A+S     +    Q+  +  N               L  ++   S         
Sbjct: 359 SASPQPASSGAPAPQPFQYQQQSIPLNVAREAVGVYDKLFGGLREEERALSRPEPAMPSP 418

Query: 395 -----------PVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKM 443
                           E     LG A AQ+H  YI+SQ  +GL++VD HAAHER+++E++
Sbjct: 419 AAPLLHPAVLAMPAHDENGIPPLGFALAQLHGVYILSQCAEGLILVDMHAAHERIVYERL 478

Query: 444 RQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAI 503
           +    S  I  Q LL P        E A   EH E++ RLG++     P  IA+R +P  
Sbjct: 479 KAALESDAIPLQPLLLPVSFAADRMEVATAHEHGEEMKRLGVELAPLSPTQIAVRGVPVW 538

Query: 504 LSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLRE 563
           L   +  +L R ++ ++ +   T  L +R   +LATMAC+G++R+ R++   EMN LLR+
Sbjct: 539 LKDGDPVELARAVLKDVREFGLTQVLTERRNELLATMACHGAVRANRQLTLPEMNALLRD 598

Query: 564 MEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ME    S QCNHGRPT+ +L + D++KLF R
Sbjct: 599 MEATERSGQCNHGRPTWTRLTMRDLDKLFMR 629


>gi|66043837|ref|YP_233678.1| DNA mismatch repair protein [Pseudomonas syringae pv. syringae
           B728a]
 gi|63254544|gb|AAY35640.1| DNA mismatch repair protein [Pseudomonas syringae pv. syringae
           B728a]
          Length = 648

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 218/625 (34%), Positives = 344/625 (55%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDVDVEQAGIKLLKVRDDGS 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++   +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTARARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S   V   +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLYRALGDVRPENQLGGSVPVVAEARPSGPEAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTY----------------------- 389
             +      L   Q + F +               T                        
Sbjct: 382 GEMRLANNVLEQPQGEPFARPAAGGGAGSGYQYQYTPRPTAGVPVAEAQSAYREFFAPLP 441

Query: 390 SEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
           S  +  + ES      LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    +
Sbjct: 442 SAASASLPESPGDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMAN 501

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE I + + E     EH     RLG + +R GP  +AIR+IPA+L +   
Sbjct: 502 EGLSGQPLLVPESIAVSQREADCAEEHLATFQRLGFELQRLGPETLAIRQIPALLKQAEA 561

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    
Sbjct: 562 NRLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTER 621

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L+D++KLF R
Sbjct: 622 SGQCNHGRPTWTQMGLNDLDKLFLR 646


>gi|86751283|ref|YP_487779.1| DNA mismatch repair protein [Rhodopseudomonas palustris HaA2]
 gi|123292100|sp|Q2ISE2|MUTL_RHOP2 RecName: Full=DNA mismatch repair protein mutL
 gi|86574311|gb|ABD08868.1| DNA mismatch repair protein MutL [Rhodopseudomonas palustris HaA2]
          Length = 597

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 232/596 (38%), Positives = 360/596 (60%), Gaps = 2/596 (0%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E I+N+IAAGE++ERP+  +KEL+EN++DA +SR++    GGG+    I D+G
Sbjct: 1   MPVRQLPETIVNRIAAGEVVERPASVVKELVENAIDAGASRIDIFSDGGGRRKIVIADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT  ++ +AV RH TSK+ D D   I T GFRGEALPSIGAV+ LT+ +R        
Sbjct: 61  SGMTRADLALAVDRHATSKLDDEDLLQIRTLGFRGEALPSIGAVARLTITTRHAGEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + + G   S + P A++ GT VEV DLFF  PARL FLK+++ E   I DV+RR+A+A 
Sbjct: 121 TLGVEGGDKSPIAPAALSQGTRVEVADLFFATPARLKFLKTDRTEAEAIRDVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           P ++FT +  +                  R+  ++G DF  NA+E+  +   + ++G+  
Sbjct: 181 PDIAFTLAGEERAPVTWAAALPGAPGQLIRLGDILGADFRANAIEVRSEREGVAVEGFAA 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P   R NA   Y+F+NGR V+DK IL  +R AY++ +P  R+PVV L + ++ R+VD N
Sbjct: 241 SPALTRANALGQYLFVNGRPVRDKLILGAVRAAYSDYLPRDRHPVVALFVTLESREVDAN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHPAK+ +RFRN  ++R  I+ ++++ + ++G  T++  +  +IS+F   + P  +    
Sbjct: 301 VHPAKTEVRFRNAGLVRALIVHALKEGLAREGRRTAANSAGSVISTFRPASMPAANWDWR 360

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYI 418
           A+             +               ++        +     LG A  QIH+ YI
Sbjct: 361 ASPSYPVGGSAIDAPSFAERPQAAFDVGGPSADIRTHEVAPDLLDRPLGAARTQIHETYI 420

Query: 419 ISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDE 478
           +SQT DGL++VDQHAAHER+++E+++    +  +  Q LL P+I+++ E     ++   +
Sbjct: 421 VSQTRDGLIVVDQHAAHERIVYERLKASLAANGVQRQILLIPDIVEMDEATVERLVARAD 480

Query: 479 DLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILA 538
           +L + G+  E FGP A+A+RE P++L K +   LLRD+ + + +      L+ R+ ++ A
Sbjct: 481 ELAQFGLVVESFGPGAVAVRETPSLLGKTDAASLLRDLAEHMAEWDEALPLERRLMHVAA 540

Query: 539 TMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           TMAC+GS+R+GR ++  EMN LLREME  PNS QCNHGRPT+++L L+DIEKLFGR
Sbjct: 541 TMACHGSVRAGRVLKPEEMNALLREMEATPNSGQCNHGRPTYVELTLTDIEKLFGR 596


>gi|330971552|gb|EGH71618.1| DNA mismatch repair protein [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 648

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 218/625 (34%), Positives = 343/625 (54%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDVDVEQAGIKLLKVRDDGS 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++   +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTARARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S   V   +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLYRALGDVRPENQLGGSVPVVAETRPSGPEAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTY----------------------- 389
             +      L   Q + F +               T                        
Sbjct: 382 GEMRLANNMLEQPQGEPFARPAAGGGAGSGYQYQYTPRPTAGVPVAEAQSAYREFFAPLP 441

Query: 390 SEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
           S     + ES      LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    +
Sbjct: 442 SAAPASLPESPGDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMAN 501

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE I + + E     EH     RLG + +R GP  +AIR+IPA+L +   
Sbjct: 502 EGLSGQPLLVPESIAVSQREADCAEEHLATFQRLGFELQRLGPETLAIRQIPALLKQAEA 561

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    
Sbjct: 562 NRLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTER 621

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L+D++KLF R
Sbjct: 622 SGQCNHGRPTWTQMGLNDLDKLFLR 646


>gi|99079943|ref|YP_612097.1| DNA mismatch repair protein [Ruegeria sp. TM1040]
 gi|99036223|gb|ABF62835.1| DNA mismatch repair protein MutL [Ruegeria sp. TM1040]
          Length = 644

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 266/620 (42%), Positives = 386/620 (62%), Gaps = 29/620 (4%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA ++R+   IA GGK+  ++ DNG G
Sbjct: 25  IRQLDDGAINRIAAGEVVERPASAVKELVENAIDAGATRITVEIADGGKTLIRVIDNGCG 84

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT E++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  L + SR   ++  AQI
Sbjct: 85  MTPEDLPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLAITSRAEGHD-AAQI 143

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +SG  +  VRP A+  G+IVE+RDLFF  PARL F+++++ E   I+D ++R+A+A P 
Sbjct: 144 RVSGGHMEPVRPAALRQGSIVELRDLFFATPARLKFMRTDRAEMQAISDTVKRLAMAEPS 203

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT    S     R        NG+  +    R++ VIG +F  NA++++     I L 
Sbjct: 204 VGFTLRDVSGGGEGRVTFRADPMNGDLFDALHGRLAHVIGREFAENALKIDATREGIRLY 263

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   ++F+N R V+DK +   +R AY + +   R+P   L ++ DP  
Sbjct: 264 GYAALPTYSRGAAVTQFLFVNARPVKDKMLTGALRAAYMDFLSRDRHPAAALFIDCDPTL 323

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR+P + R  I+ +++ A+ + G   SS ++   + +   +    T 
Sbjct: 324 VDVNVHPAKSEVRFRDPGLARGLIVSALRHALAEAGHRASSTVAGATLGAMRPEQPTATG 383

Query: 355 LPK---------------YATSLTNTQEKLFLQENRLSTNDLLPSDDPTYS-----EDND 394
            P+               YA       +         S          TYS     E   
Sbjct: 384 APRVYQMDRPSLGARHSAYAAQTPAQPQAPSYAAPPPSDAVGFAEFSGTYSGRLVEETPL 443

Query: 395 PVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITS 454
              +  A    LG A  Q+H+NYII+QT DG+VIVDQHAAHERL++E++++      + +
Sbjct: 444 EEAQPPAEDQPLGAARGQVHENYIIAQTRDGMVIVDQHAAHERLVYERLKRQLAENGVAT 503

Query: 455 QTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLR 514
           Q LL PEII+L +G+CA ++E  EDL RLG+  E FG +A+A+RE PAIL + N   ++R
Sbjct: 504 QGLLIPEIIELSDGDCARLLEVAEDLARLGLGIEAFGGSAVAVRETPAILGEVNAEAMIR 563

Query: 515 DIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCN 574
           DI+DE+ D   +  +Q R+E IL+ +AC+GSIRSGR+M+  EMN LLREME+ P+S QCN
Sbjct: 564 DILDELADQGESQLVQARLEAILSRVACHGSIRSGRRMRGEEMNALLREMEQTPHSGQCN 623

Query: 575 HGRPTFIKLKLSDIEKLFGR 594
           HGRPT+++LKL+DIE+LFGR
Sbjct: 624 HGRPTYVELKLADIERLFGR 643


>gi|148549974|ref|YP_001270076.1| DNA mismatch repair protein [Pseudomonas putida F1]
 gi|148514032|gb|ABQ80892.1| DNA mismatch repair protein MutL [Pseudomonas putida F1]
          Length = 633

 Score =  566 bits (1458), Expect = e-159,   Method: Composition-based stats.
 Identities = 212/625 (33%), Positives = 340/625 (54%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLD+ + R++  +  GG    ++ D+G 
Sbjct: 7   RIQLLSPRLANQIAAGEVVERPASVAKELLENSLDSGARRIDIEVEQGGVKLLKVRDDGS 66

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++++++P+A+ RH TSKI +  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 67  GISADDLPLALARHATSKIRELEDLEGVLSLGFRGEALASISSVARLTLTSRTASASEAW 126

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++   +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VIRR+A+A
Sbjct: 127 QVETEGRDMTPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIRRLALA 186

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V F       +   ++          R+  + G  F+  A+ ++ + N + L G+ G
Sbjct: 187 RFDVGFHLRHNGKSILSLHEAHDETARARRVGAICGPGFMEQALPIDVERNGLRLWGWVG 246

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL LE++P  VDVN
Sbjct: 247 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLELEPNGVDVN 306

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI-----------------------NKKGISTSS 335
           VHP K  +RFR    + +F+  ++ +A+                        + G     
Sbjct: 307 VHPTKHEVRFREGRSVHDFLYGTLHRALADVRPEDQLAAPAAVPELVRPTGQQAGEFGPQ 366

Query: 336 VLSKKMISSFHQDNAPKTHLPK------YATSLTNTQEKLFLQENRLSTNDLLPSDDPTY 389
              +       Q  AP+           Y    T    +        +          T 
Sbjct: 367 GEMRLASPVLEQPRAPQQSFSNGGSGAGYQYQYTPRPSQPLPAAEAQAVYREFYKPLDTG 426

Query: 390 SEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
           +     + ES+     LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    S
Sbjct: 427 AAPATALPESQGDIPPLGYALAQLKGIYILAENAVGLVLVDMHAAHERIMYERLKVAMAS 486

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE + L + E     EH +   RLG + +R GP  +AIR+IPA+L +   
Sbjct: 487 EGLSGQPLLVPETLALSQREADCAEEHAQWFQRLGFELQRLGPETLAIRQIPALLKQAEA 546

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L++D++ ++++  T+  +Q  +  +L TMAC+G++R+ R++   EMN LLR+ME    
Sbjct: 547 NRLVQDVLADLMEYGTSDRIQAHLNELLGTMACHGAVRANRRLAIPEMNALLRDMENTER 606

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L D++KLF R
Sbjct: 607 SGQCNHGRPTWTQMGLDDLDKLFLR 631


>gi|312958650|ref|ZP_07773170.1| DNA mismatch repair protein [Pseudomonas fluorescens WH6]
 gi|311287193|gb|EFQ65754.1| DNA mismatch repair protein [Pseudomonas fluorescens WH6]
          Length = 640

 Score =  565 bits (1457), Expect = e-159,   Method: Composition-based stats.
 Identities = 213/630 (33%), Positives = 348/630 (55%), Gaps = 39/630 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENS+D+ + R++  +  GG    ++ D+G 
Sbjct: 11  RIELLSPRLANQIAAGEVVERPASVIKELLENSIDSGAKRIDVDVEQGGVKLLRVRDDGS 70

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR        
Sbjct: 71  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRNAEQAW 130

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++   +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+R+A+A
Sbjct: 131 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRLALA 190

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++          R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 191 RFDVAFHLRHNGKTILSLHEAHDEAARARRVSAICGAGFLEQALPIEIERNGLRLWGWVG 250

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 251 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAVVDVN 310

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAP------- 351
           VHP K  +RFR+  ++ +F+  ++ +A+    +     LS  ++++  + + P       
Sbjct: 311 VHPTKHEVRFRDGRMVHDFLYGTLHRALG--DVRPDDQLSAPIVTAMVRPSGPEAGEFGP 368

Query: 352 -----------KTHLPKYATSLTN---------------TQEKLFLQENRLSTNDLLPSD 385
                      ++  P+ + S T                 Q  + + E + +  +     
Sbjct: 369 QGEMSLAGNLLQSPAPQPSYSSTPGSGSGAGYQYQYTPRPQSTVPVAEAQAAYREFFAXX 428

Query: 386 DPTYSEDNDP-VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMR 444
                      + E       LG A AQ+   YI+++   GLV+VD HAAHER+++E+++
Sbjct: 429 XXXXXXXXAVSLPEGGGDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLK 488

Query: 445 QDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAIL 504
               S  ++ Q LL PE + + + E     EH +   +LG + +R GP  +AIR+IPA+L
Sbjct: 489 IAMASEGLSGQPLLVPESLAVSQREADCAEEHHDVFQKLGFELQRLGPETLAIRQIPALL 548

Query: 505 SKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREM 564
            +    +L+ D++ ++++  T+  +Q  I  +L TMAC+G++R+ R++   EMN LLR+M
Sbjct: 549 KQAEANRLVADVLADLMEYGTSDRIQAHINELLGTMACHGAVRANRRLALPEMNGLLRDM 608

Query: 565 EKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           E    S QCNHGRPT+ ++ L D++KLF R
Sbjct: 609 ENTERSGQCNHGRPTWTQMGLDDLDKLFLR 638


>gi|26991574|ref|NP_746999.1| DNA mismatch repair protein [Pseudomonas putida KT2440]
 gi|37999611|sp|Q88DD1|MUTL_PSEPK RecName: Full=DNA mismatch repair protein mutL
 gi|24986662|gb|AAN70463.1|AE016688_2 DNA mismatch repair protein MutL [Pseudomonas putida KT2440]
          Length = 632

 Score =  565 bits (1457), Expect = e-159,   Method: Composition-based stats.
 Identities = 212/625 (33%), Positives = 340/625 (54%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLD+ + R++  +  GG    ++ D+G 
Sbjct: 6   RIQLLSPRLANQIAAGEVVERPASVAKELLENSLDSGARRIDIEVEQGGVKLLKVRDDGS 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++++++P+A+ RH TSKI +  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 66  GISADDLPLALARHATSKIRELEDLEGVLSLGFRGEALASISSVARLTLTSRTASASEAW 125

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++   +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VIRR+A+A
Sbjct: 126 QVETEGRDMTPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIRRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V F       +   ++          R+  + G  F+  A+ ++ + N + L G+ G
Sbjct: 186 RFDVGFHLRHNGKSILSLHEAHDEIARARRVGAICGPGFMEQALPIDVERNGLRLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL LE++P  VDVN
Sbjct: 246 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLELEPNGVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI-----------------------NKKGISTSS 335
           VHP K  +RFR    + +F+  ++ +A+                        + G     
Sbjct: 306 VHPTKHEVRFREGRSVHDFLYGTLHRALADVRPEDQLAAPAAVPELVRPTGQQAGEFGPQ 365

Query: 336 VLSKKMISSFHQDNAPKTHLPK------YATSLTNTQEKLFLQENRLSTNDLLPSDDPTY 389
              +       Q  AP+           Y    T    +        +          T 
Sbjct: 366 GEMRLASPVLEQPRAPQQSFSNGGSGAGYQYQYTPRPSQPLPAAEAQAVYREFYKPLETG 425

Query: 390 SEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
           +     + ES+     LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    S
Sbjct: 426 AAPATALPESQGDIPPLGYALAQLKGIYILAENAVGLVLVDMHAAHERIMYERLKVAMAS 485

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE + L + E     EH +   RLG + +R GP  +AIR+IPA+L +   
Sbjct: 486 EGLSGQPLLVPETLALSQREADCAEEHAQWFQRLGFELQRLGPETLAIRQIPALLKQAEA 545

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L++D++ ++++  T+  +Q  +  +L TMAC+G++R+ R++   EMN LLR+ME    
Sbjct: 546 NRLVQDVLADLMEYGTSDRIQAHLNELLGTMACHGAVRANRRLAIPEMNALLRDMENTER 605

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L D++KLF R
Sbjct: 606 SGQCNHGRPTWTQMGLDDLDKLFLR 630


>gi|71275150|ref|ZP_00651437.1| DNA mismatch repair protein [Xylella fastidiosa Dixon]
 gi|71898231|ref|ZP_00680405.1| DNA mismatch repair protein [Xylella fastidiosa Ann-1]
 gi|170731141|ref|YP_001776574.1| DNA mismatch repair protein [Xylella fastidiosa M12]
 gi|238687954|sp|B0U5C6|MUTL_XYLFM RecName: Full=DNA mismatch repair protein mutL
 gi|71163959|gb|EAO13674.1| DNA mismatch repair protein [Xylella fastidiosa Dixon]
 gi|71731970|gb|EAO34027.1| DNA mismatch repair protein [Xylella fastidiosa Ann-1]
 gi|167965934|gb|ACA12944.1| DNA mismatch repair protein MutL [Xylella fastidiosa M12]
          Length = 621

 Score =  565 bits (1457), Expect = e-159,   Method: Composition-based stats.
 Identities = 219/621 (35%), Positives = 349/621 (56%), Gaps = 29/621 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN++DA ++RV+  +   G    +I DNG
Sbjct: 1   MPIRQLPEILINQIAAGEVVERPASVVKELVENAIDAGATRVDIELEAAGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            GM ++E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TLMSR   +  G
Sbjct: 61  HGMAAQELPLAVLRHATSKIASLDDLEAVATLGFRGEALPSIASVSRFTLMSRRATDEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           A + I G  +  V P A  PGT VEVR+LF+ +PAR  FL++E+ E   I +  R +A+A
Sbjct: 121 AVLQIEGGTLGEVIPHAHAPGTTVEVRELFYNVPARRKFLRAERTELGHIEEWARSLALA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +P +    S       +        +    + +++GEDF + A+ ++     + L G   
Sbjct: 181 HPDLELRLSHNGKLSRRYKPGDWYSDAR--LIEILGEDFAHQALRVDHSGAGLRLHGCIV 238

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P ++R NA+Q Y+++NGR V+D+ +   ++ AY++ +  GR+P  VL LE+DP +VDVN
Sbjct: 239 QPHYSRLNADQQYLYVNGRPVRDRSVAHAVKQAYSDVLYQGRHPAYVLFLELDPARVDVN 298

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKK--GISTSSVLSKKMISSFHQDNAPKTHLP 356
           VHPAK  +RFR+  +I +F+ +++Q  + +   G    +V    +         P  H  
Sbjct: 299 VHPAKHEVRFRDARLIHDFVYRTVQGTLAQTRAGTPPLAVGVGDVEGEGEGARPPGRHAV 358

Query: 357 KYAT----------SLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHY-- 404
            ++           S + +   L      +S  D   +    Y+     V ++       
Sbjct: 359 SFSGRRGGASHVLGSYSTSTAPLMQGVPSVSVADAPAAYAALYAAPPTQVMDAVPQMQTG 418

Query: 405 -----------QLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKIT 453
                       LG A AQ+H  YI+++  DGL++VD HAAHER+ +E++++  +   + 
Sbjct: 419 LPLAAGAGDVPPLGYAIAQLHGIYILAECADGLIVVDMHAAHERIGYERLKRAHDGIGLR 478

Query: 454 SQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLL 513
           +Q LL P  + + E E  +     E L  LG +  R GP ++ +R IPA+LS+     LL
Sbjct: 479 TQPLLVPMTLMVAEREADVAECEAETLASLGFEVTRSGPGSLQVRSIPALLSQAEPEMLL 538

Query: 514 RDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQC 573
           RD++ ++ +   T  + +  + +LATMAC+G++R+ R++   EMN LLR+ME    S QC
Sbjct: 539 RDVLSDLSEHGHTRRVAEARDTLLATMACHGAVRAHRRLSISEMNALLRDMEATERSGQC 598

Query: 574 NHGRPTFIKLKLSDIEKLFGR 594
           NHGRPT+ +  L++I++ F R
Sbjct: 599 NHGRPTWARFSLAEIDRWFLR 619


>gi|330984562|gb|EGH82665.1| DNA mismatch repair protein [Pseudomonas syringae pv. lachrymans
           str. M301315]
          Length = 648

 Score =  565 bits (1456), Expect = e-159,   Method: Composition-based stats.
 Identities = 215/625 (34%), Positives = 344/625 (55%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDVDVEQAGIKLLKVRDDGG 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++   +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    + +   R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTSRARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S    +  +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPENQLGGSVPVAVEPRPTGPEAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDN------------------- 393
             +      L   Q + F +               T    +                   
Sbjct: 382 GEMRLANNVLEQPQGEPFARPAAGGGAGSGYQYQYTPRPTSGVPVAEAQSAYREFFAPLP 441

Query: 394 ----DPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                 + ES      LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    +
Sbjct: 442 STAPSSLPESPGDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMAN 501

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE + + + E     EH     RLG + +R GP  +AIR+IPA+L +   
Sbjct: 502 EGLSGQPLLVPESLAVSQREADCAEEHIATFQRLGFELQRLGPETLAIRQIPALLKQAEA 561

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    
Sbjct: 562 NRLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTER 621

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L+D++KLF R
Sbjct: 622 SGQCNHGRPTWTQMGLNDLDKLFLR 646


>gi|257482413|ref|ZP_05636454.1| DNA mismatch repair protein [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|331009762|gb|EGH89818.1| DNA mismatch repair protein [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 648

 Score =  565 bits (1456), Expect = e-159,   Method: Composition-based stats.
 Identities = 215/625 (34%), Positives = 345/625 (55%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDVDVEQAGIKLLKVRDDGG 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++   +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    + +   R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTSRARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S    +  +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPENQLGGSVPVAVEPRPTGPEAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDN------------------- 393
             +      L + Q + F +               T    +                   
Sbjct: 382 GEMRLANNVLEHPQGEPFARPAAGGGAGSGYQYQYTPRPTSGVPVAEAQSAYREFFAPLP 441

Query: 394 ----DPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                 + ES      LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    +
Sbjct: 442 STAPSSLPESPGDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMAN 501

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE + + + E     EH     RLG + +R GP  +AIR+IPA+L +   
Sbjct: 502 EGLSGQPLLVPESLAVSQREADCAEEHIATFQRLGFELQRLGPETLAIRQIPALLKQAEA 561

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    
Sbjct: 562 NRLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTER 621

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L+D++KLF R
Sbjct: 622 SGQCNHGRPTWTQMGLNDLDKLFLR 646


>gi|167035937|ref|YP_001671168.1| DNA mismatch repair protein [Pseudomonas putida GB-1]
 gi|189030406|sp|B0KKZ7|MUTL_PSEPG RecName: Full=DNA mismatch repair protein mutL
 gi|166862425|gb|ABZ00833.1| DNA mismatch repair protein MutL [Pseudomonas putida GB-1]
          Length = 632

 Score =  565 bits (1456), Expect = e-159,   Method: Composition-based stats.
 Identities = 209/625 (33%), Positives = 339/625 (54%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLD+ + R++  +  GG    ++ D+G 
Sbjct: 6   RIQLLSPRLANQIAAGEVVERPASVAKELLENSLDSGARRIDVEVEQGGVKLLKVRDDGS 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++++++P+A+ RH TSKI +  D   + + GFRGEAL SI +V+ LT+ SR    +   
Sbjct: 66  GISADDLPLALARHATSKIRELEDLEGVMSLGFRGEALASISSVARLTMTSRTASASEAW 125

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++   +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VIRR+A+A
Sbjct: 126 QVETEGRDMTPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIRRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V F       +   ++          R+  + G  F+  A+ ++ + N + L G+ G
Sbjct: 186 RFDVGFHLRHNGKSILSLHEAHDETARARRVGAICGPGFMEQALPIDVERNGLRLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL LE++P  VDVN
Sbjct: 246 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLELEPNGVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI-----------------------NKKGISTSS 335
           VHP K  +RFR    + +F+  ++ +A+                        + G     
Sbjct: 306 VHPTKHEVRFREGRSVHDFLYGTLHRALADVRPEDQLAAPAAVPELARPTGQQAGEFGPQ 365

Query: 336 VLSKKMISSFHQDNAPKTHLPK------YATSLTNTQEKLFLQENRLSTNDLLPSDDPTY 389
              +       Q  AP+           Y    T    +        +            
Sbjct: 366 GEMRLASPVLEQPRAPQQSFSNGGSGAGYQYQYTPRPSQPLPAAEAQAVYREFYKPLDNG 425

Query: 390 SEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
           +     + ES+     LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    S
Sbjct: 426 AAAATALPESQGDIPPLGYALAQLKGIYILAENAVGLVLVDMHAAHERIMYERLKVAMAS 485

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE + L + E     EH +   RLG + +R GP  +A+R+IPA+L +   
Sbjct: 486 EGLSGQPLLVPETLALSQREADCAEEHAQWFQRLGFELQRLGPETLAVRQIPALLKQAEA 545

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L++D++ ++++  T+  +Q  +  +L TMAC+G++R+ R++   EMN LLR+ME    
Sbjct: 546 NRLVQDVLADLMEYGTSDRIQAHLNELLGTMACHGAVRANRRLAIPEMNALLRDMENTER 605

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L D++KLF R
Sbjct: 606 SGQCNHGRPTWTQMGLDDLDKLFLR 630


>gi|330951472|gb|EGH51732.1| DNA mismatch repair protein [Pseudomonas syringae Cit 7]
          Length = 648

 Score =  565 bits (1456), Expect = e-159,   Method: Composition-based stats.
 Identities = 218/625 (34%), Positives = 343/625 (54%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDVDVEQAGIKLLKVRDDGS 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++   +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTARARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S   V   +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLYRALGDVRPENQLGGSVPVVAETRPSGPEAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTY----------------------- 389
             +      L   Q + F +               T                        
Sbjct: 382 GEMRLANNVLEQPQGESFARPAAGGGAGSGYQYQYTPRPTAGVPVAEAQSAYREFFAPLP 441

Query: 390 SEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
           S     + ES      LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    +
Sbjct: 442 SAAPASLPESPGDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMAN 501

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE I + + E     EH     RLG + +R GP  +AIR+IPA+L +   
Sbjct: 502 EGLSGQPLLVPESIAVSQREADCAEEHLATFQRLGFELQRLGPETLAIRQIPALLKQAEA 561

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    
Sbjct: 562 NRLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTER 621

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L+D++KLF R
Sbjct: 622 SGQCNHGRPTWTQMGLNDLDKLFLR 646


>gi|289623754|ref|ZP_06456708.1| DNA mismatch repair protein [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289648629|ref|ZP_06479972.1| DNA mismatch repair protein [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|320321886|gb|EFW77982.1| DNA mismatch repair protein [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320331009|gb|EFW86983.1| DNA mismatch repair protein [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330865892|gb|EGH00601.1| DNA mismatch repair protein [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 648

 Score =  565 bits (1455), Expect = e-159,   Method: Composition-based stats.
 Identities = 215/625 (34%), Positives = 343/625 (54%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDVDVEQAGIKLLKVRDDGG 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++   +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    + +   R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTSRARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S       +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPENQLGGSVPVAAEPRPTGPEAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDN------------------- 393
             +      L   Q + F +               T    +                   
Sbjct: 382 GEMRLANNVLEQPQGEPFARPAAGGGAGSGYQYQYTPRPTSGVPVAEAQSAYREFFAPLP 441

Query: 394 ----DPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                 + ES      LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    +
Sbjct: 442 STAPSSLPESPGDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMAN 501

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE + + + E     EH     RLG + +R GP  +AIR+IPA+L +   
Sbjct: 502 EGLSGQPLLVPESLAVSQREADCAEEHIATFQRLGFELQRLGPETLAIRQIPALLKQAEA 561

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    
Sbjct: 562 NRLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTER 621

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L+D++KLF R
Sbjct: 622 SGQCNHGRPTWTQMGLNDLDKLFLR 646


>gi|288958816|ref|YP_003449157.1| DNA mismatch repair protein [Azospirillum sp. B510]
 gi|288911124|dbj|BAI72613.1| DNA mismatch repair protein [Azospirillum sp. B510]
          Length = 643

 Score =  565 bits (1455), Expect = e-158,   Method: Composition-based stats.
 Identities = 239/642 (37%), Positives = 373/642 (58%), Gaps = 48/642 (7%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR L E ++N+IAAGE++ERP+ A+KEL+EN++DA ++R++ V   GGKS   +TD+G
Sbjct: 1   MPIRLLPETLVNRIAAGEVVERPAAAVKELVENAIDAGATRIDVVARDGGKSLIAVTDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT++E+ +AV+RH TSK+  DD  +I + GFRGEALPSIGAVS LT+ SR    ++  
Sbjct: 61  CGMTADELVLAVERHATSKLPGDDLLDIRSLGFRGEALPSIGAVSCLTITSRARGADSAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + +      S +P A+  GT +EVRDLF  +PARL FLK+ + E + I D + R+A+A+
Sbjct: 121 SLTVDAGAKGSPQPAALAQGTRIEVRDLFAAVPARLKFLKASRTEYDHIADCLERLAMAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTN--GNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P V+FT S       +++            R+  ++G DF  NAV +      +TL G+ 
Sbjct: 181 PAVAFTLSDGGRGGLRLSAAQGELLDARLTRLGALMGRDFQENAVPVTAAREGVTLAGWI 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PT +R  A   ++F+NGR V+DK ++  +R AYA+ +P  R+P++ L L+IDP++VDV
Sbjct: 241 GLPTLHRPTAKHQHLFVNGRPVRDKLMVGAVRAAYADFLPRDRHPMLALFLDIDPQEVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAP------ 351
           NVHPAK+ +RFR+  ++R  I+ S++ A+ + G   S+ +    + +   +         
Sbjct: 301 NVHPAKAEVRFRDQGLVRGLIVGSLKHALAEAGHRASTTVGLATLGALRPEPGGGSVGES 360

Query: 352 ----------------------------------KTHLPKYATSLTNTQEKLFLQENRL- 376
                                                L + + +     + L   + RL 
Sbjct: 361 GGESGGFTPSPLPYGRSGGGSGSGWGGSYAPAALPRGLAERSAAFQAPAQGLPPLQGRLG 420

Query: 377 ----STNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQH 432
                        +    +   P  E     + LG A AQ+H  YI++QT +G+VIVDQH
Sbjct: 421 GFGNGFAPAARPPEYRAPDPAAPTPEPPPDSHPLGAARAQLHTTYIVAQTREGIVIVDQH 480

Query: 433 AAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGP 492
           AAHERL++E+M+       +  Q LL PE+I+L E     ++    +L  LG+  E FG 
Sbjct: 481 AAHERLVYERMKTALLEGGVKRQALLIPELIELDEPSANRLLARGAELAELGLVIEGFGH 540

Query: 493 NAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKM 552
             + +RE+PA+L + ++  L+RD+ +E+ +     +L++R+E + ATMAC+GS+R+GR +
Sbjct: 541 GCVMVREVPALLGQSDVKNLIRDLAEELSELGDALSLKERLEEVCATMACHGSVRAGRTL 600

Query: 553 QSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
              EMN LLR+ME  P+S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 601 SVDEMNALLRQMEATPHSGQCNHGRPTYVELKLADIERLFGR 642


>gi|190890558|ref|YP_001977100.1| DNA mismatch repair protein [Rhizobium etli CIAT 652]
 gi|238692496|sp|B3PRD9|MUTL_RHIE6 RecName: Full=DNA mismatch repair protein mutL
 gi|190695837|gb|ACE89922.1| DNA mismatch repair protein [Rhizobium etli CIAT 652]
          Length = 606

 Score =  564 bits (1454), Expect = e-158,   Method: Composition-based stats.
 Identities = 303/607 (49%), Positives = 408/607 (67%), Gaps = 15/607 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+LSE +INQIAAGE+IERP+ A KELIEN+LDA ++R+E   AGGGK+  +++DNG
Sbjct: 1   MAIRQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIATAGGGKALLRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM + ++ +AV+RHCTSKIS+   +I T GFRGEALPSIG+V+ L + SR   +  G +
Sbjct: 61  SGMEATDLELAVRRHCTSKISETLEDIRTLGFRGEALPSIGSVARLNIASRRRDSAGGHE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA++G KI  +RP A NPGTIVEVRDLFF  PARL FLKSE+ E   IT++++RMAIA+P
Sbjct: 121 IAVAGGKIVHIRPAAANPGTIVEVRDLFFATPARLKFLKSEKAEAGAITEIVKRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V F  S   S+R  + F +T  +   R++QV+G++F +NA+ L+    +I+L G+ G+P
Sbjct: 181 AVRFVLS--GSDRTTLEFPATGDDHLARMAQVLGKEFRDNAILLDAVREDISLTGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+   Y F+NGR VQDK ILS IR AYAETIP GRYPV VL + +DP  VDVNVH
Sbjct: 239 TFNRGNSAHQYAFVNGRPVQDKLILSAIRGAYAETIPSGRYPVAVLSITLDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           PAKS +RFR+P ++R  I+ +I++A+ + G   ++  +  M+ +F     P    P+   
Sbjct: 299 PAKSDVRFRDPGLVRGLIVGAIREALARDGSRAATTGASDMLRAFRPGFQPHAQRPQAPW 358

Query: 361 SLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEAT-------------HYQLG 407
           S   +  + +      S       D  +       ++ S                 Y LG
Sbjct: 359 SAETSPFRPYPPAAGFSERPQASFDRLSMPTARAELQPSPQPGAPEPAASAETTGRYPLG 418

Query: 408 IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLE 467
            A AQIH NYI++QT DGLVIVDQHAAHERL+FE MR+  +S ++ SQ LL PEIIDL E
Sbjct: 419 AARAQIHANYIVAQTEDGLVIVDQHAAHERLVFEAMRKALHSKRLASQVLLIPEIIDLPE 478

Query: 468 GECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTY 527
            +C  +M+H  +L  LG+  ERFGP AIA+RE PA+L + +   L+R + DEI +  T  
Sbjct: 479 EDCDRLMQHAAELSELGLAIERFGPGAIAVRETPAMLGEVDAHGLIRQLADEIAEWDTAS 538

Query: 528 TLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSD 587
            L  ++E + ATMAC+GS+RSGR+++  EMN LLREME  P S QCNHGRPT+I+LKLSD
Sbjct: 539 GLSAKLEYVAATMACHGSVRSGRRLRPEEMNALLREMEVTPGSGQCNHGRPTYIELKLSD 598

Query: 588 IEKLFGR 594
           IE+LFGR
Sbjct: 599 IERLFGR 605


>gi|302189791|ref|ZP_07266464.1| DNA mismatch repair protein [Pseudomonas syringae pv. syringae 642]
          Length = 648

 Score =  564 bits (1454), Expect = e-158,   Method: Composition-based stats.
 Identities = 217/625 (34%), Positives = 343/625 (54%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDVDVEQAGIKLLKVRDDGG 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++   +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTARARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S   V   +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLYRALGDVRPENQLGGSVPVVAETRPSGPEAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDN------------------- 393
             +      L   Q + F +               T    +                   
Sbjct: 382 GEMRLANNVLEQPQGEPFARPAAAGGTGSGYQYQYTPRPTSGVPVAEAQSAYREFFAPLP 441

Query: 394 ----DPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                 + ES      LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    +
Sbjct: 442 SAAPASLPESPGDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMAN 501

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE I + + E     EH     RLG + +R GP  +AIR+IPA+L +   
Sbjct: 502 EGLSGQPLLVPESIAVSQREADCAEEHLATFQRLGFELQRLGPETLAIRQIPALLKQAEA 561

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    
Sbjct: 562 NRLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTER 621

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L+D++KLF R
Sbjct: 622 SGQCNHGRPTWTQMGLNDLDKLFLR 646


>gi|71738065|ref|YP_272865.1| DNA mismatch repair protein [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|298484916|ref|ZP_07003015.1| DNA mismatch repair protein MutL [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|71558618|gb|AAZ37829.1| DNA mismatch repair protein MutL [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|298160603|gb|EFI01625.1| DNA mismatch repair protein MutL [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 648

 Score =  564 bits (1454), Expect = e-158,   Method: Composition-based stats.
 Identities = 216/625 (34%), Positives = 343/625 (54%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDVDVEQAGIKLLKVRDDGG 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++   +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTMLSLHEAHDDTARARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S       +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPENQLGGSVPVAAEPRPTGPEAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTY----------------------- 389
             +      L   Q + F +               T                        
Sbjct: 382 GEMRLANNVLEQPQGEPFARPAAGGGAGSGYQYQYTPRPTSGVPVAEAQSAYREFFAPLP 441

Query: 390 SEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
           S  +  + ES      LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    +
Sbjct: 442 SAASSSLPESPGDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMAN 501

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE + + + E     EH     RLG + +R GP  +AIR+IPA+L +   
Sbjct: 502 EGLSGQPLLVPESLAVSQREADCAEEHIATFQRLGFELQRLGPETLAIRQIPALLKQAEA 561

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    
Sbjct: 562 NRLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTER 621

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L+D++KLF R
Sbjct: 622 SGQCNHGRPTWTQMGLNDLDKLFLR 646


>gi|134093680|ref|YP_001098755.1| DNA mismatch repair protein [Herminiimonas arsenicoxydans]
 gi|166232092|sp|A4G289|MUTL_HERAR RecName: Full=DNA mismatch repair protein mutL
 gi|133737583|emb|CAL60626.1| DNA mismatch repair protein MutL [Herminiimonas arsenicoxydans]
          Length = 612

 Score =  564 bits (1453), Expect = e-158,   Method: Composition-based stats.
 Identities = 205/605 (33%), Positives = 336/605 (55%), Gaps = 16/605 (2%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            I+ LS+++I+QIAAGE++ERPS  +KEL+EN+LDA ++ +   +  GG     ITDNG 
Sbjct: 10  PIQALSDQLISQIAAGEVVERPSAVVKELLENALDAGATHISVRLEQGGVKRIAITDNGR 69

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  E++P+A+ RH TSKI+   +  N+ T GFRGEAL SI +VS LTL SR        
Sbjct: 70  GIAPEQLPLALARHATSKINSLTELENVATLGFRGEALASIASVSQLTLTSRTADAAHAW 129

Query: 120 QI--AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           +I    S ++ S+V P +   GT V+V DL+F  PAR  FLK+EQ E     +V+RR+A+
Sbjct: 130 EISGVQSIDQKSTVAPSSGTAGTTVDVLDLYFNTPARRKFLKTEQTEFGHCAEVVRRIAL 189

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           + P V+F+ +                +   R + ++G +F    + L E +  + L G+ 
Sbjct: 190 SRPDVAFSLTHNGKTIDHW----AVNDIARRSAHILGNEFSAARLPLKETAGPLRLHGFI 245

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PT ++   +  Y ++NGR V+DK ++  +R+AY + +   RYP  V+ LE+DP  VDV
Sbjct: 246 GLPTASKARGDAQYFYVNGRFVRDKLLMHAVRSAYQDVLHGDRYPSYVISLELDPALVDV 305

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINK-----KGISTSSVLSKKMISSFHQDNAPK 352
           NVHP+K  +RFR+   +  F+  ++ +A+ +      G + S   +      + ++    
Sbjct: 306 NVHPSKIEVRFRDSRAVHQFVFHAVTRALAQTSATAFGAAPSPTPAPSSALPWLREQQQS 365

Query: 353 THLPKYATSLTNTQEKLFLQE---NRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIA 409
           T  P++ +     Q          N  ++ND   +    ++  +          + LG A
Sbjct: 366 TFAPQFNSPYGVAQSAANYGALFANGPASNDSNSAAPSLHTAGSHGATTLPDDEFPLGFA 425

Query: 410 CAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGE 469
            AQ+H  +I++Q T GLV+VD HAAHER+++E+++   +  ++  Q LL P        E
Sbjct: 426 LAQLHGIFILAQNTKGLVLVDMHAAHERILYEQLKHALDDNELQVQPLLIPITFYADGME 485

Query: 470 CALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTL 529
                ++ + LH LG       P  +A+R +PA+L   +   L RD++ ++ +   +  L
Sbjct: 486 VGTTEDNQDILHALGFDIAALSPTTLAVRAVPALLKNADAQTLARDVLRDVREFGGSRVL 545

Query: 530 QDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIE 589
            +R   +L T+AC+ ++R+ R +   EMN LLR+ME    + QCNHGRPT+++L LSD++
Sbjct: 546 LERRNELLGTLACHTAVRANRTLTVPEMNALLRQMEATERADQCNHGRPTWVQLGLSDLD 605

Query: 590 KLFGR 594
           KLF R
Sbjct: 606 KLFER 610


>gi|254510493|ref|ZP_05122560.1| DNA mismatch repair protein MutL [Rhodobacteraceae bacterium KLH11]
 gi|221534204|gb|EEE37192.1| DNA mismatch repair protein MutL [Rhodobacteraceae bacterium KLH11]
          Length = 616

 Score =  564 bits (1453), Expect = e-158,   Method: Composition-based stats.
 Identities = 261/602 (43%), Positives = 382/602 (63%), Gaps = 11/602 (1%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA ++R+   IA GGK+  ++TD+G G
Sbjct: 15  IRQLDDAAINRIAAGEVVERPASAVKELVENAIDAGATRIAIDIADGGKTLIRVTDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           + + ++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  L++ SR P     A I
Sbjct: 75  IAASDLPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLSITSRVPGAE-AASI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +SG ++ +VRP A+  GT+VE+RDLF+  PARL F+++++ E   I+D+++R+A+A P 
Sbjct: 134 RVSGGQMQAVRPAALRAGTVVELRDLFYATPARLKFMRTDRAEAQAISDIVKRLAMAEPA 193

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           VSFT    S     R        NG+  +    R+++V+G +F  NA++++     I L 
Sbjct: 194 VSFTLRDVSGGGEGRVTFRTDRENGDLFDALHARLARVLGREFAENALQIDATREGIRLY 253

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   Y+F+NGR V+DK +   +R AY + +   R+P   L ++ DP  
Sbjct: 254 GYAALPTYSRGAAVAQYLFVNGRPVRDKMLTGALRAAYFDFLSRDRHPAAALFIDCDPTL 313

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR+P + R  I+ S++ A+ + G   SS ++   + +   + AP   
Sbjct: 314 VDVNVHPAKSEVRFRDPGLARGLIVSSLRHALAEAGHRASSTVANATLGAMRPEPAPSAP 373

Query: 355 LPKYATSLTNTQEKLFLQENRLSTNDLLPSD--DPTYSEDNDPVEESEATHYQLGIACAQ 412
              Y     +   +      +      L  D          +     E     LG A  Q
Sbjct: 374 ARVYQMDRPSPAARQAAYRAQSPGFAELSQDYSGRVVDPAPEVAPVEEPQDLPLGAARGQ 433

Query: 413 IHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECAL 472
           +H+NYII+QT DG+VIVDQHAAHERL++EK++       + +Q LL PEI++L +G+C  
Sbjct: 434 VHENYIIAQTADGMVIVDQHAAHERLVYEKLKSQMAENGVAAQALLIPEIVELSDGDCTR 493

Query: 473 IMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDR 532
           +M   EDL RLG+  E FG  AIAIRE PAIL + +   ++ DI+DE+ D   +  +Q R
Sbjct: 494 LMAVAEDLSRLGLTIEAFGGGAIAIRETPAILGEVDARAMILDILDELADQGESQMVQAR 553

Query: 533 IENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLF 592
           IE IL+ +AC+GSIRSGR+M++ EMN LLREME  P+S QCNHGRPT+++LKL DIE+LF
Sbjct: 554 IEAILSRVACHGSIRSGRRMRAEEMNALLREMEATPHSGQCNHGRPTYVELKLGDIERLF 613

Query: 593 GR 594
           GR
Sbjct: 614 GR 615


>gi|313500875|gb|ADR62241.1| MutL [Pseudomonas putida BIRD-1]
          Length = 632

 Score =  563 bits (1452), Expect = e-158,   Method: Composition-based stats.
 Identities = 211/625 (33%), Positives = 339/625 (54%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLD+ + R++  +  GG    ++ D+G 
Sbjct: 6   RIQLLSPRLANQIAAGEVVERPASVAKELLENSLDSGARRIDVEVEQGGVKLLKVRDDGS 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++++++P+A+ RH TSKI +  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 66  GISADDLPLALARHATSKIRELEDLEGVLSLGFRGEALASISSVARLTLTSRTASASEAW 125

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++   +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VIRR+A+A
Sbjct: 126 QVETEGRDMTPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIRRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V F       +   ++          R+  + G  F+  A+ ++ + N + L G+ G
Sbjct: 186 RFDVGFHLRHNGKSILSLHEAHDETARARRVGAICGPGFMEQALPIDVERNGLRLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL LE++P  VDVN
Sbjct: 246 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLELEPNGVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI-----------------------NKKGISTSS 335
           VHP K  +RFR    + +F+  ++ +A+                        + G     
Sbjct: 306 VHPTKHEVRFREGRSVHDFLYGTLHRALADVRPEDQLAAPAAVPELVRPTGQQAGEFGPQ 365

Query: 336 VLSKKMISSFHQDNAPKTHLPK------YATSLTNTQEKLFLQENRLSTNDLLPSDDPTY 389
              +       Q  AP+           Y    T    +        +            
Sbjct: 366 GEMRLASPVLEQPRAPQQSFSNSGSGAGYQYQYTPRPSQPLPAAEAQAVYREFYKPLEGG 425

Query: 390 SEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
           +     + ES+     LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    S
Sbjct: 426 AAPATALPESKGDIPPLGYALAQLKGIYILAENAVGLVLVDMHAAHERIMYERLKVAMAS 485

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE + L + E     EH +   RLG + +R GP  +AIR+IPA+L +   
Sbjct: 486 EGLSGQPLLVPETLALSQREADCAEEHSQWFQRLGFELQRLGPETLAIRQIPALLKQAEA 545

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L++D++ ++++  T+  +Q  +  +L TMAC+G++R+ R++   EMN LLR+ME    
Sbjct: 546 NRLVQDVLADLMEYGTSDRIQAHLNELLGTMACHGAVRANRRLAIPEMNALLRDMENTER 605

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L D++KLF R
Sbjct: 606 SGQCNHGRPTWTQMGLDDLDKLFLR 630


>gi|325271237|ref|ZP_08137782.1| DNA mismatch repair protein [Pseudomonas sp. TJI-51]
 gi|324103640|gb|EGC00942.1| DNA mismatch repair protein [Pseudomonas sp. TJI-51]
          Length = 632

 Score =  563 bits (1452), Expect = e-158,   Method: Composition-based stats.
 Identities = 212/625 (33%), Positives = 337/625 (53%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLD+ + R++  +  GG    ++ D+G 
Sbjct: 6   RIQLLSPRLANQIAAGEVVERPASVAKELLENSLDSGARRIDVEVEQGGVKLLKVRDDGS 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++++++P+A+ RH TSKI +  D   + + GFRGEAL SI +V+ LTL SR        
Sbjct: 66  GISADDLPLALARHATSKIRELEDLEGVLSLGFRGEALASISSVARLTLTSRTASATEAW 125

Query: 120 QIAISGEKI-SSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  +   V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VIRR+A+A
Sbjct: 126 QVETEGRDMLPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIRRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V F       +   ++          R+  + G  F+  A+ ++ + N + L G+ G
Sbjct: 186 RFDVGFHLRHNGKSILSLHEAHDEVARARRVGAICGPGFMEQALPIDVERNGLRLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL LE++P  VDVN
Sbjct: 246 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLELEPNGVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI-----------------------NKKGISTSS 335
           VHP K  +RFR    + +F+  ++ +A+                        + G     
Sbjct: 306 VHPTKHEVRFREGRSVHDFLYGTLHRALADVRPEDQLAAPAAVPEAVRATGQQAGEFGPQ 365

Query: 336 VLSKKMISSFHQDNAPKTHLPK------YATSLTNTQEKLFLQENRLSTNDLLPSDDPTY 389
              +       Q  AP+           Y    T             +            
Sbjct: 366 GEMRLASPVLEQPRAPQHTASNGGSGAGYQYQYTPRPSPPLPAAEAQAVYREFYKPLDNG 425

Query: 390 SEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
           +     + ES+     LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    S
Sbjct: 426 AAPAATLPESQGDIPPLGYALAQLKGIYILAENAVGLVLVDMHAAHERIMYERLKVAMAS 485

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE + L + E     EH +   RLG + +R GP  +AIR+IPA+L +   
Sbjct: 486 EGLSGQPLLVPETLALSQREADCAEEHAQWFQRLGFELQRLGPETLAIRQIPALLKQAEA 545

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L++D++ ++++  T+  +Q  +  +L TMAC+G++R+ R++   EMN LLR+ME    
Sbjct: 546 NRLVQDVLADLMEYGTSDRIQAHLNELLGTMACHGAVRANRRLAIPEMNALLRDMENTER 605

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L D++KLF R
Sbjct: 606 SGQCNHGRPTWTQMGLDDLDKLFLR 630


>gi|27382604|ref|NP_774133.1| DNA mismatch repair protein [Bradyrhizobium japonicum USDA 110]
 gi|81841408|sp|Q89DE6|MUTL_BRAJA RecName: Full=DNA mismatch repair protein mutL
 gi|27355776|dbj|BAC52758.1| DNA mismatch repair protein [Bradyrhizobium japonicum USDA 110]
          Length = 603

 Score =  563 bits (1452), Expect = e-158,   Method: Composition-based stats.
 Identities = 235/602 (39%), Positives = 371/602 (61%), Gaps = 8/602 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E+++N+IAAGE++ERP+  +KEL+EN++DA +SR++    GGG+    ITD+G
Sbjct: 1   MPVRQLPEQVVNRIAAGEVVERPASVVKELVENAIDAGASRIDVFTDGGGRRRIGITDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT++++ +AV+RH TSK+ D D   I T GFRGEALPSIG+V+ L++ +R        
Sbjct: 61  SGMTAKDLALAVERHATSKLDDEDLLQIRTLGFRGEALPSIGSVARLSITTRHAGEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + + G + S + P A+  GT VEV DLF+  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 ALTVEGGEKSEIMPAALAHGTRVEVNDLFYATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           P V+FT +  +                  R+  ++G +F ++A+E++ +   I + GY  
Sbjct: 181 PDVAFTLAGEERAPVTWAAALPGAAGRLTRLGDILGAEFRSHAIEVHAEREGIVVSGYAA 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P   + NA   Y+F+NGR V+DK IL  +R AY++ +P  R+PV+ L + +DPR+VD N
Sbjct: 241 APALTKANALGQYLFVNGRPVRDKLILGAVRAAYSDYLPRDRHPVLALFVTLDPREVDAN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHPAK+ +RFRN  ++R  I+  +++A+ ++G  T++   +  +SSF     P+     +
Sbjct: 301 VHPAKTEVRFRNAGLVRALIVHGLKEALAREGRRTAANSGESALSSFRPAFTPRPASWDW 360

Query: 359 ATSLTNT--QEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACA----Q 412
             S +        F      +  +   +     +   D   E++     +         Q
Sbjct: 361 RASPSAPVAPMPSFDGAAAPAFTERAQAAFDVGAPSADVRFETQPVSDLVDRPLGAARTQ 420

Query: 413 IHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECAL 472
           IH+ YI+SQT DGL+IVDQHAAHER+++E ++    +  +  Q LL PEI+++ E     
Sbjct: 421 IHETYIVSQTRDGLIIVDQHAAHERIVYEGLKASLAANGVQRQILLIPEIVEMDEATVER 480

Query: 473 IMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDR 532
           ++E  ++L   G+  E FGP A+A+RE P++L K N   LLRD+ + + +      L+ R
Sbjct: 481 LLERSDELASFGLAIESFGPGAVAVRETPSLLGKTNAGGLLRDLSEHMAEWDEALPLERR 540

Query: 533 IENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLF 592
           + ++ ATMAC+GS+R+GR+++  EMN LLREME+ PNS QCNHGRPT+++LKLSD+EKLF
Sbjct: 541 LMHVAATMACHGSVRAGRRLRPEEMNALLREMEETPNSGQCNHGRPTYVELKLSDVEKLF 600

Query: 593 GR 594
           GR
Sbjct: 601 GR 602


>gi|218682547|ref|ZP_03530148.1| DNA mismatch repair protein [Rhizobium etli CIAT 894]
          Length = 600

 Score =  563 bits (1451), Expect = e-158,   Method: Composition-based stats.
 Identities = 299/601 (49%), Positives = 408/601 (67%), Gaps = 9/601 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+LSE +INQIAAGE+IERP+ A KELIEN+LDA ++R+E   A GGK+  +++DNG
Sbjct: 1   MAIRQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIATASGGKALLRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM + ++ +AV+RHCTSK+SD   +I T GFRGEALPSIG+V+ L++ SR   +  G +
Sbjct: 61  SGMDAADLELAVRRHCTSKLSDTLEDIRTLGFRGEALPSIGSVARLSIASRRRDSAGGHE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA++  KI+ +RP A NPGTIVEVRDLFF  PARL FLKSE+ E   IT++++RMAIA+P
Sbjct: 121 IAVNAGKITHLRPAAANPGTIVEVRDLFFATPARLKFLKSEKAEAGAITEIVKRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V F  S   S+R  + F +T  +   R++QV+G++F +NA+ L+    EI+L G+ G+P
Sbjct: 181 AVRFVLS--GSDRATLEFPATGDDHLARMAQVLGKEFRDNAIALDAVREEISLTGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+   Y F+NGR VQDK ILS IR AYAETIP GRYPV VL + +DP  VDVNVH
Sbjct: 239 TFNRGNSAHQYAFVNGRPVQDKLILSAIRGAYAETIPSGRYPVAVLSITLDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           PAKS +RFR+P ++R  I+ +I++A+ + G   ++  +  M+ +F          P+ A 
Sbjct: 299 PAKSDVRFRDPGLVRGLIVGAIREALARDGSRAATTGASDMLRAFRPGFQSYAPRPQTAW 358

Query: 361 SLTNTQEKLF------LQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQL-GIACAQI 413
           S   +  + +       +  + S + L         + +      E       G A AQI
Sbjct: 359 SAETSPSRPYQPAMGLSERPQASFDGLSMPTARAEPQFSPQPAAPEPAARYPLGAARAQI 418

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
           H NYI++QT DGLVIVDQHAAHERL+FE MR+  +S ++ SQ LL PEIID+ E +C  +
Sbjct: 419 HANYIVAQTEDGLVIVDQHAAHERLVFEAMRKALHSKRLASQVLLIPEIIDIPEEDCDRL 478

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRI 533
           M+H  +L  LG+  ERFGP AIA+RE PA+L + +   L+R + DEI +  T   L  ++
Sbjct: 479 MQHAAELSELGLSIERFGPGAIAVRETPAMLGEVDAHGLIRQLADEIAEWDTASGLSAKL 538

Query: 534 ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFG 593
           E + ATMAC+GS+RSGR+++  EMN LLREME  P S QCNHGRPT+I+LKLSDIE+LFG
Sbjct: 539 EYVAATMACHGSVRSGRRLRPEEMNALLREMEVTPGSGQCNHGRPTYIELKLSDIERLFG 598

Query: 594 R 594
           R
Sbjct: 599 R 599


>gi|28872058|ref|NP_794677.1| DNA mismatch repair protein MutL [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|37999555|sp|Q87VJ2|MUTL_PSESM RecName: Full=DNA mismatch repair protein mutL
 gi|28855311|gb|AAO58372.1| DNA mismatch repair protein MutL [Pseudomonas syringae pv. tomato
           str. DC3000]
          Length = 645

 Score =  563 bits (1451), Expect = e-158,   Method: Composition-based stats.
 Identities = 220/622 (35%), Positives = 348/622 (55%), Gaps = 29/622 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDIDVEQAGIKLLKVRDDGG 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  + +  +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMDARVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLHEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTARARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S  +    +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPENQLGGSVPAAAEPRPTGPDAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQE------------NRLSTNDLLPSDDPTYSED-------- 392
             +      L   Q + F +              R +T   +      Y E         
Sbjct: 382 GEMRLANNVLEQPQGEPFARPAGGGSGSGYQYSPRPTTGVPVAEAQSAYREFFAPLPGTT 441

Query: 393 NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
              + ES +    LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    +  +
Sbjct: 442 PSALPESPSDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMANEGL 501

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
           + Q LL PE I + + E     EH     RLG + +R GP  +AIR+IPA+L +    +L
Sbjct: 502 SGQPLLVPESIAVSQREADCAEEHITTFQRLGFELQRLGPETLAIRQIPALLKQAEANRL 561

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           + D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    S Q
Sbjct: 562 VSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTERSGQ 621

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT+ ++ LSD++KLF R
Sbjct: 622 CNHGRPTWTQMGLSDLDKLFLR 643


>gi|259417261|ref|ZP_05741180.1| DNA mismatch repair protein [Silicibacter sp. TrichCH4B]
 gi|259346167|gb|EEW57981.1| DNA mismatch repair protein [Silicibacter sp. TrichCH4B]
          Length = 643

 Score =  563 bits (1451), Expect = e-158,   Method: Composition-based stats.
 Identities = 260/620 (41%), Positives = 384/620 (61%), Gaps = 29/620 (4%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA ++R+   IA GGK+  ++ DNG G
Sbjct: 24  IRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGATRITVEIADGGKTLIRVIDNGCG 83

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT E++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR    +  AQI
Sbjct: 84  MTPEDLPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLTITSRAEGYD-AAQI 142

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            ++G  +  V+P A+  GTIVE+RDLFF  PARL F+++++ E+  I+D ++R+A+A P 
Sbjct: 143 RVAGGHLELVKPAALRQGTIVELRDLFFATPARLKFMRTDRAESQAISDTVKRLAMAEPA 202

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT    S     R        +G+  +    R++ VIG +F  NA++++     I L 
Sbjct: 203 VGFTLRDVSGGGEGRVTFRADPMSGDLFDALHGRLAHVIGREFAENALKIDATREGIRLY 262

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   ++F+N R V+DK +   +R AY + +   R+P   L ++ DP  
Sbjct: 263 GYAALPTYSRGAAVTQFLFVNTRPVKDKMLTGALRAAYMDFLSRDRHPAAALFIDCDPTL 322

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR+P + R  I+ S++ A+ + G   SS ++   + +   +    T 
Sbjct: 323 VDVNVHPAKSEVRFRDPGLARGLIVSSLRHALAEAGHRASSTVAGATLGAMRPEQPTATG 382

Query: 355 LPK-YATSLTNTQEKLFLQENRLSTND----------------LLPSDDPTYSEDNDPVE 397
            P+ Y     +   +      +                        S   +     D   
Sbjct: 383 APRVYQMDRPSPGARNSSYAAQAPGQPPAPSYPAPPSAEPAGFAEFSGAYSGRLVEDAAV 442

Query: 398 ESEAT---HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITS 454
           E EA       LG A  Q+H+NYII+QT DG+VIVDQHAAHERL++EK++       + +
Sbjct: 443 EPEAHPVEDLPLGAARGQVHENYIIAQTRDGMVIVDQHAAHERLVYEKLKHQMAENGVAT 502

Query: 455 QTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLR 514
           Q LL PEI++L +G+CA +++  +DL + G+  E FG +A+A+RE PAIL + N   ++R
Sbjct: 503 QGLLIPEIVELSDGDCARLLDVADDLAKFGLGIEAFGGSAVAVRETPAILGEVNAEAMIR 562

Query: 515 DIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCN 574
           DI+DE+ D   +  +Q R+E IL+ +AC+GSIRSGR+M+  EMN LLREME  P+S QCN
Sbjct: 563 DILDELADQGESQLVQARLEAILSRVACHGSIRSGRRMRGEEMNALLREMEATPHSGQCN 622

Query: 575 HGRPTFIKLKLSDIEKLFGR 594
           HGRPT+++LKL+DIE+LFGR
Sbjct: 623 HGRPTYVELKLADIERLFGR 642


>gi|330873787|gb|EGH07936.1| DNA mismatch repair protein [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
 gi|330965979|gb|EGH66239.1| DNA mismatch repair protein [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 647

 Score =  563 bits (1451), Expect = e-158,   Method: Composition-based stats.
 Identities = 220/624 (35%), Positives = 348/624 (55%), Gaps = 31/624 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDIDVEQAGIKLLKVRDDGS 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  + +  +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMDARVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLHEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTARARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S       ++      +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPENQLGGSVPVAAEPRLTGPDAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQE--------------NRLSTNDLLPSDDPTYSED------ 392
             +      L   Q + F +                R +T   +      Y E       
Sbjct: 382 GEMRLANNVLEQPQGEPFARPAGSGSGSGYQYQYSPRPTTGVPVAEAQSAYREFFAPLPG 441

Query: 393 --NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST 450
                + ES +    LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    + 
Sbjct: 442 TTPSALPESPSDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMANE 501

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
            ++ Q LL PE I + + E     EH     RLG + +R GP  +AIR+IPA+L +    
Sbjct: 502 GLSGQPLLVPESIAVSQREADCAEEHITTFQRLGFELQRLGPETLAIRQIPALLKQAEAN 561

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
           +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    S
Sbjct: 562 RLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTERS 621

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
            QCNHGRPT+ ++ LSD++KLF R
Sbjct: 622 GQCNHGRPTWTQMGLSDLDKLFLR 645


>gi|330807229|ref|YP_004351691.1| DNA mismatch repair protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375337|gb|AEA66687.1| DNA mismatch repair protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 637

 Score =  563 bits (1451), Expect = e-158,   Method: Composition-based stats.
 Identities = 218/625 (34%), Positives = 342/625 (54%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +  GG    ++ D+G 
Sbjct: 11  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGAKRIDVDVEQGGVKLLRVRDDGG 70

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +VS LTL SR        
Sbjct: 71  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVSRLTLTSRTRDAEQAW 130

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++S  +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+R+A+A
Sbjct: 131 QVETEGRDMASRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRLALA 190

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+  V G  F+  A+ +  + N + L G+ G
Sbjct: 191 RFDVAFHLRHNGKTILSLHEAHDDAARARRVGAVCGAGFLEQALPIEVERNGLHLWGWVG 250

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y ++NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 251 LPTFSRSQADLQYFYVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAVVDVN 310

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ------DNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+              +            +  P+
Sbjct: 311 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPEDQLAAPAAVGGMVRPTGLEAGEFGPQ 370

Query: 353 THLPKYATSLTNTQEKL---------------FLQENRLSTNDLLPSDDPTYSEDNDPVE 397
             +   A +L    +                 +    R  +N         Y E   P+ 
Sbjct: 371 GEMRLAANALLEQPQPQPSYNTAGSGAGSGYQYQYTPRPQSNVPAAEAQAAYREFFKPLP 430

Query: 398 ES--------EATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
           E+        +     LG A AQ+   YI+S+   GLV+VD HAAHER+++E+++    S
Sbjct: 431 EAGAAAMPDGQGDIPPLGYALAQLKGIYILSENAQGLVLVDMHAAHERIMYERLKIAMAS 490

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE + + + E     EH     RLG + +R GP  +AIR+IPA+L +   
Sbjct: 491 EGLSGQPLLVPESLAVSQREADCAEEHVAWFQRLGFELQRLGPETLAIRQIPALLKQAEA 550

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    
Sbjct: 551 NRLVSDVLADLMEYGTSDRIQAHLNELLGTMACHGAIRANRRLALPEMNGLLRDMENTER 610

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ +L L D++KLF R
Sbjct: 611 SGQCNHGRPTWTQLGLDDLDKLFLR 635


>gi|260429288|ref|ZP_05783265.1| DNA mismatch repair protein [Citreicella sp. SE45]
 gi|260419911|gb|EEX13164.1| DNA mismatch repair protein [Citreicella sp. SE45]
          Length = 627

 Score =  563 bits (1450), Expect = e-158,   Method: Composition-based stats.
 Identities = 252/612 (41%), Positives = 387/612 (63%), Gaps = 21/612 (3%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+EN++DA + RV   IA GGK+  ++TD+G G
Sbjct: 16  IRQLDESAINRIAAGEVVERPASAVKELVENAIDAGARRVAIEIADGGKTLIRVTDDGCG 75

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M ++E+P+A+ RH TSKI   D  +IH+FGFRGEALPS+GAV  LT+ SR      GA+I
Sbjct: 76  MRADELPLALSRHATSKIDGSDLLDIHSFGFRGEALPSLGAVGRLTIQSRAAGEE-GAEI 134

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           +++G +    +P A+N GT+V +RDLF+  PARL FL++++ E   I++VI+R+A+A P 
Sbjct: 135 SVAGGQTGGAKPCALNGGTVVTLRDLFYATPARLKFLRTDRAEMQAISEVIKRLAMAEPS 194

Query: 182 VSFTFS--TIKSNRYKMNFQSTNGNFPERIS----QVIGEDFINNAVELNEKSNEITLQG 235
           V FT    +   +R        +G+  + +     QV+G +F +NA+ ++ +     L G
Sbjct: 195 VGFTLRDVSDGKDRVTFRADPCSGDLFDALRGRMGQVMGAEFTDNALSIDAEREGFRLTG 254

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
              +PT++RG++   ++F+NGR VQD+ +   +R AYA+ +   R+P V L ++ DP +V
Sbjct: 255 LAALPTYSRGSSVAQHLFVNGRPVQDRLLHGALRGAYADFLSRERHPAVALFVDCDPHKV 314

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL 355
           DVNVHPAKS +RFR+P I+R  I+ +++ A+ + G   S+ ++   + +   +  P    
Sbjct: 315 DVNVHPAKSEVRFRDPGIVRGLIVSALRHALAEAGHRASTTVAGATLGAMRPEPQPAAAP 374

Query: 356 PKYAT-------------SLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEAT 402
             Y               +     +       + ++     S D +   D     E  A 
Sbjct: 375 RVYQMDRPSQGALSSAWRAQAPAPQPYTPPAPQPTSGFAEFSRDYSGRVDVVEEPEQPAE 434

Query: 403 HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEI 462
              LG A  Q+H+NYII+QT DG+VIVDQHAAHERL++EK+++      + +Q LL PEI
Sbjct: 435 ALPLGAARGQVHENYIIAQTADGVVIVDQHAAHERLVYEKLKRQMAERGVPAQALLIPEI 494

Query: 463 IDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIID 522
           ++    + + ++   ++L R+G+  E FG  A+A+RE PAIL + N   LL DI+DE+ D
Sbjct: 495 VEFSADDLSRLLSVADELSRMGLTVEPFGGGAVAVRETPAILGEVNAKALLNDILDELAD 554

Query: 523 SSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIK 582
             ++  +Q++IE IL+ +AC+GSIRSGR+M++ EMN LLREME  P+S QCNHGRPT+++
Sbjct: 555 YGSSQLVQEKIEAILSRVACHGSIRSGRRMRAEEMNALLREMEATPHSGQCNHGRPTYVE 614

Query: 583 LKLSDIEKLFGR 594
           LKLSDIE+LFGR
Sbjct: 615 LKLSDIERLFGR 626


>gi|213967922|ref|ZP_03396068.1| DNA mismatch repair protein MutL [Pseudomonas syringae pv. tomato
           T1]
 gi|301384442|ref|ZP_07232860.1| DNA mismatch repair protein [Pseudomonas syringae pv. tomato Max13]
 gi|302064109|ref|ZP_07255650.1| DNA mismatch repair protein [Pseudomonas syringae pv. tomato K40]
 gi|302132270|ref|ZP_07258260.1| DNA mismatch repair protein [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|213927265|gb|EEB60814.1| DNA mismatch repair protein MutL [Pseudomonas syringae pv. tomato
           T1]
          Length = 645

 Score =  562 bits (1449), Expect = e-158,   Method: Composition-based stats.
 Identities = 220/622 (35%), Positives = 347/622 (55%), Gaps = 29/622 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDIDVEQAGIKLLKVRDDGG 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  + +  +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMDARVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLHEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTARARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S       +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPENQLGGSVPVAAEPRPTGPDAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQE------------NRLSTNDLLPSDDPTYSED-------- 392
             +      L   Q + F +              R +T   +      Y E         
Sbjct: 382 GEMRLANNVLEQPQGEPFARPAGGGSGSGYQYSPRPTTGVPVAEAQSAYREFFAPLPGTT 441

Query: 393 NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
              + ES +    LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    +  +
Sbjct: 442 PSALPESPSDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMANEGL 501

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
           + Q LL PE I + + E     EH     RLG + +R GP  +AIR+IPA+L +    +L
Sbjct: 502 SGQPLLVPESIAVSQREADCAEEHITTFQRLGFELQRLGPETLAIRQIPALLKQAEANRL 561

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           + D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    S Q
Sbjct: 562 VSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTERSGQ 621

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT+ ++ LSD++KLF R
Sbjct: 622 CNHGRPTWTQMGLSDLDKLFLR 643


>gi|330960091|gb|EGH60351.1| DNA mismatch repair protein [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 647

 Score =  562 bits (1449), Expect = e-158,   Method: Composition-based stats.
 Identities = 220/624 (35%), Positives = 349/624 (55%), Gaps = 31/624 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL++NSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLKNSLDSGARRIDVDVEQAGIKLLKVRDDGG 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++   +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     RIS + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTAKARRISAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S    +  +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPENQLGGSVPVAVEPRPTGPEAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQE--------------NRLSTNDLLPSDDPTYSEDNDPVEE 398
             +      L   Q + F +                R +T   +      Y E   P+  
Sbjct: 382 GEMRLANNVLEQPQGEAFARPAGGGAGSGYQYQYSPRPTTGVPVAEAQSAYREFFAPLPS 441

Query: 399 --------SEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST 450
                   SE+    LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    + 
Sbjct: 442 AAPSSLPGSESDIPPLGYALAQLKGIYILAENAQGLVLVDMHAAHERIMYERLKIAMANE 501

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
            ++ Q LL PE + + + E     EH     RLG + +R GP  +AIR+IPA+L +    
Sbjct: 502 GLSGQPLLVPESLAVSQREADCAEEHIATFQRLGFELQRLGPETLAIRQIPALLKQAEAN 561

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
           +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    S
Sbjct: 562 RLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNALLRDMENTERS 621

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
            QCNHGRPT+ ++ LSD++KLF R
Sbjct: 622 GQCNHGRPTWTQMGLSDLDKLFLR 645


>gi|254466092|ref|ZP_05079503.1| DNA mismatch repair protein MutL [Rhodobacterales bacterium Y4I]
 gi|206687000|gb|EDZ47482.1| DNA mismatch repair protein MutL [Rhodobacterales bacterium Y4I]
          Length = 647

 Score =  562 bits (1449), Expect = e-158,   Method: Composition-based stats.
 Identities = 256/628 (40%), Positives = 385/628 (61%), Gaps = 37/628 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA ++R+   IA GGK+  ++TD+G G
Sbjct: 20  IRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGATRITVEIADGGKTLIRVTDDGCG 79

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT +++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR   +   AQI
Sbjct: 80  MTPDDLPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLTITSRAAGHE-AAQI 138

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +SG K+  V+P A+  GT+VE+RDLFF  PARL F+++++ E   I+D ++R+A+A P 
Sbjct: 139 RVSGGKLEPVKPAALRAGTVVELRDLFFATPARLKFMRTDRAEAQAISDTVKRLAMAEPS 198

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT    S     R        +G+  +    R++ V+G +F  NA++++     I L 
Sbjct: 199 VGFTLRDVSGGGEGRVTFRADPLSGDLFDALHGRLASVLGREFAENALKIDATREGIRLY 258

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   ++F+N R V+DK +   +R AY + +   R+P   L ++ DP+ 
Sbjct: 259 GYAALPTYSRGAAVAQFLFVNTRPVKDKMLTGALRAAYFDFLSRDRHPAAALFVDCDPQL 318

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR+P + R  I+ S++ A+ + G   S+ ++   + +   +    + 
Sbjct: 319 VDVNVHPAKSEVRFRDPGLARGLIVSSLRHALAEAGHRASTTVAGATLGAMKPEQPTASG 378

Query: 355 LPK----------------YATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDND---- 394
            P+                 A S    Q   +         +L        +E  +    
Sbjct: 379 APRIYQMDRPSYGARSLSYAAQSPGQPQAPSYDAPPSPGFAELAGVYSGRVTEVAEAPTA 438

Query: 395 --------PVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQD 446
                         A    LG A  Q+H+NYII+QT DG+VIVDQHAAHERL++EK+++ 
Sbjct: 439 PGRPSVPPEASAPGAEQLPLGAARGQVHENYIIAQTADGMVIVDQHAAHERLVYEKLKRQ 498

Query: 447 FNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSK 506
                + +Q LL PEI++L + +CA ++   ++L + G+  E FG NAIA+RE PAIL +
Sbjct: 499 MAENGVAAQALLIPEIVELSDNDCACLLGVADELAKFGLGIEAFGGNAIAVRETPAILGE 558

Query: 507 KNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEK 566
            N   +++DI+DE+ D   +  +Q +IE IL+ +AC+GSIRSGR+M+  EMN LLREME 
Sbjct: 559 VNAKAMIKDILDELSDQGESQLVQAKIEAILSRVACHGSIRSGRRMRGEEMNALLREMEA 618

Query: 567 NPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            P+S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 619 TPHSGQCNHGRPTYVELKLADIERLFGR 646


>gi|237798277|ref|ZP_04586738.1| DNA mismatch repair protein [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331021129|gb|EGI01186.1| DNA mismatch repair protein [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 647

 Score =  562 bits (1449), Expect = e-158,   Method: Composition-based stats.
 Identities = 219/624 (35%), Positives = 347/624 (55%), Gaps = 31/624 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDIDVEQAGIKLLKVRDDGG 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++   +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTARARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S       K       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPENQVGGSVPVAAEPKPTGPDAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQE--------------NRLSTNDLLPSDDPTYSED------ 392
             +      L   Q + F +                R ++   +      Y E       
Sbjct: 382 GEMRLANNVLEQPQGEAFARPAGGGSGSGYQYQYSPRPASALPVAEAQSAYREFFAPLPS 441

Query: 393 --NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST 450
                + ES +    LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    + 
Sbjct: 442 AAPSALPESPSDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMANE 501

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
            ++ Q LL PE + + + E     EH     RLG + +R GP  +AIR+IPA+L +    
Sbjct: 502 GLSGQPLLVPESLAVSQREADCAEEHIATFQRLGFELQRLGPETLAIRQIPALLKQAEAN 561

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
           +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    S
Sbjct: 562 RLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTERS 621

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
            QCNHGRPT+ ++ LSD++KLF R
Sbjct: 622 GQCNHGRPTWTQMGLSDLDKLFLR 645


>gi|222085025|ref|YP_002543554.1| DNA mismatch repair protein [Agrobacterium radiobacter K84]
 gi|254766153|sp|B9JA11|MUTL_AGRRK RecName: Full=DNA mismatch repair protein mutL
 gi|221722473|gb|ACM25629.1| DNA mismatch repair protein [Agrobacterium radiobacter K84]
          Length = 606

 Score =  562 bits (1449), Expect = e-158,   Method: Composition-based stats.
 Identities = 297/607 (48%), Positives = 415/607 (68%), Gaps = 15/607 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I++LSE +INQIAAGE+IERP+ A KELIEN+LDA ++R+E   AGGGK+  +++DNG
Sbjct: 1   MTIKQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIATAGGGKALLRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM   ++ +A++RHCTSKISD   +I T GFRGEALPSIG+V+ L++ SR   +  GA+
Sbjct: 61  SGMEQADLELAIKRHCTSKISDTLDDIRTLGFRGEALPSIGSVARLSIASRRVGSAGGAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA++G K+  +RP A NPGTIVEVRDLFF  PARL FLK+E+ E   IT+V++RMAIA+P
Sbjct: 121 IAVAGGKVLHLRPAAANPGTIVEVRDLFFATPARLKFLKTEKAEAAAITEVVKRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
           +V F  S   S+R  + F +T  +   R++QV+G+DF +NA+EL+ +  ++ L G+ G+P
Sbjct: 181 QVRFVLS--GSDRSTLEFPATGDDRLARMAQVLGKDFKDNAIELDAEREDVRLTGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+   Y F+NGR VQDK ILS IR AYAETIP GRYP+ VL + +DP  +DVNVH
Sbjct: 239 TFNRGNSAHQYAFVNGRPVQDKLILSAIRGAYAETIPSGRYPIAVLSITLDPALLDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           PAKS +RFR+P ++R  I+ +I++A+ ++G   ++  +  M+ +F     P       + 
Sbjct: 299 PAKSDVRFRDPGLVRGLIVGAIREALAREGDRAATTGADGMLRAFTSGFQPGWRPSAPSA 358

Query: 361 SLTNTQEK------------LFLQENRLSTNDLLPSDDPTYSEDN-DPVEESEATHYQLG 407
             T                  F +  + + + L        S    +P +  E   + LG
Sbjct: 359 PWTPEASPSRPYQPAVTNGYSFRERPQAAFDGLTMPTARAESTPFVEPTQSEEPARFPLG 418

Query: 408 IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLE 467
            A AQ+H+NYI++QT DGLVIVDQHAAHERL+FE+MR+  +S +++SQ LL PEI+DL E
Sbjct: 419 AARAQLHENYIVAQTDDGLVIVDQHAAHERLVFEEMRKALHSKRLSSQVLLIPEIVDLPE 478

Query: 468 GECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTY 527
            +C  +M   ++L  LG+  ERFGP AIA+RE PA+L + +   L+R + DEI +  T  
Sbjct: 479 EDCDRLMVFADELGELGLAIERFGPGAIAVRETPAMLGEVDAQGLIRQLADEIAEWDTAS 538

Query: 528 TLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSD 587
            L  ++E + ATMAC+GS+RSGR+++  EMN LLR+ME  P S QCNHGRPT+I+LKLSD
Sbjct: 539 GLAAKLEYVAATMACHGSVRSGRRLRPEEMNALLRQMEATPGSGQCNHGRPTYIELKLSD 598

Query: 588 IEKLFGR 594
           IE+LFGR
Sbjct: 599 IERLFGR 605


>gi|307825900|ref|ZP_07656115.1| DNA mismatch repair protein MutL [Methylobacter tundripaludum SV96]
 gi|307733019|gb|EFO03881.1| DNA mismatch repair protein MutL [Methylobacter tundripaludum SV96]
          Length = 614

 Score =  562 bits (1448), Expect = e-158,   Method: Composition-based stats.
 Identities = 202/612 (33%), Positives = 344/612 (56%), Gaps = 18/612 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M+I  L  +++NQIAAGE++ERPS  +KEL+EN  DA +S+V   I  GG    +I DNG
Sbjct: 1   MRIHSLPTQLVNQIAAGEVVERPSSVVKELVENCFDAGASQVSIEIEQGGARLIKIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  E++P+A+ RH TSKI+   D   + + GFRGEALPSI +VS LTL+SR    +  
Sbjct: 61  CGIVKEDLPLALSRHATSKIASLKDLEQVVSMGFRGEALPSISSVSRLTLISRISDADCA 120

Query: 119 AQIAIS-GEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
            ++     E+  + +P     GT ++VRDLF+  PAR  FLK+E+ E   I  +I+RMA+
Sbjct: 121 WRVNADGTEQDFNPQPDPHPQGTTIDVRDLFYNTPARRKFLKTEKTEFAHIETLIKRMAL 180

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           +   + F  S  +   + +    T     +RI+ + G  FI N+++++  ++ + L G+ 
Sbjct: 181 SRFDIGFILSHNQKEIFNLKPAITESEQEQRIAGICGSAFIENSIKIDFAASGLQLTGWV 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PTF+R   +  + ++NGR V+DK +   ++ AY + +  GR+PV VL L +DP  VDV
Sbjct: 241 GLPTFSRSQQDMQFFYVNGRLVRDKLVSHAVKQAYQDVLFHGRHPVFVLYLTLDPALVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGI---------------STSSVLSKKMI 342
           N HPAK  +RFR   ++ +F+  ++ +++                    + + + +K   
Sbjct: 301 NAHPAKLEVRFREGRLVHDFLFSALHRSLADLRPGRNLMQQVEVEALPQTPAVLDAKPNN 360

Query: 343 SSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEAT 402
            ++  D+  +   P +      +          L   + + +    Y +     + ++  
Sbjct: 361 VAWLNDSVTQQSKPNFDNKTAYSSRSPQQASLPLHVEEAMQAYASLYPKPEPVAQSAQPE 420

Query: 403 HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEI 462
              LG A A +H  YI+S+T +G+++VD HAAHER+ +E+++Q + +  + +Q LL P  
Sbjct: 421 ARPLGHAIAHLHNIYILSETPNGIILVDAHAAHERVTYERLKQQYQNGAVPNQPLLLPIK 480

Query: 463 IDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIID 522
           I +   E  L  +  E  + LG +  R G   I +R IP +L   ++  L+RD++ ++I+
Sbjct: 481 IKVSAAEADLAEQEHEFFNTLGFEINRSGLETIVLRSIPVLLGNTDMETLVRDVLADMIE 540

Query: 523 SSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIK 582
              +  +Q++   ILAT+AC+G++R+ R++   EMN LLR+ME+     QCNHGRPT+++
Sbjct: 541 HGMSQRIQEKSNEILATVACHGAVRAHRRLTIDEMNALLRDMEQTERIGQCNHGRPTWVE 600

Query: 583 LKLSDIEKLFGR 594
           L  +D++K F R
Sbjct: 601 LSTNDLDKFFLR 612


>gi|285017885|ref|YP_003375596.1| DNA mismatch repair protein mutl [Xanthomonas albilineans GPE PC73]
 gi|283473103|emb|CBA15608.1| probable dna mismatch repair protein mutl [Xanthomonas albilineans]
          Length = 623

 Score =  562 bits (1448), Expect = e-158,   Method: Composition-based stats.
 Identities = 212/623 (34%), Positives = 348/623 (55%), Gaps = 31/623 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN+LDA + RV+  +  GG    +I D+G
Sbjct: 1   MSIRQLPEILINQIAAGEVVERPASVVKELVENALDAGARRVDVDLEEGGVRLIRIRDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+ +EE+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TL SR   +  G
Sbjct: 61  SGIPAEELPLAVSRHATSKIASLDDLETVGTLGFRGEALPSIASVSRFTLASRRADDAHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           A + + G K+ +V+P A +PGT VEVR+LF+ +PAR  FL++E+ E   I + +R +A+A
Sbjct: 121 AMLQVEGGKVGAVQPHAQSPGTTVEVRELFYNVPARRKFLRAERTELGHIEEWLRSLALA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P V    S       +        +    + + +GEDF   A+ ++     + L G+  
Sbjct: 181 RPDVELRVSHNGKPSRRYKPGDLYSDAR--LGETLGEDFARQALRVDHSGAGLRLHGWIA 238

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P ++R +A+Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VDVN
Sbjct: 239 QPHYSRASADQQYLYVNGRSVRDRSVAHAVKMAYGDVLFHGRQPAYVLFLELDPSRVDVN 298

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGIST-SSVLSKKMISSFHQDNAPKTHLPK 357
           VHPAK  +RFR+  +I +F+ +++Q  + +    +  S  +   + +     +     P 
Sbjct: 299 VHPAKHEVRFRDARLIHDFVYRTLQDTLAQTRAGSLPSTAADAPVQTLPTHGSGAGAWPP 358

Query: 358 YATSLTNTQEKLFLQENRLSTN---------------------DLLPSDDPTYSEDND-- 394
              S+  +  K    + R + +                     D   +     S   D  
Sbjct: 359 PRASVGGSSGKGEGAQWRSAQSPLGLRVQEAPAAYAALYAASADSGSTAAHLPSPPQDAA 418

Query: 395 ---PVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK 451
              P    ++    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++   +   
Sbjct: 419 GGLPPTAPDSGVPPLGYAIAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKSAHDGIG 478

Query: 452 ITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQ 511
           + +Q LL P  + + E +        + L  LG +  R GP ++ +R IPA+L++     
Sbjct: 479 LHTQPLLVPITLAVGERDADTAEREAQTLAALGFEVTRSGPQSLHVRSIPALLAQAEPEA 538

Query: 512 LLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSS 571
           LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME    S 
Sbjct: 539 LLRDVLTDLREHGHSGRVAGARDALLSTMACHGAVRANRRLTLPEMNALLRDMEATERSG 598

Query: 572 QCNHGRPTFIKLKLSDIEKLFGR 594
           QCNHGRPT+ +  L++I++ F R
Sbjct: 599 QCNHGRPTWARFTLAEIDRWFLR 621


>gi|331014608|gb|EGH94664.1| DNA mismatch repair protein [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 647

 Score =  561 bits (1447), Expect = e-158,   Method: Composition-based stats.
 Identities = 220/624 (35%), Positives = 347/624 (55%), Gaps = 31/624 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 22  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGARRIDIDVEQAGIKLLKVRDDGG 81

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 82  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDADQAW 141

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  + +  +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+RMA+A
Sbjct: 142 QVETEGRDMDARVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLHEVIKRMALA 201

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R+S + G  F+  A+ +  + N + L G+ G
Sbjct: 202 RFDVAFHLRHNGKTVLSLHEAHDDTARARRVSAICGPGFLEQALPIEIERNGLHLWGWVG 261

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 262 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPAAVDVN 321

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------NKKGISTSSVLSKKMISSFHQDNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+      N+ G S       +       +  P+
Sbjct: 322 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPENQLGGSVPVAAEPRPTGPDAGEFGPQ 381

Query: 353 THLPKYATSLTNTQEKLFLQE--------------NRLSTNDLLPSDDPTYSED------ 392
             +      L   Q + F +                R +T   +      Y E       
Sbjct: 382 GEMRLANNVLEQPQGEPFARPAGGGSGSGYQYQYSPRPTTGVPVAEAQSAYREFFAPLPG 441

Query: 393 --NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST 450
                + ES +    LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    + 
Sbjct: 442 TTPSALPESPSDIPPLGYALAQLKGIYILAENAHGLVLVDMHAAHERIMYERLKIAMANE 501

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
            ++ Q LL PE I + + E     EH     RLG + +R GP  +AIR+IPA+L +    
Sbjct: 502 GLSGQPLLVPESIAVSQREADCAEEHITTFQRLGFELQRLGPETLAIRQIPALLKQAEAN 561

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
           +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    S
Sbjct: 562 RLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRANRRLAIPEMNGLLRDMENTERS 621

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
            QCNHGRPT+ ++ LSD++KLF R
Sbjct: 622 GQCNHGRPTWTQMGLSDLDKLFLR 645


>gi|170723845|ref|YP_001751533.1| DNA mismatch repair protein [Pseudomonas putida W619]
 gi|229486326|sp|B1JAD6|MUTL_PSEPW RecName: Full=DNA mismatch repair protein mutL
 gi|169761848|gb|ACA75164.1| DNA mismatch repair protein MutL [Pseudomonas putida W619]
          Length = 633

 Score =  561 bits (1447), Expect = e-158,   Method: Composition-based stats.
 Identities = 209/626 (33%), Positives = 340/626 (54%), Gaps = 33/626 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ LS ++ NQIAAGE++ERP+   KEL+ENSLD+ + R++  +  GG    ++ D+G 
Sbjct: 6   RIQLLSPRLTNQIAAGEVVERPASVAKELLENSLDSGARRIDVEVEQGGVKLLRVRDDGS 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++++++P+A+ RH TSKI +  D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 66  GISADDLPLALARHATSKIRELEDLEGVLSLGFRGEALASISSVARLTLTSRTASASEAW 125

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  ++   +P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VIRR+A+A
Sbjct: 126 QVETEGRDMTPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIRRLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F       +   ++          R+  + G  F+  A+ ++ + N + L G+ G
Sbjct: 186 RFDVAFHLRHNGKSILSLHEAHDETARARRVGAICGGGFMEQALPIDVERNGLRLWGWVG 245

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL LE++P  VDVN
Sbjct: 246 LPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLELEPNGVDVN 305

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI------------------------NKKGISTS 334
           VHP K  +RFR    + +F+  ++ +A+                         + G    
Sbjct: 306 VHPTKHEVRFREGRSVHDFLYGTLHRALADVRPEDHLASAPAAAAEITRPTGQQAGEFGP 365

Query: 335 SVLSKKMISSFHQDNAPKTHLPK------YATSLTNTQEKLFLQENRLSTNDLLPSDDPT 388
               +       Q   P+  +        Y    T    +        +           
Sbjct: 366 QGEMRLASPVLEQPQVPQHSISNGGSGAGYQYQYTPRPSQPLPAAEAQAVYREFYKPLND 425

Query: 389 YSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFN 448
            +     + +S+     LG A AQ+   YI+++   GLV+VD HAAHER+++E+++    
Sbjct: 426 DAAGPATLPQSQGDIPPLGYALAQLKGIYILAENAAGLVLVDMHAAHERIMYERLKVAMA 485

Query: 449 STKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKN 508
           S  ++ Q LL PE + L + E     EH +   RLG + +R GP  +AIR+IPA+L +  
Sbjct: 486 SEGLSGQPLLVPESLALSQREADCAEEHAQWFQRLGFELQRLGPETLAIRQIPALLKQAE 545

Query: 509 IPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNP 568
             +L++D++ ++++  T+  +Q  +  +L TMAC+G++R+ R++   EMN LLR+ME   
Sbjct: 546 ANRLVQDVLADLMEYGTSDRIQAHLNELLGTMACHGAVRANRRLAIPEMNALLRDMENTE 605

Query: 569 NSSQCNHGRPTFIKLKLSDIEKLFGR 594
            S QCNHGRPT+ ++ L D++KLF R
Sbjct: 606 RSGQCNHGRPTWTQMGLDDLDKLFLR 631


>gi|311695392|gb|ADP98265.1| LOW QUALITY PROTEIN: DNA mismatch repair protein mutL [marine
           bacterium HP15]
          Length = 630

 Score =  561 bits (1447), Expect = e-158,   Method: Composition-based stats.
 Identities = 210/632 (33%), Positives = 346/632 (54%), Gaps = 48/632 (7%)

Query: 6   LSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTS 65
           LS ++ NQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    ++ D+G G+  
Sbjct: 2   LSPRLANQIAAGEVVERPASVVKELVENALDAGANRVDVEVEQGGVKLIRVRDDGSGIEE 61

Query: 66  EEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAI 123
           +++P+A+ RH TSKI+  DD   + + GFRGEAL SI +VS LTL SR       +++ +
Sbjct: 62  DDLPLALSRHATSKIASLDDLEAVASLGFRGEALASISSVSRLTLTSRTESQEAASRVEV 121

Query: 124 SGEKIS-SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKV 182
            G ++   + P A   GT VEVRDLFF  PAR  FL++E+ E N + + +RR A++    
Sbjct: 122 EGREMDARISPAAHPVGTTVEVRDLFFNTPARRKFLRTEKTEFNHVEECVRRQALSRFDA 181

Query: 183 SFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTF 242
            FT    +     +    +  +   RI  + G+ FI+NAV ++ ++  + L G+  +PTF
Sbjct: 182 GFTLRHNQRVVQSLRPAESALDRERRIGSLCGQQFIDNAVVIDAEATGLRLWGWVALPTF 241

Query: 243 NRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPA 302
           +R  A+  Y F+NGR ++D+ +   +R AY + +   R+P  VL LE+DP  VDVNVHP 
Sbjct: 242 SRSQADLQYFFVNGRVIRDRLVAHAVRQAYRDVLYNNRHPAFVLYLEVDPATVDVNVHPT 301

Query: 303 KSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYATSL 362
           K  +RFR+  ++ +FI +++ KA+    +         +  SF ++   +      AT  
Sbjct: 302 KHEVRFRDGRLVHDFIFRTLHKALA--DVRPDDHFRGAVAQSFGREAVTQGQEAVPATGA 359

Query: 363 TNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQL---------------- 406
           +   E  +  +  +S+          +   + P +E  A+                    
Sbjct: 360 S--AEAGWNGQPSVSSYGYPGGSGAGFGGQSQPQQEWRASDQMAFYQSLNAGGGSDGQQA 417

Query: 407 ------------------------GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEK 442
                                   G A AQ+H  YI++Q   GL++VD HAAHER+ +E+
Sbjct: 418 MPVSDRAATPMPTPPADSDQEPPLGYAIAQLHGIYILAQGRAGLIVVDMHAAHERITYER 477

Query: 443 MRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPA 502
           M++      + SQ LL P  + + + +      H E+L +LG++ ER GP  +A+R++PA
Sbjct: 478 MKRALAEQDLKSQPLLVPLSLAVSQKKPPT-ESHGEELQKLGLQIERIGPETLAVRQVPA 536

Query: 503 ILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLR 562
           +L   +  QL+RD++ ++I+   +  ++     +L TMAC+GS+R+ R++   EMN LLR
Sbjct: 537 LLRGADTEQLVRDVLADLIEHGQSDRVEAVTHELLGTMACHGSVRANRQLTIPEMNSLLR 596

Query: 563 EMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +ME    S QCNHGRPT+  + +S+++KLF R
Sbjct: 597 DMEATERSGQCNHGRPTWTLVTMSELDKLFLR 628


>gi|294666460|ref|ZP_06731703.1| DNA mismatch repair protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292603766|gb|EFF47174.1| DNA mismatch repair protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 625

 Score =  561 bits (1447), Expect = e-158,   Method: Composition-based stats.
 Identities = 218/625 (34%), Positives = 343/625 (54%), Gaps = 33/625 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    +I DNG
Sbjct: 1   MAIRQLPEILINQIAAGEVVERPASVVKELVENALDAGATRVDIELEEGGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+T +E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TL SR      G
Sbjct: 61  GGITPDELPLAVSRHATSKIASLDDLETVATLGFRGEALPSIASVSRFTLTSRRHDAEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           + + I G ++  V P A  PGT VEVR+LFF +PAR  FL++E+ E   I + +R +A+A
Sbjct: 121 SALEIDGGRLGEVVPRAHAPGTTVEVRELFFNVPARRKFLRAERTELGHIEEWLRSLALA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P V    S       +        +    + + +G+DF   A+ ++     + L G+  
Sbjct: 181 RPDVELRVSHNGKPSRRYKPGDLYSDAR--LGETLGDDFARQALRVDHSGAGLRLHGWVA 238

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P ++R + +Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VDVN
Sbjct: 239 QPHYSRASTDQQYLYVNGRSVRDRSVAHAVKMAYGDVLFHGRQPAYVLFLELDPARVDVN 298

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSS------------------VLSKK 340
           VHPAK  +RFR   +I +F+ +++Q A+ +     +                        
Sbjct: 299 VHPAKHEVRFREARLIHDFVYRTLQDALAQTRAGATPNSIGSDRVGDMGTTSGGMGSLAG 358

Query: 341 MISSFHQDNAPKTHLPKYATSLTNTQEKLFLQ--ENRLSTNDLLPSDDPTYSEDNDP--- 395
             +  H      ++      S T +Q  L L+  E R +   L      +  +       
Sbjct: 359 GGAPRHGGMPGGSNGTYGYASWTPSQAPLGLRVDEARAAYGALYAPPPSSAQQSAGMPNM 418

Query: 396 ------VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                     ++    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++Q  +S
Sbjct: 419 VGTGLPATAEDSGVPPLGYAIAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKQAHDS 478

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             + +Q LL P  + + E E        E L  LG +  R GP ++ +R IPA+L+    
Sbjct: 479 IGLHAQPLLVPMTLAVGEREADTAEREAETLATLGFEITRAGPQSLHVRSIPALLANAEP 538

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
             LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME    
Sbjct: 539 EALLRDVLGDLREHGQSRRIASARDELLSTMACHGAVRANRRLTVPEMNALLRDMEATER 598

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ +  LSDI++ F R
Sbjct: 599 SGQCNHGRPTWARFTLSDIDRWFLR 623


>gi|294626021|ref|ZP_06704631.1| DNA mismatch repair protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292599691|gb|EFF43818.1| DNA mismatch repair protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 625

 Score =  561 bits (1447), Expect = e-158,   Method: Composition-based stats.
 Identities = 218/625 (34%), Positives = 343/625 (54%), Gaps = 33/625 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    +I DNG
Sbjct: 1   MAIRQLPEILINQIAAGEVVERPASVVKELVENALDAGATRVDIELEEGGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+T +E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TL SR      G
Sbjct: 61  GGITPDELPLAVSRHATSKIASLDDLETVATLGFRGEALPSIASVSRFTLTSRRHDAEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           + + I G ++  V P A  PGT VEVR+LFF +PAR  FL++E+ E   I + +R +A+A
Sbjct: 121 SALEIDGGRLGEVVPRAHAPGTTVEVRELFFNVPARRKFLRAERTELGHIEEWLRSLALA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P V    S       +        +    + + +G+DF   A+ ++     + L G+  
Sbjct: 181 RPDVELRVSHNGKPSRRYKPGDLYSDAR--LGETLGDDFARQALRVDHSGAGLRLHGWVA 238

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P ++R + +Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VDVN
Sbjct: 239 QPHYSRASTDQQYLYVNGRSVRDRSVAHAVKMAYGDVLFHGRQPAYVLFLELDPARVDVN 298

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSS------------------VLSKK 340
           VHPAK  +RFR   +I +F+ +++Q A+ +     +                        
Sbjct: 299 VHPAKHEVRFREARLIHDFVYRTLQDALAQTRAGATPNSIGSDRVGDMGTTSGGMGSLAG 358

Query: 341 MISSFHQDNAPKTHLPKYATSLTNTQEKLFLQ--ENRLSTNDLLPSDDPTYSEDNDP--- 395
             +  H      ++      S T +Q  L L+  E R +   L      +  +       
Sbjct: 359 GGAPSHGGMPGGSNGTYGYASWTPSQTPLGLRVDEARAAYGALYAPPPSSAQQSAGMPNM 418

Query: 396 ------VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                     ++    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++Q  +S
Sbjct: 419 AGTGLPATAEDSGVPPLGYAIAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKQAHDS 478

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             + +Q LL P  + + E E        E L  LG +  R GP ++ +R IPA+L+    
Sbjct: 479 IGLHAQPLLVPMTLAVGEREADTAEREAETLATLGFEITRAGPQSLHVRSIPALLANAEP 538

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
             LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME    
Sbjct: 539 EALLRDVLGDLREHGQSRRIASARDELLSTMACHGAVRANRRLTVPEMNALLRDMEATER 598

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ +  LSDI++ F R
Sbjct: 599 SGQCNHGRPTWARFTLSDIDRWFLR 623


>gi|159184423|ref|NP_353724.2| DNA mismatch repair protein [Agrobacterium tumefaciens str. C58]
 gi|25090766|sp|Q8UHI3|MUTL_AGRT5 RecName: Full=DNA mismatch repair protein mutL
 gi|159139736|gb|AAK86509.2| DNA mismatch repair protein MutL [Agrobacterium tumefaciens str.
           C58]
          Length = 606

 Score =  561 bits (1446), Expect = e-157,   Method: Composition-based stats.
 Identities = 299/607 (49%), Positives = 413/607 (68%), Gaps = 15/607 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I++LSE +INQIAAGE+IERPS A KEL+EN++DA ++R+E   AGGGK   +ITDNG
Sbjct: 1   MAIKQLSETLINQIAAGEVIERPSSATKELVENAIDAGATRIEIATAGGGKGLVRITDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM+  ++ +AV+RHCTSKIS    +I T GFRGEALPSIG+V+ LT+ SR      G+ 
Sbjct: 61  SGMSPADLELAVRRHCTSKISTTLDDIRTLGFRGEALPSIGSVAKLTITSRQQGAEQGSV 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I+++G K+S VRP A N GTIVEVRDLFF  PARL FLK+E+ E   IT+V++RMAIA+P
Sbjct: 121 ISVTGGKVSDVRPAASNAGTIVEVRDLFFATPARLKFLKTERAEAAAITEVVKRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            + F  S   ++R  +   ST  +   R++Q++G +F +NA+E++    ++TL G+ G+P
Sbjct: 181 HIRFVLS--GTDRSTLEIPSTGDDHLARMAQILGAEFKDNAIEIDAGREDVTLTGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN++  YVF+NGR VQDK +LS IR AYAET+P GRYPV VL + +DP  VDVNVH
Sbjct: 239 TFNRGNSSHQYVFVNGRPVQDKLLLSAIRGAYAETVPHGRYPVAVLSITLDPAFVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           PAKS +RFR+P +IR  I+ +I++A+ + G   ++  + +M+++F    +P    P  + 
Sbjct: 299 PAKSDVRFRDPGLIRGLIVGAIRQALTRDGDRAATTGASQMMNAFRPGYSPSGLRPSPSA 358

Query: 361 SLTNTQEKL----------FLQENRLSTNDLLP---SDDPTYSEDNDPVEESEATHYQLG 407
           + +                F +  +   +D+       +P  + +       E   Y LG
Sbjct: 359 TWSAATSPSRPLAVSGDMQFAEAAQSRFSDITMPTARAEPREAYEASQSPSPEPVLYPLG 418

Query: 408 IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLE 467
            A AQ+H+NYII+QT +GLVIVDQHAAHERL+FE+MR   +S +  SQ LL PEIIDL E
Sbjct: 419 AARAQLHENYIIAQTENGLVIVDQHAAHERLVFEEMRNALHSRRPPSQVLLIPEIIDLPE 478

Query: 468 GECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTY 527
            +C  +M+H      LG+  ERFGP AIA+RE PA+L + N+  L+R + DEI +     
Sbjct: 479 EDCDRLMDHAAGFDALGLVIERFGPGAIAVRETPAMLGEVNVQGLVRQLADEIAEWDAAS 538

Query: 528 TLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSD 587
           TL +++E + ATMAC+GS+RSGR+M+  EMN LLR+ME  P S QCNHGRPT+I+LKLSD
Sbjct: 539 TLANKLEYVAATMACHGSVRSGRRMRPEEMNALLRQMENTPGSGQCNHGRPTYIELKLSD 598

Query: 588 IEKLFGR 594
           IE+LFGR
Sbjct: 599 IERLFGR 605


>gi|163794888|ref|ZP_02188857.1| DNA mismatch repair protein [alpha proteobacterium BAL199]
 gi|159179707|gb|EDP64234.1| DNA mismatch repair protein [alpha proteobacterium BAL199]
          Length = 620

 Score =  561 bits (1445), Expect = e-157,   Method: Composition-based stats.
 Identities = 236/607 (38%), Positives = 372/607 (61%), Gaps = 18/607 (2%)

Query: 4   RKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGM 63
           R+L E ++N+IAAGE++ERP+ A+KEL+ENSLDA + RV+ V+  GG++  Q++D+G G+
Sbjct: 15  RRLPETLVNRIAAGEVVERPASALKELVENSLDAGARRVDVVLRDGGRTLIQVSDDGHGL 74

Query: 64  TSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIA 122
             + + +AV+RH TSK+ DD  ++I T GFRGEALPSIGAVS L++ SR        +I 
Sbjct: 75  DPDTLSLAVERHATSKLPDDDLTHISTLGFRGEALPSIGAVSRLSITSRAAGAPAAWRIR 134

Query: 123 ISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKV 182
           + G  + +  P A+  GT VE+RDLF+  PARL FLK  + E +   ++++R+A+A P V
Sbjct: 135 VEGGAVGAPEPAALTAGTRVEIRDLFYATPARLKFLKIPRTEQSHALEILQRLAMAAPTV 194

Query: 183 SFTFSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            FT S     R  +N ++  G+  E    R+  V+G DF  +A+ ++ +     L GY G
Sbjct: 195 GFTLS--DGTRTLLNLEAAQGDLFEVRLARLGAVLGRDFAADALPIDAERQGYRLTGYAG 252

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PT +R  +   Y+F+NGR V+D+ +L  +R AY + +   R+P++ L LE+   +VDVN
Sbjct: 253 LPTLHRRTSAHQYLFVNGRPVRDRLLLGAVRGAYMDFVASDRHPMLALFLELPAEEVDVN 312

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD---NAPKTHL 355
           VHPAK+ +RFR+  ++R  I+ +++ A+ + G   S+ +    + +F  D          
Sbjct: 313 VHPAKTEVRFRDAGLVRGLIVGALKHALAEAGHRASASVGAATLGAFRPDGLRAHTGHAA 372

Query: 356 PKYATSLTNTQEKLFLQENRLSTNDL--------LPSDDPTYSEDNDPVEESEATHYQLG 407
           P + T+         L E + +            L       +   +   +  A  + LG
Sbjct: 373 PAWNTARWTPPPSEGLAEAQAAWQAPSTDRVGHTLDFGAAPAARVENAPADPVAERHPLG 432

Query: 408 IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLE 467
            A AQ+H  YI++QT DGLVIVDQHAAHERL++E+M+       + SQ LL PE+++L E
Sbjct: 433 AARAQVHGTYIVAQTEDGLVIVDQHAAHERLVYERMKDALAVGGVKSQALLLPEVVELEE 492

Query: 468 GECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTY 527
                +++  ++   LG+  E FG  A+ +RE+PA+L K +   L+RD+ D++ +    +
Sbjct: 493 AAVDRLVQRADEFAELGLVLEAFGQGAVVVREVPALLGKTDTAALIRDLADDLAEVGDAH 552

Query: 528 TLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSD 587
            L+DR+ ++  TMAC+GS+R+GR++   EMN LLR+ME  P+S QCNHGRPT+++LKL+D
Sbjct: 553 ALKDRLADVCGTMACHGSVRAGRRLSGDEMNALLRQMEATPHSGQCNHGRPTYVELKLTD 612

Query: 588 IEKLFGR 594
           IE+LFGR
Sbjct: 613 IERLFGR 619


>gi|88798917|ref|ZP_01114499.1| DNA mismatch repair protein [Reinekea sp. MED297]
 gi|88778397|gb|EAR09590.1| DNA mismatch repair protein [Reinekea sp. MED297]
          Length = 632

 Score =  561 bits (1445), Expect = e-157,   Method: Composition-based stats.
 Identities = 210/618 (33%), Positives = 339/618 (54%), Gaps = 26/618 (4%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I  LS ++ NQIAAGE++ERP+  +KELIENSLDA ++R+E  I  GG    ++ DNG G
Sbjct: 13  IAVLSPRLANQIAAGEVVERPASVVKELIENSLDAGATRIEIEIEQGGVKLIRVRDNGRG 72

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  +++ +A+ RH TSK+   D+   + + GFRGEAL S+ +VS LTL S+P   +   Q
Sbjct: 73  IPQDDLALALARHATSKVYSLDELEALGSLGFRGEALASVASVSRLTLTSKPANQSEAWQ 132

Query: 121 IAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +   G  +++   P A   GT VEVRDLFF  PAR  FL++E+ E N + +V++R A++ 
Sbjct: 133 VQSHGRDMATELAPAAHTDGTTVEVRDLFFNTPARRKFLRTEKTEFNHLEEVVKRQALSR 192

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
             V+F+        + +    T      RI+Q++  +F+ NA+ +  +   + + G+ G+
Sbjct: 193 FDVAFSLRHNNRTIHSLRAAHTQAEQQRRIAQLLKPEFMTNALVVETERAGLRMTGWVGL 252

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF+R   +  Y F+NGR V+DK I   ++ AY + +  GR+P  VL LE+D   VDVNV
Sbjct: 253 PTFSRSMPDMQYFFVNGRVVKDKVIGHAVKQAYRDVLYHGRHPCFVLFLELDSSGVDVNV 312

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTS--SVLSKKMISSFHQ---------- 347
           HP K  +RFR+  ++ +F+   + +A+          S     M +              
Sbjct: 313 HPTKHEVRFRDQRLVHDFLFSQLHRALADVRPENDVGSSFDNPMTAPPQPRVSGLEAGEF 372

Query: 348 ------DNAPKTHLPKYATSLTNTQ-----EKLFLQENRLSTNDLLPSDDPTYSEDNDPV 396
                 D  P    P    S + T      E++   +          + +  ++      
Sbjct: 373 RGQNHLDMRPSGSGPMVDASASGTSSLGVSEQVSFYQQLQQPGSEAGAANAGFTPQPQLP 432

Query: 397 EESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQT 456
           +        LG A AQ+H  YI+S++  GL+IVD HAAHER+ +E+M+Q ++   + +Q 
Sbjct: 433 QSETPDMPPLGFAVAQLHGIYILSESEQGLIIVDMHAAHERITYERMKQQYDHQGVQAQP 492

Query: 457 LLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDI 516
           LL P  + + E E     E    L + G++ +R GP  + +R++P  L + ++  L+R +
Sbjct: 493 LLVPLALSVSEKEADAAEEFSALLQQFGLELQRSGPEKMTVRQVPVYLQQADVEPLVRSV 552

Query: 517 IDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHG 576
           + ++I   T+  +Q     IL+TMAC+GS+R+ R++   EMN LLR+ME+   S QCNHG
Sbjct: 553 LADVIQHETSDAIQAHRNEILSTMACHGSVRANRRLTVPEMNALLRDMERTERSGQCNHG 612

Query: 577 RPTFIKLKLSDIEKLFGR 594
           RPT+ +L  S+++KLF R
Sbjct: 613 RPTWTQLTQSELDKLFLR 630


>gi|58582355|ref|YP_201371.1| DNA mismatch repair protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84624234|ref|YP_451606.1| DNA mismatch repair protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188576161|ref|YP_001913090.1| DNA mismatch repair protein [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|81311818|sp|Q5GZ85|MUTL_XANOR RecName: Full=DNA mismatch repair protein mutL
 gi|123739091|sp|Q2P295|MUTL_XANOM RecName: Full=DNA mismatch repair protein mutL
 gi|238691577|sp|B2SHP8|MUTL_XANOP RecName: Full=DNA mismatch repair protein mutL
 gi|58426949|gb|AAW75986.1| DNA mismatch repair protein MutL [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84368174|dbj|BAE69332.1| DNA mismatch repair protein mutL [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|188520613|gb|ACD58558.1| DNA mismatch repair protein MutL [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 625

 Score =  561 bits (1445), Expect = e-157,   Method: Composition-based stats.
 Identities = 215/625 (34%), Positives = 342/625 (54%), Gaps = 33/625 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    +I DNG
Sbjct: 1   MAIRQLPEMLINQIAAGEVVERPASVVKELVENALDAGATRVDIELEEGGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  +E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TL SR      G
Sbjct: 61  GGIAPDELPLAVSRHATSKIASLDDLETVATLGFRGEALPSIASVSRFTLTSRRHDAEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           + + I G ++  V P A  PGT VEVR+LFF +PAR  FL++E+ E   I + +R +A+A
Sbjct: 121 SALEIDGGRLGEVVPRAHAPGTTVEVRELFFNVPARRKFLRAERTELGHIEEWLRSLALA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P V    S       +        +    + + +GEDF   A+ ++     + L G+  
Sbjct: 181 RPDVELRVSHNGKPSRRYKPGDLYSDAR--LGETLGEDFARQALRVDHSGAGLRLHGWVA 238

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P ++R + +Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VDVN
Sbjct: 239 QPHYSRASTDQQYLYVNGRSVRDRSVAHAVKMAYGDVLFHGRQPAYVLFLELDPARVDVN 298

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMI---------------- 342
           VHPAK  +RFR   +I +F+ +++Q A+       +                        
Sbjct: 299 VHPAKHEVRFREARLIHDFVYRTLQDALAHTRAGATPNSIGSDGAGYTGATAGEMGNIAS 358

Query: 343 --SSFHQDNAPKTHLPKYATSLTNTQEKLFLQ--ENRLSTNDLLPSDDPTYSEDNDPVE- 397
              + H +   ++       + T +Q  L L+  E R + + L         +       
Sbjct: 359 GGPANHGNAPGRSGSAYSYANWTPSQTPLGLRVDEARAAYSALYAPPPRNAPQSTGMPSM 418

Query: 398 --------ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                     ++    LG A AQ+H  YI+++  +GL++VD HAAHER+++E+++   +S
Sbjct: 419 AGTGLPATSEDSGVPPLGYAIAQLHGIYILAENAEGLIVVDMHAAHERIVYERLKNAHDS 478

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             + +Q LL P  + + E E        + L  LG +  R GP ++ +R IPA+L+    
Sbjct: 479 IGLHAQPLLVPMTLAVGEREADTAEREADTLATLGFEITRAGPQSLHVRSIPALLANAEP 538

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
             LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME    
Sbjct: 539 EALLRDVLGDLREHGQSCRIASARDELLSTMACHGAVRANRRLTVPEMNALLRDMEATER 598

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ +  LSDI++ F R
Sbjct: 599 SGQCNHGRPTWARFTLSDIDRWFLR 623


>gi|323135584|ref|ZP_08070667.1| DNA mismatch repair protein MutL [Methylocystis sp. ATCC 49242]
 gi|322398675|gb|EFY01194.1| DNA mismatch repair protein MutL [Methylocystis sp. ATCC 49242]
          Length = 602

 Score =  560 bits (1444), Expect = e-157,   Method: Composition-based stats.
 Identities = 239/598 (39%), Positives = 362/598 (60%), Gaps = 5/598 (0%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L   ++++IAAGE++ERP+ A+KEL+EN+LDA ++R++  I  GG+   ++ D+G
Sbjct: 5   MPVRRLDPILVDRIAAGEVVERPASAVKELVENALDAGATRIDVAIEEGGRKLIRVIDDG 64

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM   ++ +AV+RH TSKI D D ++I T GFRGEALPSI AV+ LT+ +R      G 
Sbjct: 65  CGMDENDLALAVERHATSKIPDGDLTHIATLGFRGEALPSIAAVADLTIDTRAQNAPHGF 124

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            I +       +   +   GT +E R LF   PARL FLK+E+ ET  + DV++R+A+A+
Sbjct: 125 SIRVEAGDRRGLTASSWPRGTRIEARALFAATPARLKFLKTERTETAAVVDVVKRLAMAH 184

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGN-FPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           P V F FS      +       +      RI+QV+GE+F  NA+E++ +   + L G   
Sbjct: 185 PDVRFGFSADNGALFDYPACGDDAAGRARRIAQVLGEEFRANAIEIDAERAGVRLTGLAS 244

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PT+NRGNA   YV++NGR V+DK     IR AY + +   R+PVV L +  DPR VDVN
Sbjct: 245 LPTYNRGNAQLQYVYVNGRPVRDKLFAGAIRAAYLDFLSPDRHPVVALFIGCDPRIVDVN 304

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHPAK+ +RF +P ++R  ++ ++++A+ +K   ++    +  + +F + NA +   P  
Sbjct: 305 VHPAKAEVRFADPGLVRGLVVGALKQALAEKSHRSADTA-RAAVETFARANAARHDAPWR 363

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQL--GIACAQIHQN 416
           A    N   +               + D      +  V E+ A       G A AQ+H+ 
Sbjct: 364 APPPANWDIRHSPHAPSGFAESPQAAFDVGAPAADARVHEAPAQDTDAPLGAARAQLHET 423

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEH 476
           YII+QT DGLVIVDQHAAHERL++EK+++    T +  Q LL P ++DL E     +   
Sbjct: 424 YIIAQTRDGLVIVDQHAAHERLVYEKLKRQREETGVARQMLLIPVVVDLDESRMNALAGA 483

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            ++L  LG+  E FGP A+ +RE P+IL + +  +L+ DI D + +      L  R++++
Sbjct: 484 FDELAALGLALEPFGPGAVLVREAPSILGEVDHRRLVEDIADLLAEDGDARGLSRRLDHV 543

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LAT AC+ S+R+GR++ + EMN LLREME  P + QCNHGRPT+++LKL+DIEKLFGR
Sbjct: 544 LATCACHHSVRAGRRLGAAEMNALLREMETTPGAGQCNHGRPTYVELKLADIEKLFGR 601


>gi|77456749|ref|YP_346254.1| DNA mismatch repair protein [Pseudomonas fluorescens Pf0-1]
 gi|77380752|gb|ABA72265.1| DNA mismatch repair protein [Pseudomonas fluorescens Pf0-1]
          Length = 635

 Score =  560 bits (1443), Expect = e-157,   Method: Composition-based stats.
 Identities = 215/625 (34%), Positives = 345/625 (55%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +  GG    ++ D+G 
Sbjct: 9   RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGAKRIDVDVEQGGVKLLRVRDDGS 68

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++++++P+A+ RH TSKI   +D   + + GFRGEAL SI +V+ LTL SR    +   
Sbjct: 69  GISADDLPLALARHATSKIRNLEDLEQVMSLGFRGEALASISSVARLTLTSRTRDADQAW 128

Query: 120 QIAISGEKI-SSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  +   V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+R+A+A
Sbjct: 129 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKTEKTEFDHLQEVIKRLALA 188

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           ++    +     R++ + G  F+  A+ +  + N + L G+ G
Sbjct: 189 RFDVAFHLRHNGKTILSLHEAHDDAARARRVAAICGSGFLEQALPIEIERNGLHLWGWVG 248

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTFNR  A+  Y F+NGR V+DK +   +R AY + +  GR+P   L  E+DP  VDVN
Sbjct: 249 LPTFNRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFALFFEVDPAAVDVN 308

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKK-------GISTSSVLSKKMISSFHQDNAP 351
           VHP K  +RFR+  ++ +F+  ++ +A+          G  T++++    + +       
Sbjct: 309 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPEDQLAGSVTTAIVRPTGLEAGEFGPQG 368

Query: 352 KTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQL----- 406
           +  L   A       +  F   +  S             +   PV E++A + +      
Sbjct: 369 EMRLAANALLEQPQAQPAFNTASGASAGGAYQYQYTPRPQSTVPVAEAQAAYREFFAPLP 428

Query: 407 -----------------GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                            G A AQ+   YI+S+   GLV+VD HAAHER+++E+++    S
Sbjct: 429 EANANALPAGQEDIPPLGYALAQLKGIYILSENAQGLVLVDMHAAHERIMYERLKIAMAS 488

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE + + + E     EH     RLG + +R GP  +AIR+IPA+L +   
Sbjct: 489 EGLSGQPLLVPESLAVSQREADCAEEHAAWFQRLGFELQRLGPETLAIRQIPALLKQAEA 548

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    
Sbjct: 549 NRLVGDVLSDLMEYGTSDRIQAHLNELLGTMACHGAIRANRRLALPEMNGLLRDMENTER 608

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ +L L D++KLF R
Sbjct: 609 SGQCNHGRPTWTQLGLDDLDKLFLR 633


>gi|21243139|ref|NP_642721.1| DNA mismatch repair protein [Xanthomonas axonopodis pv. citri str.
           306]
 gi|25090749|sp|Q8PJX2|MUTL_XANAC RecName: Full=DNA mismatch repair protein mutL
 gi|21108659|gb|AAM37257.1| DNA mismatch repair protein MutL [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 625

 Score =  560 bits (1443), Expect = e-157,   Method: Composition-based stats.
 Identities = 217/625 (34%), Positives = 342/625 (54%), Gaps = 33/625 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    +I DNG
Sbjct: 1   MAIRQLPEILINQIAAGEVVERPASVVKELVENALDAGATRVDIELEEGGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+T +E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TL SR      G
Sbjct: 61  GGITPDELPLAVSRHATSKIASLDDLETVATLGFRGEALPSIASVSRFTLTSRRHDAEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           + + I G ++  V P A  PGT VEVR+LFF +PAR  FL++E+ E   I + +R +A+A
Sbjct: 121 SALEIDGGRLGEVVPRAHAPGTTVEVRELFFNVPARRKFLRAERTELGHIEEWLRSLALA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P V    S       +        +    + + +G+DF   A+ ++     + L G+  
Sbjct: 181 RPDVELRVSHNGKPSRRYKPGDLYSDAR--LGETLGDDFARQALRVDHSGAGLRLHGWVA 238

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P ++R + +Q Y+++NGR+V+++ +   ++ AY + +  GR P  VL LE+DP +VDVN
Sbjct: 239 QPHYSRASTDQQYLYVNGRSVRERSVAHAVKMAYGDVLFHGRQPAYVLFLELDPARVDVN 298

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLS------KKMISSFHQDNAPK 352
           VHPAK  +RFR   +I +F+ +++Q A+       +              +S        
Sbjct: 299 VHPAKHEVRFREARLIHDFVYRTLQDALAHTRAGATPNSIGGDGTGYTAATSGGMGGIAS 358

Query: 353 THLPKYA------------TSLTNTQEKLFLQ--ENRLSTNDLLPSDDPTYSEDNDP--- 395
             +P                S T +Q  L L+  E R + + L      +  +       
Sbjct: 359 GGVPGNGGASIGSGGAYSYASWTPSQTPLGLRVDEARAAYSALYAPPPSSAQQSAGMPNM 418

Query: 396 ------VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                     ++    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++   +S
Sbjct: 419 AGTGLPATAQDSGVPPLGYAIAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKHAHDS 478

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             + +Q LL P  + + E E        E L  LG +  R GP ++ +R IPA+L+    
Sbjct: 479 IGLHAQPLLVPMTLAVGEREADTAEREAETLATLGFEITRAGPQSLHVRSIPALLANAEP 538

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
             LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME    
Sbjct: 539 EALLRDVLSDLREHGQSRRIASARDELLSTMACHGAVRANRRLTVPEMNALLRDMEATER 598

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ +  LSDI++ F R
Sbjct: 599 SGQCNHGRPTWARFTLSDIDRWFLR 623


>gi|325928077|ref|ZP_08189290.1| DNA mismatch repair protein MutL [Xanthomonas perforans 91-118]
 gi|325541575|gb|EGD13104.1| DNA mismatch repair protein MutL [Xanthomonas perforans 91-118]
          Length = 630

 Score =  560 bits (1442), Expect = e-157,   Method: Composition-based stats.
 Identities = 222/625 (35%), Positives = 350/625 (56%), Gaps = 33/625 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    +I DNG
Sbjct: 6   MAIRQLPEILINQIAAGEVVERPASVVKELVENALDAGATRVDIELEEGGVRLIRIRDNG 65

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  +E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TL SR      G
Sbjct: 66  GGIAPDELPLAVSRHATSKIASLDDLETVATLGFRGEALPSIASVSRFTLTSRRHDAEHG 125

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           + + I G ++  V P A  PGT VEVR+LFF +PAR  FL++E+ E   I + +R +A+A
Sbjct: 126 SALEIDGGRLGEVVPRAHAPGTTVEVRELFFNVPARRKFLRAERTELGHIEEWLRSLALA 185

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P V    S       +        +    + + +G+DF   A+ ++     + L G+  
Sbjct: 186 RPDVELRVSHNGKPSRRYKPGDLYSDAR--LGETLGDDFARQALRVDHSGAGLRLHGWVA 243

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P ++R + +Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VDVN
Sbjct: 244 QPHYSRASTDQQYLYVNGRSVRDRSVAHAVKMAYGDVLFHGRQPAYVLFLELDPARVDVN 303

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAIN--KKGISTSSVLSKKMISS------------ 344
           VHPAK  +RFR   +I +F+ +++Q A+   + G++ +S+ S                  
Sbjct: 304 VHPAKHEVRFREARLIHDFVYRTLQDALAHTRAGVTPNSIGSDGAGDPGATAGGLGNIAG 363

Query: 345 ---FHQDNAPKTHLPKYA-TSLTNTQEKLFLQ--ENRLSTNDLLPSDDPTYSEDNDPVE- 397
               +  NAP +    Y   S T +Q  L L+  E R + + L      +  +       
Sbjct: 364 SGVPNHGNAPGSSGSGYNYPSWTPSQTPLGLRVDEARAAYSALYAPPPSSAQQSAGMPSM 423

Query: 398 --------ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                     ++    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++   +S
Sbjct: 424 AGTGLPATAQDSGVPPLGYAVAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKNAHDS 483

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             + +Q LL P  + + E E        E L  LG +  R GP ++ +R IPA+L+    
Sbjct: 484 IGLHAQPLLVPMTLAVGEREADTAEREAETLATLGFEITRAGPQSLHVRSIPALLANAEP 543

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
             LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME    
Sbjct: 544 EALLRDVLGDLREHGQSRRIASARDELLSTMACHGAVRANRRLTVPEMNALLRDMEATER 603

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ +  LSDI++ F R
Sbjct: 604 SGQCNHGRPTWARFTLSDIDRWFLR 628


>gi|86356494|ref|YP_468386.1| DNA mismatch repair protein [Rhizobium etli CFN 42]
 gi|123765850|sp|Q2KBX7|MUTL_RHIEC RecName: Full=DNA mismatch repair protein mutL
 gi|86280596|gb|ABC89659.1| DNA mismatch repair protein [Rhizobium etli CFN 42]
          Length = 610

 Score =  560 bits (1442), Expect = e-157,   Method: Composition-based stats.
 Identities = 300/611 (49%), Positives = 408/611 (66%), Gaps = 19/611 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+LSE +INQIAAGE+IERP+ A KELIEN+LDA ++R+E   AGGGK+  +++DNG
Sbjct: 1   MAIRQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIATAGGGKALLRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM + ++ +A++RHCTSKIS+   +I T GFRGEALPSIG+V+ L++ SR   +  G +
Sbjct: 61  SGMDAADLELAIRRHCTSKISETLEDIRTLGFRGEALPSIGSVARLSIASRKRDSAGGHE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA++G K+  +RP   NPGTIVEVRDLFF  PARL FLK+E+ E   IT++++RMAIA+P
Sbjct: 121 IAVAGGKVLHLRPAGANPGTIVEVRDLFFATPARLKFLKTEKAEAGAITEIVKRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V F  S   S+R  + F +T  +   R++QV+G+DF +NA+ L+    EI+L G+ G+P
Sbjct: 181 AVRFVLS--GSDRATLEFPATGDDHLARMAQVLGKDFSDNAIALDAVREEISLTGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+   Y F+NGR VQDK ILS IR AYAETIP GRYPV VL + +DP  VDVNVH
Sbjct: 239 TFNRGNSAHQYAFVNGRPVQDKLILSAIRGAYAETIPSGRYPVAVLSIALDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY-- 358
           PAKS +RFR+P ++R  I+ +I++A+ + G   ++  +  M+ +F     P    P+   
Sbjct: 299 PAKSDVRFRDPGLVRGLIVGAIREALARDGSRAATTGASDMLRAFRPGFQPYGQRPQAPW 358

Query: 359 ----ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDND-----------PVEESEATH 403
               + S        F +  + S + L         + +            PV       
Sbjct: 359 SAETSPSRPYQPAPAFSERPQASFDGLSTPTARAEPQFSPDPVSPGLASPRPVAPETVGR 418

Query: 404 YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEII 463
           Y LG A AQIH NYI++QT DGLVIVDQHAAHERL+FE MR+  +S ++ SQ LL PEI+
Sbjct: 419 YPLGAARAQIHANYIVAQTEDGLVIVDQHAAHERLVFEAMRKALHSKRLASQVLLIPEIV 478

Query: 464 DLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDS 523
           D+ E +C  +M H  +   LG+  ERFGP AIA+RE PA+L + +   L+R + DEI + 
Sbjct: 479 DIPEEDCDRLMLHAAEFAELGLAIERFGPGAIAVRETPAMLGEVDAHGLIRQLADEIAEW 538

Query: 524 STTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKL 583
            T   L  ++E + ATMAC+GS+RSGR+++  EMN LLREME  P S QCNHGRPT+I+L
Sbjct: 539 DTASGLSAKLEYVAATMACHGSVRSGRRLRPEEMNALLREMEVTPGSGQCNHGRPTYIEL 598

Query: 584 KLSDIEKLFGR 594
           KLSDIE+LFGR
Sbjct: 599 KLSDIERLFGR 609


>gi|166711797|ref|ZP_02243004.1| DNA mismatch repair protein [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 625

 Score =  560 bits (1442), Expect = e-157,   Method: Composition-based stats.
 Identities = 215/625 (34%), Positives = 340/625 (54%), Gaps = 33/625 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    +I DNG
Sbjct: 1   MAIRQLPEMLINQIAAGEVVERPASVVKELVENALDAGATRVDIELEEGGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  +E+ +AV RH TSKI+  DD   + T GFRGEALPSI +VS  TL SR      G
Sbjct: 61  GGIAPDELSLAVSRHATSKIASLDDLETVATLGFRGEALPSIASVSRFTLTSRRHDAEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           + + I G ++  V P A  PGT VEVR+LFF +PAR  FL++E+ E   I + +R +A+A
Sbjct: 121 SALEIDGGRLGEVVPRAHAPGTTVEVRELFFNVPARRKFLRAERTELGHIEEWLRSLALA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P V    S       +        +    + + +GEDF   A+ ++     + L G+  
Sbjct: 181 RPDVELRVSHNGKPSRRYKPGDLYSDAR--LGETLGEDFARQALRVDHSGAGLRLHGWVA 238

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P ++R + +Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VDVN
Sbjct: 239 QPHYSRASTDQQYLYVNGRSVRDRSVAHAVKMAYGDVLFHGRQPAYVLFLELDPARVDVN 298

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMIS--------------- 343
           VHPAK  +RFR   +I +F+ +++Q A+       +        +               
Sbjct: 299 VHPAKHEVRFREARLIHDFVYRTLQDALAHTRAGATPNSIGSDGAGDTGATAGEMGNIAS 358

Query: 344 ---SFHQDNAPKTHLPKYATSLTNTQEKLFLQ--ENRLSTNDLLPSDDPTYSEDNDPVE- 397
              + H +    +       S T +Q  L L+  E R + + L         +       
Sbjct: 359 GGLANHGNAPGSSGRAYSYASWTPSQTPLGLRVDEARAAYSALYAPPPRNAPQSTGMPSM 418

Query: 398 --------ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                     ++    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++   +S
Sbjct: 419 AGTGLPATAEDSGVPPLGYAIAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKNAHDS 478

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             + +Q LL P  + + E E        + L  LG +  R GP ++ +R IPA+L+    
Sbjct: 479 IGLHAQPLLVPMTLAVGEREADTAEREADTLATLGFEITRAGPQSLHVRSIPALLANAEP 538

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
             LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME    
Sbjct: 539 EALLRDVLGDLREHGQSRRIASARDELLSTMACHGAVRANRRLTVPEMNALLRDMEATER 598

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ +  LSDI++ F R
Sbjct: 599 SGQCNHGRPTWARFTLSDIDRWFLR 623


>gi|78048158|ref|YP_364333.1| DNA mismatch repair protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|123757458|sp|Q3BSD0|MUTL_XANC5 RecName: Full=DNA mismatch repair protein mutL
 gi|78036588|emb|CAJ24279.1| DNA mismatch repair protein MutL [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 625

 Score =  560 bits (1442), Expect = e-157,   Method: Composition-based stats.
 Identities = 220/625 (35%), Positives = 348/625 (55%), Gaps = 33/625 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    +I DNG
Sbjct: 1   MAIRQLPEILINQIAAGEVVERPASVVKELVENALDAGATRVDIELEEGGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  +E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TL SR      G
Sbjct: 61  GGIAPDELPLAVSRHATSKIASLDDLETVATLGFRGEALPSIASVSRFTLTSRRHDAEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           + + I G ++  V P A  PGT VEVR+LFF +PAR  FL++E+ E   I + +R +A+A
Sbjct: 121 SALEIDGGRLGEVVPRAHAPGTTVEVRELFFNVPARRKFLRAERTELGHIEEWLRSLALA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P V    S       +        +    + + +G+DF   A+ ++     + L G+  
Sbjct: 181 RPDVELRVSHNGKPSRRYKPGDLYSDAR--LGETLGDDFARQALRVDHSGAGLRLHGWVA 238

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P ++R + +Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VDVN
Sbjct: 239 QPHYSRASTDQQYLYVNGRSVRDRSVAHAVKMAYGDVLFHGRQPAYVLFLELDPARVDVN 298

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAIN--KKGISTSSVLSKKMISS------------ 344
           VHPAK  +RFR   +I +F+ +++Q A+   + G++ +S+ S                  
Sbjct: 299 VHPAKHEVRFREARLIHDFVYRTLQDALAHTRAGVTPNSIGSDGAGDPGATAGGLGNIAG 358

Query: 345 ----FHQDNAPKTHLPKYATSLTNTQEKLFLQ--ENRLSTNDLLPSDDPTYSEDNDPVE- 397
                H + A  +       S T +Q  L L+  E R + + L      +  +       
Sbjct: 359 SGVPNHGNAAGSSGSGYNYASWTPSQTPLGLRVDEARAAYSALYAPPPSSAQQSAGMPSM 418

Query: 398 --------ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                     ++    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++   +S
Sbjct: 419 AGTGLPATAQDSGVPPLGYAVAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKNAHDS 478

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             + +Q LL P  + + E E        E L  LG +  R GP ++ +R IPA+L+    
Sbjct: 479 IGLHAQPLLVPMTLAVGEREADTAEREAETLATLGFEITRAGPQSLHVRSIPALLANAEP 538

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
             LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME    
Sbjct: 539 EALLRDVLGDLREHGQSRRIASARDELLSTMACHGAVRANRRLTVPEMNALLRDMEATER 598

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ +  LSDI++ F R
Sbjct: 599 SGQCNHGRPTWARFTLSDIDRWFLR 623


>gi|325923187|ref|ZP_08184872.1| DNA mismatch repair protein MutL [Xanthomonas gardneri ATCC 19865]
 gi|325546332|gb|EGD17501.1| DNA mismatch repair protein MutL [Xanthomonas gardneri ATCC 19865]
          Length = 620

 Score =  560 bits (1442), Expect = e-157,   Method: Composition-based stats.
 Identities = 213/620 (34%), Positives = 348/620 (56%), Gaps = 28/620 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L + +INQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    +I DNG
Sbjct: 1   MAIRQLPDILINQIAAGEVVERPASVVKELVENALDAGATRVDIELEEGGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  +E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TL+SR      G
Sbjct: 61  GGIPPDELPLAVSRHATSKIASLDDLETVATLGFRGEALPSIASVSRFTLVSRRHDAEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           + + I G ++  V P A  PGT VEVR+LF+ +PAR  FL++E+ E   I + +R +A+A
Sbjct: 121 SALEIEGGRLGEVTPRAHAPGTTVEVRELFYNVPARRKFLRAERTELGHIEEWLRSLALA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P V    +       +        +    + + +GEDF   A+ ++     + L G+  
Sbjct: 181 RPDVELRVAHNGKPSRRYKPGDLYSDAR--LGETLGEDFTRQALRVDHSGAGLRLHGWVA 238

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P ++R + +Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VDVN
Sbjct: 239 QPHYSRASTDQQYLYVNGRSVRDRSVAHAVKMAYGDVLFHGRQPAYVLFLELDPARVDVN 298

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKK------------GISTSSVLSKKMISSFH 346
           VHPAK  +RFR   +I +F+ +++Q A+               G S +      M ++ +
Sbjct: 299 VHPAKHEVRFREARLIHDFVYRTLQDALAHTRAGAMPNSIGTEGTSDTGAAPSGMANTPN 358

Query: 347 QDNAPKTHLPKYATSLTNTQEKLFLQ--ENRLSTNDLLPSDDPTYSEDNDPVE------- 397
              A  +       + T +Q  L L+  E R + + L      +  + +  ++       
Sbjct: 359 YGGATGSGGGTGYGNWTPSQTPLGLRVDEARAAYSALYAPPSGSAQQQSAAMQTFSGTGL 418

Query: 398 ---ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITS 454
                ++    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++   +S  + +
Sbjct: 419 PATSHDSGVPPLGYAVAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKNAHDSIGLHA 478

Query: 455 QTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLR 514
           Q LL P  + + E E        + L  LG +  R GP ++ +R IPA+L+      LLR
Sbjct: 479 QPLLVPMTLAVGEREADTAEREADTLASLGFEITRAGPQSLHVRSIPALLANAEPEALLR 538

Query: 515 DIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCN 574
           D++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME    S QCN
Sbjct: 539 DVLGDLREHGQSRRIATARDELLSTMACHGAVRANRRLSVPEMNALLRDMEATERSGQCN 598

Query: 575 HGRPTFIKLKLSDIEKLFGR 594
           HGRPT+ +  L +I++ F R
Sbjct: 599 HGRPTWARFTLGEIDRWFLR 618


>gi|256015004|ref|YP_003105013.1| DNA mismatch repair protein [Brucella microti CCM 4915]
 gi|255997664|gb|ACU49351.1| DNA mismatch repair protein [Brucella microti CCM 4915]
          Length = 623

 Score =  560 bits (1442), Expect = e-157,   Method: Composition-based stats.
 Identities = 273/622 (43%), Positives = 395/622 (63%), Gaps = 28/622 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           MKIR LSE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG
Sbjct: 1   MKIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL SRP   ++G +
Sbjct: 61  SGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSRPQDADSGFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + ++G  +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P
Sbjct: 121 VCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ +      ++M    +      ERI QV+G +F  NA+ ++ + + + L G+ GI
Sbjct: 181 HIRFSLAGTDRTPFEMPATGTGAEATLERIGQVLGREFGENALAIDAERDGVRLAGFVGI 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTFNRGNA   + ++NGR V+DK I   +R A+++ I   R+PV VL L +DP  VDVNV
Sbjct: 241 PTFNRGNALHQFAYVNGRPVRDKQIFGALRGAHSDVIARDRHPVAVLFLTLDPALVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD-NAPKTHLPKY 358
           HPAK+ +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F  +    +   P+ 
Sbjct: 301 HPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRP 360

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTY--------------------------SED 392
           A S +    +      R   +                                    +  
Sbjct: 361 ANSYSPASWRTAPPAPRSEWSPQTAHPAHRPLDLQAAPALRENGQAVLGDVAVPAADARA 420

Query: 393 NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
           +      E     LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++  I
Sbjct: 421 SVAEAPVELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHARPI 480

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
             Q LL PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+ QL
Sbjct: 481 AGQMLLIPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLGEMNVQQL 540

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           +RD+ DEI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P S  
Sbjct: 541 IRDLADEIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPGSGT 600

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 601 CNHGRPTYIELKLTDIERLFGR 622


>gi|56698186|ref|YP_168558.1| DNA mismatch repair protein [Ruegeria pomeroyi DSS-3]
 gi|56679923|gb|AAV96589.1| DNA mismatch repair protein MutL [Ruegeria pomeroyi DSS-3]
          Length = 621

 Score =  559 bits (1441), Expect = e-157,   Method: Composition-based stats.
 Identities = 259/607 (42%), Positives = 384/607 (63%), Gaps = 16/607 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+EN++DA ++R+   +A GGK+  +++D+G G
Sbjct: 15  IRQLDETAINRIAAGEVVERPASAVKELVENAIDAGATRIAIDLADGGKTLIRVSDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT +++P+A+ RH TSKI   D  NIHTFGFRGEALPS+G+V  LT+ SR         I
Sbjct: 75  MTPDQLPLALARHATSKIDGSDLLNIHTFGFRGEALPSLGSVGRLTITSRARGAEAAN-I 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +SG ++  V+P A+  GT+VE+RDLFF  PARL F+++++ E   + D ++R+A+A P 
Sbjct: 134 RVSGGRVDPVKPAALRAGTVVELRDLFFATPARLKFMRTDRAEAQAVADTVKRLAMAEPS 193

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGNF----PERISQVIGEDFINNAVELNEKSNEITLQ 234
           VSFT    S     R      +  G+      +R++QV+G +F +NA+ ++     + L 
Sbjct: 194 VSFTLRDVSGGGEGRLVFRADAETGDLFDALRDRLAQVMGREFTDNALRIDTMREGLRLY 253

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   Y+F+NGR V+DK +   +R AY + +   R+P   L ++ DP  
Sbjct: 254 GYAALPTYSRGAAVAQYLFVNGRPVRDKMLTGALRAAYFDFLSRDRHPAAALFIDCDPTL 313

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD------ 348
           VDVNVHPAKS +RFR+P + R  I+ +++ A+ + G   S+ ++   + +   +      
Sbjct: 314 VDVNVHPAKSEVRFRDPGVARGLIVSALRHALAEAGHRASTTVAGATLGAMRPEQTGARI 373

Query: 349 NAPKTHLPKYATSLTNTQEKLFLQ-ENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLG 407
                  P    +    Q   F +  +  S   + P          +P  E+      LG
Sbjct: 374 YQMDRPSPAARMASHQAQAPGFAELSSSYSGRMVEPEPGEDARRAEEPPAETPPESLPLG 433

Query: 408 IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLE 467
            A  Q+H+NYII+QT DG+VIVDQHAAHERL++EK+++    T + +Q LL PEI++L  
Sbjct: 434 AARGQVHENYIIAQTADGMVIVDQHAAHERLVYEKLKRQMAETGVAAQALLIPEIVELST 493

Query: 468 GECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTY 527
            +CA +++  +DL RLG+  E FG  A+A+RE PAIL   +   +LRDI+DE+ D   + 
Sbjct: 494 ADCARLLDLSDDLARLGLTIEPFGGGAVAVRETPAILGPVDAGAMLRDILDELADQGESA 553

Query: 528 TLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSD 587
           TLQ RIE IL+ +AC+GSIRSGR+M+  EMN LLREME  P+S QCNHGRPT+++LKLSD
Sbjct: 554 TLQARIEAILSRVACHGSIRSGRRMRGEEMNALLREMEATPHSGQCNHGRPTYVELKLSD 613

Query: 588 IEKLFGR 594
           IE+LFGR
Sbjct: 614 IERLFGR 620


>gi|149200821|ref|ZP_01877796.1| DNA mismatch repair protein [Roseovarius sp. TM1035]
 gi|149145154|gb|EDM33180.1| DNA mismatch repair protein [Roseovarius sp. TM1035]
          Length = 611

 Score =  559 bits (1441), Expect = e-157,   Method: Composition-based stats.
 Identities = 261/601 (43%), Positives = 390/601 (64%), Gaps = 12/601 (1%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR+L E  IN+IAAGE++ERP+ A+KEL+EN+LDA ++R+E   A GGK+  +++D+G 
Sbjct: 14  QIRQLDEGAINRIAAGEVVERPASAVKELVENALDAGATRIEVSYADGGKTLIRVSDDGC 73

Query: 62  GMTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           GMT +E+P+A+ RH TSKI   D  NIH+FGFRGEALPS+GAV  LT++SR       A+
Sbjct: 74  GMTPDELPLALARHATSKIDGSDLLNIHSFGFRGEALPSLGAVGRLTIVSRA--GAEAAE 131

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + ++G ++ +V+P A+N GT+V +RDLF+  PARL F++S++ E   I D ++R+A+A P
Sbjct: 132 MTVAGGQMGAVKPAALNSGTVVTLRDLFYATPARLKFMRSDRAEAQAIADTVKRLAMAEP 191

Query: 181 KVSFT---FSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITL 233
            V FT    S     R        +G+  +    R+++V+G +F  NA++++     + L
Sbjct: 192 FVGFTLRDVSGGGEGRIVFRADPESGDLFDALHGRLARVLGAEFAENALKIDATREGLRL 251

Query: 234 QGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPR 293
            GY  +PT+ RG+A   Y+F+NGR V+DK +   +R AY + +   R+P   L L  DP 
Sbjct: 252 TGYAALPTYARGSAVAQYLFVNGRPVRDKMLYGALRAAYQDVLSRDRHPAAALFLGCDPT 311

Query: 294 QVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKT 353
            VDVNVHPAKS +RFR+P + R  I+  ++ A+ + G   S+ ++   + +F  + A + 
Sbjct: 312 LVDVNVHPAKSEVRFRDPGLARGLIVSGLRHALAEAGHRASTTVAGATLGAFRAEPAGRI 371

Query: 354 HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQI 413
           +     +    +    +  +     +          S     VEE  AT   LG A AQ+
Sbjct: 372 YQMDRPSPQARSL--AYQAQAPGFADMGADWSARVESAPEPEVEEQPATALPLGAARAQV 429

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
           H+NYII+QT  G+VIVDQHAAHERL++E++++    + I +Q LL PEI+DL E +CAL+
Sbjct: 430 HENYIIAQTETGMVIVDQHAAHERLVYERLKRQMAESGIAAQALLIPEIVDLSEADCALL 489

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRI 533
           M+H E+L  +G+  E FG  ++A+RE PAIL   N   LLRDI+DE+ D   + TL+ RI
Sbjct: 490 MDHAEELAGMGLGIEPFGSGSLAVRETPAILGTVNAGALLRDILDELQDQGASGTLKLRI 549

Query: 534 ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFG 593
           + IL+ +AC+GS+RSGR+M + EMN LLREME+ P S QCNHGRPT+++L+LSDIE+LFG
Sbjct: 550 DAILSRVACHGSVRSGRRMSADEMNALLREMERTPMSGQCNHGRPTYVELRLSDIERLFG 609

Query: 594 R 594
           R
Sbjct: 610 R 610


>gi|227821008|ref|YP_002824978.1| DNA mismatch repair protein [Sinorhizobium fredii NGR234]
 gi|254766173|sp|C3MGW0|MUTL_RHISN RecName: Full=DNA mismatch repair protein mutL
 gi|227340007|gb|ACP24225.1| DNA mismatch repair protein MutL [Sinorhizobium fredii NGR234]
          Length = 600

 Score =  559 bits (1441), Expect = e-157,   Method: Composition-based stats.
 Identities = 296/601 (49%), Positives = 409/601 (68%), Gaps = 9/601 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I++LSE +INQIAAGE+IERP+ A KELIEN+LDA ++R+E   AGGGK+  ++TDNG
Sbjct: 1   MAIKQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEVATAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM+  ++ +A++RHCTSKI D  ++I T GFRGEALPSIG+V+ L++ +R      GA 
Sbjct: 61  NGMSPADLELAIRRHCTSKIDDTLTDIRTLGFRGEALPSIGSVARLSITTRTAGAREGAA 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I++ G K  SVRP   N GT+VEVRDLFF  PARL F+K+E+ E   I++V+RRMAIA+P
Sbjct: 121 ISVIGGKTESVRPSPANVGTVVEVRDLFFATPARLKFMKTEKAEAAAISEVVRRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
           KV F  S   S+R  + F +T  +   R++QV+G+DF +NA+ ++ +  E  L G+ G+P
Sbjct: 181 KVRFVVS--GSDRSTLEFPATGDDRLARMAQVLGKDFRDNAIGIDAEREEARLSGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+ Q Y F+NGR VQDK ILS IR AYAETIP GRYPV VL + +DP  VDVNVH
Sbjct: 239 TFNRGNSLQQYAFVNGRPVQDKLILSAIRAAYAETIPQGRYPVAVLSIALDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA- 359
           PAKS +RFR+P +IR  II +I++A+++ G   ++  ++ M+ SF  +          A 
Sbjct: 299 PAKSDVRFRDPGLIRGLIIGAIREALSRGGDRAATTGAQGMMRSFRPEAYRAEPHRAQAP 358

Query: 360 -TSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEAT-----HYQLGIACAQI 413
            T+ T+    +   E      +   +    +++      E+         + LG A AQ+
Sbjct: 359 WTAATSPYRPMRFDEPARGFAEAPQAAFQEFAQPAARPAETAPNGTVEPAFPLGAARAQL 418

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
           H+NYI++QT +GLVIVDQHAAHERL+FE MR   +S  + +Q LL PEI+DL E +C  +
Sbjct: 419 HENYIVAQTEEGLVIVDQHAAHERLVFEAMRTALHSRPVPAQALLIPEIVDLAEDDCDRL 478

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRI 533
           M H E+  RLG+  ERFGP AIA+RE PA+L + +   L+R + DE+ +  T   L  R+
Sbjct: 479 MAHAEEFLRLGLSIERFGPGAIAVRETPAMLGEMDASGLVRQLADELAEWDTANGLAGRL 538

Query: 534 ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFG 593
           + + ATMAC+GS+RSGR+M+  EMN LLR+ME  P S QCNHGRPT+I+LKL+DIE+LFG
Sbjct: 539 DYLAATMACHGSVRSGRRMRPEEMNALLRQMEATPGSGQCNHGRPTYIELKLADIERLFG 598

Query: 594 R 594
           R
Sbjct: 599 R 599


>gi|148553415|ref|YP_001260997.1| DNA mismatch repair protein [Sphingomonas wittichii RW1]
 gi|166232109|sp|A5V3J3|MUTL_SPHWW RecName: Full=DNA mismatch repair protein mutL
 gi|148498605|gb|ABQ66859.1| DNA mismatch repair protein MutL [Sphingomonas wittichii RW1]
          Length = 594

 Score =  559 bits (1441), Expect = e-157,   Method: Composition-based stats.
 Identities = 226/597 (37%), Positives = 355/597 (59%), Gaps = 7/597 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E ++N+IAAGE++ERP+ A+KEL+ENS+DA + R+   ++ GG S   + D+G
Sbjct: 1   MSIRRLPEHLVNRIAAGEVVERPASALKELVENSIDAGARRISVSLSEGGLSAIDVADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +EI +A++RH TSK+ DD    + T GFRGEALPSIG+V+ LT+ SR    + G 
Sbjct: 61  CGMTPDEIALALERHATSKLPDDAIEAVTTLGFRGEALPSIGSVADLTIESRVRGAD-GW 119

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
              +   ++    P A+ PGT + V +LF  +PAR  FL+S + E     DVI+R+A+A 
Sbjct: 120 HRRVDHGELVGEGPAALPPGTRIRVSNLFAKVPARRKFLRSARAEYAACVDVIKRLAMAR 179

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P + FT         +    + +    +R++ +   D   N+V ++ +   ++L G  G+
Sbjct: 180 PDIGFTLEHEGR---RAILVAPDEQRVDRVAALTDRDLAQNSVAVDFRREAVSLTGVAGL 236

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTFNRG A+  ++F+NGR V+D+ ++  +R AY + +   R+PV+ L +E+   QVDVNV
Sbjct: 237 PTFNRGVADHQFLFVNGRPVKDRLLIGAVRGAYQDMLARDRHPVIALFVELPGDQVDVNV 296

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HPAK+ +RFR+P ++R  I+  ++ A+++ G  +    S   + ++     P       A
Sbjct: 297 HPAKTEVRFRDPGLVRGMIVGGLRAALDEAGHRSVQRPSVAALGNWQAGGLPTASSTAPA 356

Query: 360 TSLTNTQEKLFLQENRLSTNDLL--PSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNY 417
                       +  + S  D +   +  P    +       +   Y +G+A  Q+   Y
Sbjct: 357 IPNGFAFGAAAERSGQGSVWDRVADFAPAPMARAEPAYSPPPQQASYPMGVARGQVAATY 416

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHD 477
           I+++  DGLVIVDQHAAHERL+ E+MR+      +  Q LL PE+++L E  C  +    
Sbjct: 417 IVAEAEDGLVIVDQHAAHERLVLERMRRAMADGGVARQALLLPEVVELDEVGCDRLETRI 476

Query: 478 EDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENIL 537
            +L  +G++ ERFGP A+ +R  PA+L + ++  L+ D+ DE+       +L++R++++ 
Sbjct: 477 AELAEMGLELERFGPKAMLVRATPALLGQGDVHGLIVDLADELAAYDEALSLKERLDHVA 536

Query: 538 ATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ATMAC+GS+R+GR +   EMN LLREME  P+S QCNHGRPT+IKL   DIEKLFGR
Sbjct: 537 ATMACHGSVRAGRTLSVAEMNALLREMEVTPHSGQCNHGRPTWIKLGHGDIEKLFGR 593


>gi|41582282|gb|AAS07896.1| DNA mismatch repair protein mutL [uncultured marine bacterium 463]
          Length = 624

 Score =  559 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 216/620 (34%), Positives = 344/620 (55%), Gaps = 27/620 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI++LS ++ NQIAAGE++ERP+  +KE++ENSLDA ++RV+  +  GG    +I DNG 
Sbjct: 3   KIQRLSTRLANQIAAGEVVERPASVVKEVLENSLDAGATRVDVDVESGGVKLIRIRDNGN 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNT-G 118
           G+  +++P+A+ RH TSKI+  +D   + + GFRGEAL SIG+VS LTL S   +  + G
Sbjct: 63  GIDPDDLPLAMARHATSKITSLEDLEAVGSLGFRGEALASIGSVSRLTLTSNASEQGSEG 122

Query: 119 AQIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           +  A  G  +    +P     GT VEVRDLFF  PAR  FL++E+ E N + +V++R+A+
Sbjct: 123 SSAACEGRDMEVQVKPAPHPQGTTVEVRDLFFNTPARRKFLRTEKTEFNHLEEVVKRLAL 182

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           +   V+F+        +++   +       R++ V G  F++ A+ +   ++   L G+ 
Sbjct: 183 SRFDVAFSLRHNGRGIHQLKAGTGQVEQQRRVATVCGPAFMDQAIYIENAASGFKLWGWV 242

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PTF+R  A+  Y F+NGR ++DK I   ++ AY + +  GR+P  VL LE+DP QVDV
Sbjct: 243 GLPTFSRSQADLQYFFVNGRVIRDKLIAHAVKQAYRDVLYHGRHPAFVLYLEVDPAQVDV 302

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGI---STSSVLSKKMIS----------- 343
           NVHP K  +RFR+   + NFI  S+ +A+        + +  L   M+S           
Sbjct: 303 NVHPTKHEVRFRDGRSVHNFIFSSLHRALADVRPTADNPADPLPANMLSTGDGMAINTQT 362

Query: 344 ---------SFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDND 394
                    ++              T         F                        
Sbjct: 363 GEISAQGGLAWGAGQGSAVADAPLQTQPGGGFGSRFAPNTVAPAQGSAQLAAYQQLHPQL 422

Query: 395 PVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITS 454
           P + S      LG A AQ+   YI+++   GLV+VD HAAHER+ +E+++   +   I S
Sbjct: 423 PTQGSAEDVPPLGYALAQLKGIYILAENVAGLVLVDMHAAHERITYERLKTARDEEGIRS 482

Query: 455 QTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLR 514
           Q LL P+ I + + E  +  E+++   RLG+     G  A+ IREIP  L   ++ QLLR
Sbjct: 483 QPLLVPQPIAVSQREVQVASENEDLFKRLGLSVGVAGEEALVIREIPVALRDSDVEQLLR 542

Query: 515 DIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCN 574
           D++ ++I+  ++  ++  ++ IL+TMAC+GS+R+ R++   EMN LLR+ME+   S QCN
Sbjct: 543 DVLADLIEFGSSERVEAHMDEILSTMACHGSVRANRRLTIPEMNALLRDMEETERSGQCN 602

Query: 575 HGRPTFIKLKLSDIEKLFGR 594
           HGRPT+ +++L +++KLF R
Sbjct: 603 HGRPTWTQMRLDELDKLFLR 622


>gi|254480864|ref|ZP_05094110.1| DNA mismatch repair protein MutL [marine gamma proteobacterium
           HTCC2148]
 gi|214038659|gb|EEB79320.1| DNA mismatch repair protein MutL [marine gamma proteobacterium
           HTCC2148]
          Length = 624

 Score =  559 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 216/620 (34%), Positives = 344/620 (55%), Gaps = 27/620 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI++LS ++ NQIAAGE++ERP+  +KE++ENSLDA ++RV+  +  GG    +I DNG 
Sbjct: 3   KIQRLSTRLANQIAAGEVVERPASVVKEVLENSLDAGATRVDVDVESGGVKLIRIRDNGN 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNT-G 118
           G+  +++P+A+ RH TSKI+  +D   + + GFRGEAL SIG+VS LTL S   +  + G
Sbjct: 63  GIDPDDLPLAMARHATSKITSLEDLEAVGSLGFRGEALASIGSVSRLTLTSNASEQGSEG 122

Query: 119 AQIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           +  A  G  +    +P     GT VEVRDLFF  PAR  FL++E+ E N + +V++R+A+
Sbjct: 123 SSAACEGRDMEVQVKPAPHPQGTTVEVRDLFFNTPARRKFLRTEKTEFNHLEEVVKRLAL 182

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           +   V+F+        +++   +       R++ V G  F++ A+ +   ++   L G+ 
Sbjct: 183 SRFDVAFSLRHNGRGIHQLKAGTGQVEQQRRVATVCGPAFMDQAIYVENAASGFKLWGWV 242

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PTF+R  A+  Y F+NGR ++DK I   ++ AY + +  GR+P  VL LE+DP QVDV
Sbjct: 243 GLPTFSRSQADLQYFFVNGRVIRDKLIAHAVKQAYRDVLYHGRHPAFVLYLEVDPAQVDV 302

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGI---STSSVLSKKMIS----------- 343
           NVHP K  +RFR+   + NFI  S+ +A+        + +  L   M+S           
Sbjct: 303 NVHPTKHEVRFRDGRSVHNFIFSSLHRALADVRPTADNPADPLPANMLSTGDGMAINTQT 362

Query: 344 ---------SFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDND 394
                    ++              T         F                        
Sbjct: 363 GEISAQGGLAWGAGQGSAVADAPLQTQPGGGFGSRFAPNTVAPAQGSAQLAAYQQLHPQL 422

Query: 395 PVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITS 454
           P + S      LG A AQ+   YI+++   GLV+VD HAAHER+ +E+++   +   I S
Sbjct: 423 PTQGSAEDVPPLGYALAQLKGIYILAENVAGLVLVDMHAAHERITYERLKTARDEEGIRS 482

Query: 455 QTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLR 514
           Q LL P+ I + + E  +  E+++   RLG+     G  A+ IREIP  L   ++ QLLR
Sbjct: 483 QPLLVPQPIAVSQREVQVASENEDLFKRLGLSVGVAGEEALVIREIPVALRDSDVEQLLR 542

Query: 515 DIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCN 574
           D++ ++I+  ++  ++  ++ IL+TMAC+GS+R+ R++   EMN LLR+ME+   S QCN
Sbjct: 543 DVLADLIEFGSSERVEAHMDEILSTMACHGSVRANRRLTIPEMNALLRDMEETERSGQCN 602

Query: 575 HGRPTFIKLKLSDIEKLFGR 594
           HGRPT+ +++L +++KLF R
Sbjct: 603 HGRPTWTQMRLDELDKLFLR 622


>gi|115523441|ref|YP_780352.1| DNA mismatch repair protein [Rhodopseudomonas palustris BisA53]
 gi|122297082|sp|Q07RR2|MUTL_RHOP5 RecName: Full=DNA mismatch repair protein mutL
 gi|115517388|gb|ABJ05372.1| DNA mismatch repair protein MutL [Rhodopseudomonas palustris
           BisA53]
          Length = 603

 Score =  559 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 247/606 (40%), Positives = 375/606 (61%), Gaps = 16/606 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E I+N+IAAGE++ERP+  +KEL+EN+LDA ++R+E    GGG+    ITD+G
Sbjct: 1   MPVRQLPETIVNRIAAGEVVERPASVVKELVENALDAGANRIEVFSDGGGRRRIAITDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT  ++ +AV RH TSK+ D D   I T GFRGEALPSIG+V+ L++ +R  +     
Sbjct: 61  GGMTRADLELAVDRHATSKLDDEDLLAIRTLGFRGEALPSIGSVAKLSITTRHTEEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            +A+ G   S + P A++ GT VEV DLF+  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 ALAVEGGTKSPLVPAALSQGTRVEVSDLFYATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           P V+FT S  +                  R+S ++G +F  +A+E+  + + + ++G+ G
Sbjct: 181 PDVAFTLSGEERAPVSWAAVLPGAAGRLTRLSDILGAEFRKSAIEVRSERDGVVVEGFAG 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P+  R NA   Y+F+NGR V+D+ I+  +R AYA+ +P  R+PV+ L +  DP +VD N
Sbjct: 241 APSLTRANALGQYLFVNGRPVRDRLIIGAVRAAYADYLPRDRHPVLALFVTCDPHEVDAN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGI-STSSVLSKKMISSFHQDNAPKTH--- 354
           VHPAK+ +RFR+  ++R  I+ +++  ++++G  S ++ +    +++F    AP      
Sbjct: 301 VHPAKTEVRFRDAGLVRALIVHALKDGLSREGQRSAAASVDGATLAAFRPGFAPPPRANW 360

Query: 355 ----LPKYATSLTNTQE--KLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGI 408
                P Y  + +N  +    F +  +   +  LPS D      N     +E     LG 
Sbjct: 361 DWRRSPSYPIAGSNAMDMAPGFAEREQAGFDVGLPSADV----RNYAAPAAELIDRPLGA 416

Query: 409 ACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEG 468
           A  QIH+ YI++QT  GLVIVDQHAAHERL++EK++    S  +  Q LL PEI++L E 
Sbjct: 417 ARTQIHETYIVAQTRTGLVIVDQHAAHERLVYEKLKASMASNGVQRQLLLIPEIVELDEA 476

Query: 469 ECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYT 528
               +++  E+L   G+  + FGP A+A+RE+PA+L K N   LLRD+ + + +      
Sbjct: 477 TVEQLLDRAEELCSFGLAIDSFGPGAVAVREVPALLGKANAASLLRDLAEHMAEWDEALP 536

Query: 529 LQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDI 588
           L+ R+ ++ ATMAC+GS+R+GR ++  EMN LLREME  PNS QCNHGRPT+++L LSDI
Sbjct: 537 LERRLLHVAATMACHGSVRAGRILKPEEMNALLREMEATPNSGQCNHGRPTYVELTLSDI 596

Query: 589 EKLFGR 594
           EKLFGR
Sbjct: 597 EKLFGR 602


>gi|94500524|ref|ZP_01307055.1| DNA mismatch repair protein [Oceanobacter sp. RED65]
 gi|94427314|gb|EAT12293.1| DNA mismatch repair protein [Oceanobacter sp. RED65]
          Length = 634

 Score =  559 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 215/630 (34%), Positives = 354/630 (56%), Gaps = 37/630 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  +KEL+ENSLDA ++R+E     GG    +I DNG 
Sbjct: 3   RIHVLSPRLANQIAAGEVVERPANVVKELVENSLDAGATRIEVDAEQGGVKLIRIRDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+++ RH TSKI D  D  ++ + GFRGEAL SI +VS L+L S   ++    
Sbjct: 63  GIEKDDLPLSLSRHATSKIVDLDDLESVQSLGFRGEALASIASVSRLSLSSHEQESELAY 122

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  +++  +P A   GT VE+RDLFF  PAR  FL++E+ E N + +V++RMA++
Sbjct: 123 QVTAEGRDMATEVKPCAHPVGTTVEMRDLFFNTPARRKFLRTEKTEFNHLEEVVKRMALS 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              VSF         + +   S+  +  +RI+ ++   F+  AV ++ ++  + L G+ G
Sbjct: 183 RYDVSFQLRHNNKVIHSLRPCSSAFDQEKRIATLLSAQFMKEAVRIDMEAAGLKLWGWVG 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTFNR  A+  Y F+NGR V+DK +   IR AY + +  GR+   VL LE+DP  VDVN
Sbjct: 243 LPTFNRSQADMQYFFVNGRIVRDKLVAHAIRQAYQDVLYHGRHSAFVLYLELDPALVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLS-------------------- 338
           VHP K  +RFR+  ++ +F+ +++ KA+ +    T S                       
Sbjct: 303 VHPTKHEVRFRDGRLVHDFLFRTLHKALGEVRPETPSTDHAIPGQLQGQSQVSGIEAGEF 362

Query: 339 --KKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPS------------ 384
             +  ++           L +      N  E   +QE   +  +L  +            
Sbjct: 363 AGQNAMALSQVQGQSSNALTQSQPWQANRPEPGQVQEQMAAYQNLYQAPPADSGLANQPI 422

Query: 385 DDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMR 444
               +       +E++     LG A AQ+H  YI+SQ   GLV+VD HAAHER+ +E+++
Sbjct: 423 QSNPFQTQPQATDENQQDIPPLGYAIAQLHGIYILSQNQHGLVVVDMHAAHERITYERLK 482

Query: 445 QDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAIL 504
             +++  I SQ LL PE I +   +  +  +H+ D+ +LG + +R GP ++ IR++P +L
Sbjct: 483 MTYDAQGIQSQPLLVPETIHVSVEQADIAEQHEADIQKLGFQLQRLGPESLVIRQMPVLL 542

Query: 505 SKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREM 564
              NI  L+  ++++   + ++  + +    IL++MAC+GS+R+ R++   EMN LLR+M
Sbjct: 543 KNANIEHLVVKVLEDYRTAGSSRHMTEFRNEILSSMACHGSVRANRQLTIAEMNGLLRDM 602

Query: 565 EKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           E+   S QCNHGRPT+ +L +++++KLF R
Sbjct: 603 EQTERSGQCNHGRPTWTQLSMNELDKLFLR 632


>gi|299134224|ref|ZP_07027417.1| DNA mismatch repair protein MutL [Afipia sp. 1NLS2]
 gi|298590971|gb|EFI51173.1| DNA mismatch repair protein MutL [Afipia sp. 1NLS2]
          Length = 598

 Score =  559 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 234/597 (39%), Positives = 372/597 (62%), Gaps = 3/597 (0%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E+I+N+IAAGE++ERP+ A+KEL+EN++DA  +R++    GGG+    ITD+G
Sbjct: 1   MPVRQLPEQIVNRIAAGEVVERPASAVKELVENAIDAGGTRIDIFTEGGGRRRIAITDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT  ++ +AV+RH TSK+ D D   I T GFRGEALPSIG+V+ L + +R        
Sbjct: 61  SGMTRGDLALAVERHATSKLDDEDLLRIRTLGFRGEALPSIGSVAKLAITTRHANEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + +     S + P A+  GT VEV DLF+  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 ALQVDAGTKSGIAPAALAHGTRVEVNDLFYATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           P ++FT +  +                  R+  ++G DF  +A+E++ +   ++++G+  
Sbjct: 181 PDIAFTLAGEERAPVTWAAALPGAAGRLTRLGDILGSDFRTHAIEVSAEREGVSVEGFAA 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P+  R NA   Y+F+NGR V+DK IL  +R AYA+ +P  R+P+V L + +DP++VD N
Sbjct: 241 APSLTRANALGQYLFVNGRPVRDKLILGAVRAAYADYLPRDRHPIVALFVTLDPQEVDAN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMIS-SFHQDNAPKTHLPK 357
           VHPAK+ +RFRN  ++R  I+ ++++ + ++G  T++  +   I+ +FH+++ P++    
Sbjct: 301 VHPAKTEVRFRNAGLVRALIVHALKEGLAREGRRTAANTNGAAITTAFHREDLPRSGYDW 360

Query: 358 YATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNY 417
            ++       +        +      +  P+          SEA +  LG A  Q+H+NY
Sbjct: 361 RSSPAAPFAPRASAMAFAEAPQAAFDAYTPSADARGHDAPLSEAVNQPLGAARTQLHENY 420

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHD 477
           I++QT DGL++VDQHAAHER+++E+++       +  Q LL PEI+++ E     ++   
Sbjct: 421 IVAQTNDGLILVDQHAAHERIVYERLKASLEKNGVQRQMLLIPEIVEMDEAVVEKLLART 480

Query: 478 EDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENIL 537
            +L + G+  E FGP A+A+RE P++L K N   LLRD+ + + +      L+ R+ ++ 
Sbjct: 481 GELEKYGLAIESFGPGAVAVRETPSLLGKTNAASLLRDLAEHMAEWDEALPLERRLMHVA 540

Query: 538 ATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ATMAC+GS+RSGR ++  EMN LLREME  PNS QCNHGRPT+++LKL+DIEKLFGR
Sbjct: 541 ATMACHGSVRSGRILKVEEMNALLREMEATPNSGQCNHGRPTYVELKLADIEKLFGR 597


>gi|39937431|ref|NP_949707.1| DNA mismatch repair protein [Rhodopseudomonas palustris CGA009]
 gi|81829456|sp|Q6N1N4|MUTL_RHOPA RecName: Full=DNA mismatch repair protein mutL
 gi|39651290|emb|CAE29812.1| DNA mismatch repair protein MutL [Rhodopseudomonas palustris
           CGA009]
          Length = 595

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 234/599 (39%), Positives = 366/599 (61%), Gaps = 10/599 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E I+N+IAAGE++ERP+  +KEL+EN++DA +SR++    GGG+    I D+G
Sbjct: 1   MPVRQLPETIVNRIAAGEVVERPASVVKELVENAIDAGASRIDIFSDGGGRRKIVIADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT  ++ +AV RH TSK+ D D   I T GFRGEALPSIGAV+ L++ +R        
Sbjct: 61  SGMTQADLALAVDRHATSKLDDEDLLQIRTLGFRGEALPSIGAVARLSITTRHAAEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + + G   + + P A+  GT VEV DLFF  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 ALRVEGGDKTPIAPAALTQGTRVEVADLFFATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           P V+FT +  +                  R+  ++G DF  NA+E+  +   + ++G+  
Sbjct: 181 PDVAFTLAGEERAPVTWAAALPGAPGQLIRLGDILGADFRANAIEVRAEREGVVVEGFAA 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P+  + NA   Y+F+NGR V+DK IL  +R AY++ +P  R+PVV L + +D R+VD N
Sbjct: 241 APSLTKANALGQYLFVNGRPVRDKLILGAVRAAYSDYLPRDRHPVVALFVTLDAREVDAN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHPAK+ +RFRN  ++R  I+ +++  + ++G  T++  +  +IS+F   + P  +    
Sbjct: 301 VHPAKTEVRFRNSGLVRALIVHALKDGLAREGRRTAANSASSVISTFRPASMPPANWDWR 360

Query: 359 ATSLTN---TQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQ 415
           ++       +    F +  + + +   PS D    E        +     LG A  QIH+
Sbjct: 361 SSPSYPVGGSAAPSFAERAQAAFDVGAPSADIRPQEVT-----PDLLDRPLGAARTQIHE 415

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
            YI+SQT DGL+++DQHAAHER+++E+++    +  +  Q LL P+I+++ E     ++ 
Sbjct: 416 TYIVSQTRDGLIVIDQHAAHERIVYERLKASLEANGVQRQILLIPDIVEMDEATVERLVA 475

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
             E+L + G+  E FGP A+A+RE P++L K +   LLRD+ + + +      L+ R+ +
Sbjct: 476 RAEELAQFGLVIESFGPGAVAVRETPSLLGKTDASGLLRDLAEHMAEWDEALPLERRLMH 535

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           + ATMAC+GS+R+GR ++  EMN LLREME  PNS QCNHGRPT+++L L+DIEKLFGR
Sbjct: 536 VAATMACHGSVRAGRVLKPEEMNALLREMEATPNSGQCNHGRPTYVELTLADIEKLFGR 594


>gi|316935889|ref|YP_004110871.1| DNA mismatch repair protein MutL [Rhodopseudomonas palustris DX-1]
 gi|315603603|gb|ADU46138.1| DNA mismatch repair protein MutL [Rhodopseudomonas palustris DX-1]
          Length = 595

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 236/599 (39%), Positives = 370/599 (61%), Gaps = 10/599 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E I+N+IAAGE++ERP+  +KEL+EN++DA +SR++    GGG+    I D+G
Sbjct: 1   MPVRQLPETIVNRIAAGEVVERPASVVKELVENAIDAGASRIDIFSDGGGRRKIVIADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT+ ++ +AV RH TSK+ D D   I T GFRGEALPSIGAV+ L++ +R        
Sbjct: 61  SGMTAVDLALAVDRHATSKLDDEDLLAIRTLGFRGEALPSIGAVARLSITTRHASEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + + G   + + P A++ GT VEV DLFF  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 AMRVEGGDKTPIAPAALSQGTRVEVADLFFATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           P V+FT +  +                  R+  ++G DF  NA+E+  +   + ++G+  
Sbjct: 181 PDVAFTLAGEERAPVTWAAALPGAPGQLIRLGDILGADFRANAIEVRAEREGVVVEGFAA 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P+  R NA   Y+F+NGR V+DK IL  +R AY++ +P  R+PVV L + +D R+VD N
Sbjct: 241 APSLTRANALGQYLFVNGRPVRDKLILGAVRAAYSDYLPRDRHPVVALFVTLDSREVDAN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHPAK+ +RFRN  ++R  I+ ++++ + ++G  T++  +  +IS+F   + P  +    
Sbjct: 301 VHPAKTEVRFRNAGLVRALIVHALKEGLAREGRRTAANSASSVISTFRPASMPPANWDWR 360

Query: 359 ATSLTN---TQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQ 415
           A+       +    F +  + + +   PS D   +E        +     LG A  QIH+
Sbjct: 361 ASPSYPVGGSAAPSFAERAQAAFDVGAPSADIRLTEVT-----PDLLDRPLGAARTQIHE 415

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
            YI+SQT DGL+++DQHAAHER+++E+++    +  +  Q LL P+I+++ E     ++ 
Sbjct: 416 TYIVSQTRDGLIVIDQHAAHERIVYERLKASLEANGVQRQILLIPDIVEMDEATVERLVA 475

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
             E+L + G+  E FGP A+A+RE P++L K +   LLRD+ + + +      L+ R+ +
Sbjct: 476 RAEELAKFGLVIESFGPGAVAVRETPSLLGKTDAGGLLRDLAEHMAEWDEALPLERRLMH 535

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           + ATMAC+GS+R+GR ++  EMN LLREME  PNS QCNHGRPT+++L L+DIEKLFGR
Sbjct: 536 VAATMACHGSVRAGRVLKPEEMNALLREMEATPNSGQCNHGRPTYVELTLADIEKLFGR 594


>gi|163844405|ref|YP_001622060.1| DNA mismatch repair protein [Brucella suis ATCC 23445]
 gi|189030393|sp|A9WXS2|MUTL_BRUSI RecName: Full=DNA mismatch repair protein mutL
 gi|163675128|gb|ABY39238.1| DNA mismatch repair protein MutL [Brucella suis ATCC 23445]
          Length = 623

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 272/622 (43%), Positives = 395/622 (63%), Gaps = 28/622 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG
Sbjct: 1   MTIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL SRP   ++G +
Sbjct: 61  SGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSRPQDADSGFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + ++G  +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P
Sbjct: 121 VCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ +      ++M    +      ERI QV+G +F  NA+ ++ + + + L G+ GI
Sbjct: 181 HIRFSLAGTDRTPFEMPATGTGAEATLERIGQVLGREFGENALAIDAERDGVRLAGFVGI 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNRGNA   + ++NGR V+DK I   +R AY++ I   R+PV VL L +DP  VDVNV
Sbjct: 241 PSFNRGNALHQFAYVNGRPVRDKQIFGALRGAYSDVIARDRHPVAVLFLTLDPALVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD-NAPKTHLPKY 358
           HPAK+ +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F  +    +   P+ 
Sbjct: 301 HPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRP 360

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTY--------------------------SED 392
           A S +    +      R   +                                    +  
Sbjct: 361 ANSYSPASWRTAPPAPRSEWSPQTAHPAHRPLDLQAAPALRENGQAVLGDVAVPAADARA 420

Query: 393 NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
           +      E     LG+A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++  I
Sbjct: 421 SVAEAPVELMQKPLGVARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHARPI 480

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
             Q LL PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+ QL
Sbjct: 481 AGQMLLIPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLGEMNVQQL 540

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           +RD+ DEI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P S  
Sbjct: 541 IRDLADEIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPGSGT 600

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 601 CNHGRPTYIELKLTDIERLFGR 622


>gi|126738320|ref|ZP_01754041.1| DNA mismatch repair protein [Roseobacter sp. SK209-2-6]
 gi|126720817|gb|EBA17522.1| DNA mismatch repair protein [Roseobacter sp. SK209-2-6]
          Length = 653

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 257/627 (40%), Positives = 389/627 (62%), Gaps = 35/627 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA + R+   IA GGK+  ++TD+G 
Sbjct: 27  QIRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGAHRITVEIADGGKTLIRVTDDGC 86

Query: 62  GMTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           GM++E++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR   ++  AQ
Sbjct: 87  GMSAEDLPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLTITSRAAGHD-AAQ 145

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I +SG ++  V+P A+  GT+VE+RDLF+  PARL F+++++ E   I DVI+R+A+A P
Sbjct: 146 IKVSGGRMDPVKPAALRAGTVVELRDLFYATPARLKFMRTDRAEAQAIGDVIKRLAMAEP 205

Query: 181 KVSFT---FSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITL 233
            V FT    S     R        +G+  +    R++ V+G +F  NA++++ +   + L
Sbjct: 206 SVGFTLRDVSGGGEGRVTFRADPLSGDLFDALHGRLASVLGREFAENALKIDAEREGVRL 265

Query: 234 QGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPR 293
            GY  +PT++RG A   ++F+N R V+DK +   +R AY + +   R+P   L ++ DP 
Sbjct: 266 FGYAALPTYSRGAAVAQFLFVNSRPVKDKMLTGALRAAYFDFLSRDRHPAAALFIDCDPT 325

Query: 294 QVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKT 353
            VDVNVHPAKS +RFR+P + R  I+ +++ A+ + G   S+ ++   + +   +    +
Sbjct: 326 LVDVNVHPAKSEVRFRDPGVARGLIVSALRHALAEAGHRASTTVAGATLGAMRPEAPTAS 385

Query: 354 HLPKY------------------------ATSLTNTQEKLFLQENRLSTNDLLPSDDPTY 389
             P+                         A S      + F +     +  +L       
Sbjct: 386 GAPRVYQMDRPSFGARNASYAAQSPGQPLAQSADAPPSQGFAELATAYSGRVLEETAEAP 445

Query: 390 SEDNDPVEESE--ATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDF 447
            +  D    S   A    LG A  Q+H+NYII+QT DG+VIVDQHAAHERL++E+++   
Sbjct: 446 GQMPDAPTTSSPGAEELPLGAARGQVHENYIIAQTRDGMVIVDQHAAHERLVYERLKAQM 505

Query: 448 NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKK 507
               + +Q LL PEI++L E +CA ++ H EDL + G+  E FG NA+A+RE PA+L + 
Sbjct: 506 AENGVAAQALLIPEIVELGESDCARLLSHAEDLKKFGLTLEAFGGNAVAVRETPALLGEV 565

Query: 508 NIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKN 567
           N   ++RDI+DE+ D   +  +Q R+E IL+ +AC+GSIRSGR+M+  EMN LLREME  
Sbjct: 566 NAGAMVRDILDELDDLGESQLVQARLEAILSRVACHGSIRSGRRMRGEEMNALLREMEAT 625

Query: 568 PNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           P+S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 626 PHSGQCNHGRPTYVELKLADIERLFGR 652


>gi|254712072|ref|ZP_05173883.1| DNA mismatch repair protein [Brucella ceti M644/93/1]
 gi|254715142|ref|ZP_05176953.1| DNA mismatch repair protein [Brucella ceti M13/05/1]
 gi|261216852|ref|ZP_05931133.1| DNA mismatch repair protein mutL [Brucella ceti M13/05/1]
 gi|261319719|ref|ZP_05958916.1| DNA mismatch repair protein mutL [Brucella ceti M644/93/1]
 gi|260921941|gb|EEX88509.1| DNA mismatch repair protein mutL [Brucella ceti M13/05/1]
 gi|261292409|gb|EEX95905.1| DNA mismatch repair protein mutL [Brucella ceti M644/93/1]
          Length = 623

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 272/622 (43%), Positives = 394/622 (63%), Gaps = 28/622 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG
Sbjct: 1   MTIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL SRP   ++G +
Sbjct: 61  SGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSRPQDADSGFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + ++G  +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P
Sbjct: 121 VCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ +      ++M    +      ERI QV+G +F  NA+ ++ + + + L G+ GI
Sbjct: 181 HIRFSLAGTDRTPFEMPATGTGAEATLERIGQVLGREFGENALAIDAERDGVRLAGFVGI 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNRGNA   + ++NGR V+DK I   +R AY++ I   R+PV VL L +DP  VDVNV
Sbjct: 241 PSFNRGNALHQFAYVNGRPVRDKQIFGALRGAYSDVIARDRHPVAVLFLTLDPALVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD-NAPKTHLPKY 358
           HPAK+ +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F  +    +   P+ 
Sbjct: 301 HPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRP 360

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTY--------------------------SED 392
           A S +    +      R   +                                    +  
Sbjct: 361 ANSYSPASWRTAPPAPRSEWSPQTAHPAHRPLDLQAAPALRENGQAVLGDVAVPAADARA 420

Query: 393 NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
           +      E     LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++  I
Sbjct: 421 SVAEAPVELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHARPI 480

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
             Q LL PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+ QL
Sbjct: 481 AGQKLLIPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLGEMNVQQL 540

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           +RD+ DEI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P S  
Sbjct: 541 IRDLADEIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPGSGT 600

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 601 CNHGRPTYIELKLTDIERLFGR 622


>gi|70734068|ref|YP_257708.1| DNA mismatch repair protein [Pseudomonas fluorescens Pf-5]
 gi|68348367|gb|AAY95973.1| DNA mismatch repair protein MutL [Pseudomonas fluorescens Pf-5]
          Length = 636

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 212/625 (33%), Positives = 339/625 (54%), Gaps = 32/625 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  IKEL+ENSLD+ + R++  +   G    ++ D+G 
Sbjct: 10  RIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGAKRIDVDVEQAGVKLLRVRDDGS 69

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++S+++P+A+ RH TSKI D  D   + + GFRGEAL SI +V+ LTL SR        
Sbjct: 70  GISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALASISSVARLTLTSRTRDAEQAW 129

Query: 120 QIAISGEKI-SSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+   G  +   V+P A   GT VEVRDLFF  PAR  FLK+E+ E + + +VI+R+A+A
Sbjct: 130 QVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIKRLALA 189

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F       +   ++    +     R++ V G  F+  A+ +  + N + L G+ G
Sbjct: 190 RFDVAFHLRHNGKSILSLHEAKDDAARARRVAAVCGSGFLEQALPIEVERNGLHLWGWVG 249

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y ++NGR V+DK +   +R AY + +  GR+P  VL  E+DP  VDVN
Sbjct: 250 LPTFSRSQADLQYFYVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFEVDPSVVDVN 309

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ------DNAPK 352
           VHP K  +RFR+  ++ +F+  ++ +A+              +            +  P+
Sbjct: 310 VHPTKHEVRFRDGRMVHDFLYGTLHRALGDVRPEDQLAAPAAVAGIVRPTGIEAGEFGPQ 369

Query: 353 THLPKYAT-SLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQL----- 406
             +   A  +L   Q +                      +   P  ES+  + +      
Sbjct: 370 GEMRLAANLALEQPQSQPSFNAPGAGAGSGYQYQYTPRPQPVLPAAESQGVYREFFAPLP 429

Query: 407 -----------------GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                            G A AQ+   YI+++   GLV+VD HAAHER+++E+++    S
Sbjct: 430 GAPAAALPDGQEDIPPLGYALAQLKGIYILAENALGLVLVDMHAAHERIMYERLKVAMAS 489

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             ++ Q LL PE I + + E     EH     RLG + +R GP ++AIR+IPA+L +   
Sbjct: 490 EGLSGQPLLVPESIAVSQREADCAEEHMSWFQRLGFELQRLGPESLAIRQIPALLKQAEA 549

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            +L+ D++ ++++  T+  +Q  +  +L TMAC+G+IR+ R++   EMN LLR+ME    
Sbjct: 550 NRLVHDVLADLMEYGTSDRIQAHLNELLGTMACHGAIRANRRLALPEMNALLRDMENTER 609

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S QCNHGRPT+ ++ L D++KLF R
Sbjct: 610 SGQCNHGRPTWTQMGLDDLDKLFLR 634


>gi|94429030|gb|ABF18946.1| DNA mismatch repair protein mutL [uncultured bacterium pFosLip]
          Length = 585

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 215/598 (35%), Positives = 333/598 (55%), Gaps = 19/598 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I++L   +INQIAAGE++ERP+  +KEL+ENSLDA +  V   I  GG    ++ D+G
Sbjct: 1   MPIQQLPNHLINQIAAGEVVERPASVVKELLENSLDAGAQAVHVDILAGGSKLIRVRDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+   E+ +A+ RH TSKIS  +D   + + GFRGEALPSI +V+ L+L SR    +  
Sbjct: 61  AGIPQGELSLALARHATSKISSLEDLEAVVSLGFRGEALPSIASVARLSLTSRSTGGDNA 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            Q+     +I   RP A   GT VEV DLF+  PAR  FLK+E+ E   I   +RR+A+A
Sbjct: 121 WQVEADNGEIGEARPAAHPGGTTVEVHDLFYNTPARRRFLKTERTEFGHIDKWVRRLALA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P V+F  +  +     +   +      +R++++ GE F   AV L  ++  I + G+ G
Sbjct: 181 RPDVAFVLTHNRRTVLDLRAATNREQQQQRLARICGEAFAEQAVYLQHETEGIAITGWIG 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTFNR   +  + F+NGR++ DK +    R AY + +  GR+P  VL L +DP  +D N
Sbjct: 241 LPTFNRSQPDLQFWFVNGRSISDKTLSHAARHAYRDVLFHGRFPAYVLGLTVDPATIDAN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMI--SSFHQDNAPKTHLP 356
            HPAK  IRFR+   I   + Q+++ A++    S   V    +   S   QD       P
Sbjct: 301 AHPAKHEIRFRDGRRIHGVVAQAVEVALSDTRPSGHGVAPAPVASGSPIRQDGLRLPAAP 360

Query: 357 KYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQN 416
           + A           ++E+  + + L     P  + D D  E        +G A AQ+   
Sbjct: 361 RPAA----------VRESLATYSALAGGAPPVSASDRDAGELPP-----MGYAIAQLGGV 405

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEH 476
           YI+++  +GLV+VD HAAHER+ +EK+++ F+   +  Q LL P  + + E E     E 
Sbjct: 406 YILAENREGLVVVDMHAAHERITYEKLKKGFDDKALVRQPLLVPVTVAVAESEARHAEEA 465

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L  +G+  +R GP ++ +RE+PA+L   +   LLRD++ +I  +  +  ++D     
Sbjct: 466 SELLALVGLVVDRAGPTSLVVREVPALLRGADAEALLRDVLADIAQAGQSSRVEDECHEF 525

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATMAC+ S+R+ R++   EMN LLREME    + QCNHGRPT+  + ++++++LF R
Sbjct: 526 LATMACHHSVRANRQLTLEEMNALLREMETTERADQCNHGRPTWTAISMAELDRLFLR 583


>gi|161620296|ref|YP_001594182.1| DNA mismatch repair protein [Brucella canis ATCC 23365]
 gi|189030392|sp|A9MDX3|MUTL_BRUC2 RecName: Full=DNA mismatch repair protein mutL
 gi|161337107|gb|ABX63411.1| DNA mismatch repair protein MutL [Brucella canis ATCC 23365]
          Length = 623

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 272/622 (43%), Positives = 394/622 (63%), Gaps = 28/622 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG
Sbjct: 1   MTIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL SRP   ++G +
Sbjct: 61  SGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSRPQDADSGFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + ++G  +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P
Sbjct: 121 VCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ +      ++M    +      ERI QV+G +F  NA+ ++ + + + L G+ GI
Sbjct: 181 HIRFSLAGTDRTPFEMPATGTGAKATLERIGQVLGREFGENALAIDAERDGVRLAGFVGI 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNRGNA   + ++NGR V+DK I   +R AY++ I   R+PV VL L +DP  VDVNV
Sbjct: 241 PSFNRGNALHQFAYVNGRPVRDKQIFGALRGAYSDVIARDRHPVAVLFLTLDPALVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD-NAPKTHLPKY 358
           HPAK+ +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F  +    +   P+ 
Sbjct: 301 HPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRP 360

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTY--------------------------SED 392
           A S +    +      R   +                                    +  
Sbjct: 361 ANSYSPASWRTAPPAPRSEWSPQTAHPAHRPLDLQAAPALRENGQAVLGDVAVPAADARA 420

Query: 393 NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
           +      E     LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++  I
Sbjct: 421 SVAEAPVELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHARPI 480

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
             Q LL PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+ QL
Sbjct: 481 AGQMLLIPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLGEMNVQQL 540

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           +RD+ DEI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P S  
Sbjct: 541 IRDLADEIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPGSGT 600

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 601 CNHGRPTYIELKLTDIERLFGR 622


>gi|85717173|ref|ZP_01048131.1| DNA mismatch repair protein [Nitrobacter sp. Nb-311A]
 gi|85696006|gb|EAQ33906.1| DNA mismatch repair protein [Nitrobacter sp. Nb-311A]
          Length = 603

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 231/602 (38%), Positives = 361/602 (59%), Gaps = 8/602 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E ++N+IAAGE++ERP+  +KEL+EN++DA ++R++    GGG+    +TD+G
Sbjct: 1   MPVRQLPETVVNRIAAGEVVERPASVVKELVENAIDAGATRIDVFTDGGGRRRIGVTDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM   ++ +AV RH TSK+ D D   I T GFRGEALPSIGAV+ L + +R  +     
Sbjct: 61  AGMAKGDLALAVDRHATSKLDDEDLLGIRTLGFRGEALPSIGAVARLCITTRDAREPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + + G + S++ P A+  GT VEV DLF+  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 SLTVEGGRKSAIVPAALTQGTRVEVGDLFYATPARLKFLKTDRAEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKS-NRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           P + FT +          +          R+  ++G DF   A+ +  +   +T+ G+  
Sbjct: 181 PDIGFTLAGEGRAPVTWTSALPGAAGRLTRLGDILGGDFRAAAIPVCAERERVTVDGFAA 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P+  R NA   Y+F+NGR V+DK IL  +R AY++ +P  R+PV  L +  DP++VD N
Sbjct: 241 APSLTRANALGQYLFVNGRPVRDKLILGAVRAAYSDYLPRDRHPVAALFVTTDPQEVDAN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHPAK+ +RFRN  ++R  I+ ++++ + ++G  T++     ++++F    +P+     +
Sbjct: 301 VHPAKTEVRFRNAGLVRALIVHALKEGLAREGRRTAANSDGAVLTAFRPATSPRPAGWDW 360

Query: 359 ATSLTNTQEKLFLQENRLST------NDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQ 412
             S     +         +T         L    P+     D     +     LG A  Q
Sbjct: 361 RQSPAAPADARPWAGGLPATAFAETGQTTLDVGAPSADVRFDAGPPLDLVDRPLGAARTQ 420

Query: 413 IHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECAL 472
           IH+ YI+SQT DGL++VDQHAAHER+++E+++       +  Q LL P+I++L E     
Sbjct: 421 IHETYIVSQTRDGLIVVDQHAAHERIVYERLKASLARDGVQRQILLIPDIVELDESTVEK 480

Query: 473 IMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDR 532
           +++   +L + G+  E FGP A+A+RE P++L K N   LLRD+ + + +   T  L+ R
Sbjct: 481 LIDRARELEKFGLAIESFGPGAVAVRETPSLLGKINAAALLRDLAEHMAEWDETLPLERR 540

Query: 533 IENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLF 592
           + ++ ATMAC+GS+R+GR ++  EMN LLREME  PNS QCNHGRPT+++LKL DIEKLF
Sbjct: 541 LMHVAATMACHGSVRAGRILKPEEMNALLREMEATPNSGQCNHGRPTYVELKLDDIEKLF 600

Query: 593 GR 594
           GR
Sbjct: 601 GR 602


>gi|17989371|ref|NP_542004.1| DNA mismatch repair protein [Brucella melitensis bv. 1 str. 16M]
 gi|23499977|ref|NP_699417.1| DNA mismatch repair protein [Brucella suis 1330]
 gi|62317165|ref|YP_223018.1| DNA mismatch repair protein [Brucella abortus bv. 1 str. 9-941]
 gi|83269147|ref|YP_418438.1| DNA mismatch repair protein [Brucella melitensis biovar Abortus
           2308]
 gi|148558497|ref|YP_001257266.1| DNA mismatch repair protein [Brucella ovis ATCC 25840]
 gi|189022424|ref|YP_001932165.1| DNA mismatch repair protein [Brucella abortus S19]
 gi|237816724|ref|ZP_04595716.1| DNA mismatch repair protein MutL [Brucella abortus str. 2308 A]
 gi|254691352|ref|ZP_05154606.1| DNA mismatch repair protein [Brucella abortus bv. 6 str. 870]
 gi|254695348|ref|ZP_05157176.1| DNA mismatch repair protein [Brucella abortus bv. 3 str. Tulya]
 gi|254698443|ref|ZP_05160271.1| DNA mismatch repair protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254699509|ref|ZP_05161337.1| DNA mismatch repair protein [Brucella suis bv. 5 str. 513]
 gi|254702632|ref|ZP_05164460.1| DNA mismatch repair protein [Brucella suis bv. 3 str. 686]
 gi|254706237|ref|ZP_05168065.1| DNA mismatch repair protein [Brucella pinnipedialis M163/99/10]
 gi|254711470|ref|ZP_05173281.1| DNA mismatch repair protein [Brucella pinnipedialis B2/94]
 gi|254731891|ref|ZP_05190469.1| DNA mismatch repair protein [Brucella abortus bv. 4 str. 292]
 gi|256029899|ref|ZP_05443513.1| DNA mismatch repair protein [Brucella pinnipedialis M292/94/1]
 gi|256043138|ref|ZP_05446080.1| DNA mismatch repair protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|256059548|ref|ZP_05449747.1| DNA mismatch repair protein [Brucella neotomae 5K33]
 gi|256111875|ref|ZP_05452836.1| DNA mismatch repair protein [Brucella melitensis bv. 3 str. Ether]
 gi|256158069|ref|ZP_05455987.1| DNA mismatch repair protein [Brucella ceti M490/95/1]
 gi|256252976|ref|ZP_05458512.1| DNA mismatch repair protein [Brucella ceti B1/94]
 gi|256256537|ref|ZP_05462073.1| DNA mismatch repair protein [Brucella abortus bv. 9 str. C68]
 gi|260544399|ref|ZP_05820220.1| DNA mismatch repair protein mutL [Brucella abortus NCTC 8038]
 gi|260564360|ref|ZP_05834845.1| DNA mismatch repair protein mutL [Brucella melitensis bv. 1 str.
           16M]
 gi|260568459|ref|ZP_05838928.1| DNA mismatch repair protein mutL [Brucella suis bv. 4 str. 40]
 gi|260756962|ref|ZP_05869310.1| DNA mismatch repair protein mutL [Brucella abortus bv. 6 str. 870]
 gi|260759664|ref|ZP_05872012.1| DNA mismatch repair protein mutL [Brucella abortus bv. 4 str. 292]
 gi|260762906|ref|ZP_05875238.1| DNA mismatch repair protein mutL [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260882774|ref|ZP_05894388.1| DNA mismatch repair protein mutL [Brucella abortus bv. 9 str. C68]
 gi|261215721|ref|ZP_05930002.1| DNA mismatch repair protein mutL [Brucella abortus bv. 3 str.
           Tulya]
 gi|261220069|ref|ZP_05934350.1| DNA mismatch repair protein mutL [Brucella ceti B1/94]
 gi|261313678|ref|ZP_05952875.1| DNA mismatch repair protein mutL [Brucella pinnipedialis
           M163/99/10]
 gi|261319079|ref|ZP_05958276.1| DNA mismatch repair protein mutL [Brucella pinnipedialis B2/94]
 gi|261323516|ref|ZP_05962713.1| DNA mismatch repair protein mutL [Brucella neotomae 5K33]
 gi|261749964|ref|ZP_05993673.1| DNA mismatch repair protein mutL [Brucella suis bv. 5 str. 513]
 gi|261753217|ref|ZP_05996926.1| DNA mismatch repair protein mutL [Brucella suis bv. 3 str. 686]
 gi|265986917|ref|ZP_06099474.1| DNA mismatch repair protein mutL [Brucella pinnipedialis M292/94/1]
 gi|265989570|ref|ZP_06102127.1| DNA mismatch repair protein mutL [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993328|ref|ZP_06105885.1| DNA mismatch repair protein mutL [Brucella melitensis bv. 3 str.
           Ether]
 gi|265996583|ref|ZP_06109140.1| DNA mismatch repair protein mutL [Brucella ceti M490/95/1]
 gi|297249893|ref|ZP_06933594.1| DNA mismatch repair protein mutL [Brucella abortus bv. 5 str.
           B3196]
 gi|54037874|sp|P65490|MUTL_BRUSU RecName: Full=DNA mismatch repair protein mutL
 gi|54041515|sp|P65489|MUTL_BRUME RecName: Full=DNA mismatch repair protein mutL
 gi|81309329|sp|Q579M7|MUTL_BRUAB RecName: Full=DNA mismatch repair protein mutL
 gi|123727280|sp|Q2YIH2|MUTL_BRUA2 RecName: Full=DNA mismatch repair protein mutL
 gi|166232081|sp|A5VTW1|MUTL_BRUO2 RecName: Full=DNA mismatch repair protein mutL
 gi|238691508|sp|B2SD15|MUTL_BRUA1 RecName: Full=DNA mismatch repair protein mutL
 gi|17985243|gb|AAL54268.1| DNA mismatch repair protein mutl [Brucella melitensis bv. 1 str.
           16M]
 gi|23463559|gb|AAN33422.1| DNA mismatch repair protein MutL [Brucella suis 1330]
 gi|62197358|gb|AAX75657.1| MutL, DNA mismatch repair protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82939421|emb|CAJ12378.1| DNA mismatch repair protein:ATP-binding region, ATPase-like
           [Brucella melitensis biovar Abortus 2308]
 gi|148369782|gb|ABQ62654.1| DNA mismatch repair protein MutL [Brucella ovis ATCC 25840]
 gi|189020998|gb|ACD73719.1| DNA mismatch repair protein [Brucella abortus S19]
 gi|237787537|gb|EEP61753.1| DNA mismatch repair protein MutL [Brucella abortus str. 2308 A]
 gi|260097670|gb|EEW81544.1| DNA mismatch repair protein mutL [Brucella abortus NCTC 8038]
 gi|260152003|gb|EEW87096.1| DNA mismatch repair protein mutL [Brucella melitensis bv. 1 str.
           16M]
 gi|260155124|gb|EEW90205.1| DNA mismatch repair protein mutL [Brucella suis bv. 4 str. 40]
 gi|260669982|gb|EEX56922.1| DNA mismatch repair protein mutL [Brucella abortus bv. 4 str. 292]
 gi|260673327|gb|EEX60148.1| DNA mismatch repair protein mutL [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260677070|gb|EEX63891.1| DNA mismatch repair protein mutL [Brucella abortus bv. 6 str. 870]
 gi|260872302|gb|EEX79371.1| DNA mismatch repair protein mutL [Brucella abortus bv. 9 str. C68]
 gi|260917328|gb|EEX84189.1| DNA mismatch repair protein mutL [Brucella abortus bv. 3 str.
           Tulya]
 gi|260918653|gb|EEX85306.1| DNA mismatch repair protein mutL [Brucella ceti B1/94]
 gi|261298302|gb|EEY01799.1| DNA mismatch repair protein mutL [Brucella pinnipedialis B2/94]
 gi|261299496|gb|EEY02993.1| DNA mismatch repair protein mutL [Brucella neotomae 5K33]
 gi|261302704|gb|EEY06201.1| DNA mismatch repair protein mutL [Brucella pinnipedialis
           M163/99/10]
 gi|261739717|gb|EEY27643.1| DNA mismatch repair protein mutL [Brucella suis bv. 5 str. 513]
 gi|261742970|gb|EEY30896.1| DNA mismatch repair protein mutL [Brucella suis bv. 3 str. 686]
 gi|262550880|gb|EEZ07041.1| DNA mismatch repair protein mutL [Brucella ceti M490/95/1]
 gi|262764198|gb|EEZ10230.1| DNA mismatch repair protein mutL [Brucella melitensis bv. 3 str.
           Ether]
 gi|263000239|gb|EEZ12929.1| DNA mismatch repair protein mutL [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|264659114|gb|EEZ29375.1| DNA mismatch repair protein mutL [Brucella pinnipedialis M292/94/1]
 gi|297173762|gb|EFH33126.1| DNA mismatch repair protein mutL [Brucella abortus bv. 5 str.
           B3196]
          Length = 623

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 272/622 (43%), Positives = 394/622 (63%), Gaps = 28/622 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG
Sbjct: 1   MTIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL SRP   ++G +
Sbjct: 61  SGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSRPQDADSGFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + ++G  +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P
Sbjct: 121 VCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ +      ++M    +      ERI QV+G +F  NA+ ++ + + + L G+ GI
Sbjct: 181 HIRFSLAGTDRTPFEMPATGTGAEATLERIGQVLGREFGENALAIDAERDGVRLAGFVGI 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNRGNA   + ++NGR V+DK I   +R AY++ I   R+PV VL L +DP  VDVNV
Sbjct: 241 PSFNRGNALHQFAYVNGRPVRDKQIFGALRGAYSDVIARDRHPVAVLFLTLDPALVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD-NAPKTHLPKY 358
           HPAK+ +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F  +    +   P+ 
Sbjct: 301 HPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRP 360

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTY--------------------------SED 392
           A S +    +      R   +                                    +  
Sbjct: 361 ANSYSPASWRTAPPAPRSEWSPQTAHPAHRPLDLQAAPALRENGQAVLGDVAVPAADARA 420

Query: 393 NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
           +      E     LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++  I
Sbjct: 421 SVAEAPVELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHARPI 480

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
             Q LL PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+ QL
Sbjct: 481 AGQMLLIPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLGEMNVQQL 540

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           +RD+ DEI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P S  
Sbjct: 541 IRDLADEIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPGSGT 600

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 601 CNHGRPTYIELKLTDIERLFGR 622


>gi|85705062|ref|ZP_01036162.1| DNA mismatch repair protein [Roseovarius sp. 217]
 gi|85670384|gb|EAQ25245.1| DNA mismatch repair protein [Roseovarius sp. 217]
          Length = 611

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 259/601 (43%), Positives = 385/601 (64%), Gaps = 12/601 (1%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR+L E  +N+IAAGE++ERP+ A+KEL+EN+LDA ++R+E   A GGK+  ++ D+G 
Sbjct: 14  QIRQLDEAAVNRIAAGEVVERPASAVKELVENALDAGATRIEVGFADGGKTLIRVMDDGC 73

Query: 62  GMTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           GM  +++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR       A+
Sbjct: 74  GMAPDQLPLALARHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLTIASRAGDA--AAE 131

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ++G +  +V+P A+N GT+V +RDLF+  PARL F++S++ E   I D ++R+A+A P
Sbjct: 132 ITVAGGQAGAVKPAALNAGTVVTLRDLFYATPARLKFMRSDRAEAQAIADTVKRLAMAEP 191

Query: 181 KVSF---TFSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITL 233
            V F     S     R        +G+  +    R+++V+G +F  NA+ ++     + +
Sbjct: 192 FVGFVLREVSGGGEGRIVFRADPESGDLFDALHGRLARVLGAEFAENALRIDATREGVRM 251

Query: 234 QGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPR 293
            GY  +PT++RG+A   Y+F+NGR V+DK +   +R AY + +   R+P V L L+ DP 
Sbjct: 252 TGYAALPTYSRGSAVAQYLFVNGRPVRDKMLYGALRAAYQDVLSRDRHPAVALFLDCDPT 311

Query: 294 QVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKT 353
            VDVNVHPAKS +RFR+P + R  I+  ++ A+ + G   S+ ++   + +F  +   + 
Sbjct: 312 LVDVNVHPAKSEVRFRDPGLARGLIVSGLRHALAEAGHRASTTVAGATLGAFRPEPVGRI 371

Query: 354 HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQI 413
           +     +         +  +     +          S     VEE  AT   LG A AQ+
Sbjct: 372 YQMDRPSPQARAL--AYSAQAPGFADMAEDWSARVESAPEPQVEEPPATALPLGAARAQV 429

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
           H+NYII+QT  G+VIVDQHAAHERL++E++++    + + +Q LL PEI+DL E +CAL+
Sbjct: 430 HENYIIAQTETGMVIVDQHAAHERLVYERLKRQMAESGVAAQALLIPEIVDLSEADCALL 489

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRI 533
           MEH E L  LG+  E FGP ++A+RE PAIL   N   LLRDI+DE+ D   + TL+ RI
Sbjct: 490 MEHAEALAGLGLGIEPFGPGSLAVRETPAILGPVNAGALLRDILDELQDQGASGTLKLRI 549

Query: 534 ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFG 593
           + IL+ +AC+GS+RSGR+M + EMN LLR+ME+ P S QCNHGRPT+++L+LSDIE+LFG
Sbjct: 550 DAILSRVACHGSVRSGRRMSAEEMNALLRKMERTPMSGQCNHGRPTYVELRLSDIERLFG 609

Query: 594 R 594
           R
Sbjct: 610 R 610


>gi|329895360|ref|ZP_08270985.1| DNA mismatch repair protein MutL [gamma proteobacterium IMCC3088]
 gi|328922373|gb|EGG29717.1| DNA mismatch repair protein MutL [gamma proteobacterium IMCC3088]
          Length = 606

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 212/602 (35%), Positives = 341/602 (56%), Gaps = 9/602 (1%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  +KE++ENSLDA ++R++  + GGG    ++ DNG 
Sbjct: 3   RIHSLSPQLANQIAAGEVVERPASVVKEVVENSLDAGATRIDIEVEGGGVKRIRVRDNGQ 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ S+++P+A+ RH TSKI   DD   + + GFRGEAL SI +VS L L +    + +  
Sbjct: 63  GIESDDLPLALARHATSKIVSLDDLEAVSSLGFRGEALASIASVSRLALSTNASSDASAG 122

Query: 120 QIAIS--GEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
            +A S   +++ +VRP     GT V+VRDLFF  PAR  FL++E+ E N + +V++R+A+
Sbjct: 123 VLAESEGRDQVVAVRPTPHPQGTTVDVRDLFFNTPARRKFLRTEKTEFNHLEEVVKRLAL 182

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           A   V+F+ S        +    +      R++ + G  FI+  V ++ + + + L G+ 
Sbjct: 183 ARFDVAFSLSHNGRVVLNLPVADSTAAQQRRVATICGPAFIDQVVHIDSERSGLGLSGWV 242

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PTF+R  A+  Y F+NGR ++DK +   I+ AY + +  GR+P  VL L I+P  VDV
Sbjct: 243 GLPTFSRSQADLQYFFVNGRVIRDKLVAHAIKQAYRDVLYHGRHPAFVLYLTINPALVDV 302

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGIST---SSVLSKKMISSFHQDNAPKTH 354
           NVHP K  +RFR+   + NF+  ++ +A+     +    SS   + +    H D      
Sbjct: 303 NVHPTKHEVRFRDSREVHNFLFSTLHRALADVRPADQLVSSERFQPLAEGGHLDTHTGEV 362

Query: 355 LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE--SEATHYQLGIACAQ 412
                +    +        NR S   +             P+ E  SE     LG A AQ
Sbjct: 363 SQGALSWGGMSHRPDVGSSNRPSPLAVQSQMSSYGRLHPVPLPEQSSEEEAPPLGYALAQ 422

Query: 413 IHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECAL 472
           +   YI+S+   GLV+VD HAAHER+ +E++++   S  + SQ LL P+ I + + E  L
Sbjct: 423 LQGIYILSENAQGLVLVDMHAAHERITYERLKEADASEGVRSQPLLVPQAIAVSQKEVEL 482

Query: 473 IMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDR 532
             EH+     LG++ E     ++ IR +P +L   ++ QL+RD++ ++ +   +  +   
Sbjct: 483 AREHEAVFVGLGLQLEPASEESLLIRSVPTLLRSADMEQLVRDVLSDLAEYGQSDRIAAE 542

Query: 533 IENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLF 592
            E IL+TMAC+GS+R+ R +   EMN LLR++E    + QCNHGRPT+ +L L++++KLF
Sbjct: 543 REAILSTMACHGSVRANRSLTIPEMNALLRDIEATERAGQCNHGRPTWTQLSLTELDKLF 602

Query: 593 GR 594
            R
Sbjct: 603 LR 604


>gi|146278965|ref|YP_001169124.1| DNA mismatch repair protein [Rhodobacter sphaeroides ATCC 17025]
 gi|145557206|gb|ABP71819.1| DNA mismatch repair protein MutL [Rhodobacter sphaeroides ATCC
           17025]
          Length = 612

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 257/602 (42%), Positives = 381/602 (63%), Gaps = 15/602 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+EN+LDA + RV   IA GGK+  ++TD+G G
Sbjct: 15  IRQLDEAAINRIAAGEVVERPASAVKELVENALDAGARRVSVDIADGGKTLIRVTDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT+E++P+A+ RH TSKI   D  +I +FGFRGEALPS+ AV  LT+ SR      GA +
Sbjct: 75  MTAEDLPLALSRHATSKIDGSDLLDIRSFGFRGEALPSLAAVGRLTMTSRVAGGE-GAAV 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +S  ++  VRP A+  GT+VE+RDLFF  PARL FL++++ ET  I +V+RR+A+A P+
Sbjct: 134 TVSAGRMEPVRPAALGAGTVVELRDLFFATPARLKFLRTDRAETQAIAEVVRRLALAEPE 193

Query: 182 VSFTFSTI--KSNRYKMNFQSTNGNF----PERISQVIGEDFINNAVELNEKSNEITLQG 235
           V FT +       R     ++  G+       R+++V+G DF  NA+ ++     + LQG
Sbjct: 194 VGFTLTDHSAGEPRLLFRAEAEGGDLFDALHRRVARVVGADFAENALRIDVAREGLRLQG 253

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y  +PT++RG+A   ++F+NGR V D+ +L  +R  Y + +   RYP  VL L  DP++V
Sbjct: 254 YAALPTYSRGSAVAQFLFVNGRPVLDRMLLGALRAGYMDVLSRDRYPAAVLNLICDPQRV 313

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL 355
           DVNVHPAK+ +RFR    +R  I+ ++++A+   G   S+ ++ + + +F  + A     
Sbjct: 314 DVNVHPAKAEVRFRESGEVRGLIVTALRQALAGAGHRASTTVAGETLEAFRPEAAAPPAA 373

Query: 356 PKYA---TSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQ 412
             Y     S  +       Q  + +   L  +      E      E       LG A AQ
Sbjct: 374 RIYQMDRPSAASVARSFAFQAPQAAMPGLAEAPAARVEEAPVDAAE----DRPLGAARAQ 429

Query: 413 IHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECAL 472
           IH N+I++QT  GLVIVDQHAAHERL++E++++  +   I  Q LL PEI++L   + A 
Sbjct: 430 IHGNWILAQTARGLVIVDQHAAHERLVYERLKRQRDGAGIARQVLLIPEIVELSPSDAAR 489

Query: 473 IMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDR 532
           ++E  ++L  LG+  E FG  A+A+RE+PAIL K     LLRDI+D++ D  ++  LQ R
Sbjct: 490 LLEAADELAALGLVLEPFGGGAVAVREVPAILGKVEAAPLLRDILDDLADLGSSDRLQAR 549

Query: 533 IENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLF 592
           ++ +L+ MAC+GS+RSGR +++ EMN LLREME  P S QCNHGRPT+++LKL+DIE+LF
Sbjct: 550 MDAVLSRMACHGSVRSGRALRAEEMNALLREMEATPLSGQCNHGRPTYVELKLADIERLF 609

Query: 593 GR 594
           GR
Sbjct: 610 GR 611


>gi|254477379|ref|ZP_05090765.1| DNA mismatch repair protein MutL [Ruegeria sp. R11]
 gi|214031622|gb|EEB72457.1| DNA mismatch repair protein MutL [Ruegeria sp. R11]
          Length = 649

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 260/634 (41%), Positives = 386/634 (60%), Gaps = 43/634 (6%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA ++R+   IA GGK+  ++TD+G G
Sbjct: 16  IRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGATRITIDIADGGKTLIRVTDDGCG 75

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT +++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR   ++  AQI
Sbjct: 76  MTPDDLPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLTITSRAAGHD-AAQI 134

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +SG K+  V+P A+  GT+VE+RDLF+  PARL F++S++ E+  I DVI+R+A+A P 
Sbjct: 135 RVSGGKLEPVKPAALRGGTVVELRDLFYATPARLKFMRSDRAESQAIGDVIKRLAMAEPS 194

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT    S     R        +G+  +    R++ V+G +F  NA++++     I L 
Sbjct: 195 VGFTLRDVSGGGDGRVTFRADPLSGDLFDALHGRLAAVLGREFAENALKIDASREGIRLY 254

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   ++F+N R V+DK +   +R AY + +   R+P   L ++ DP  
Sbjct: 255 GYAALPTYSRGAAVAQFLFVNTRPVKDKMLTGALRAAYFDFLSRDRHPAAALFIDCDPTL 314

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR+P + R  I+ S++ A+ + G   SS ++   + +   +    T 
Sbjct: 315 VDVNVHPAKSEVRFRDPGLARGLIVSSLRHALAEAGHRASSTVAGATLGAMRPEQPTATG 374

Query: 355 LPKY---------ATSLTNTQEKLFLQENRLSTNDLLPSDDPTY---------------- 389
            P+          A SL+   +  +  +          +   +                 
Sbjct: 375 APRVYQMDRPSMGARSLSYAAQAPYRADGAPVPQGDDNAPGFSEFASAYSGRVIDAPAPP 434

Query: 390 ---------SEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIF 440
                     ED     E  A    LG A  Q+H+NYII+QT DG+VIVDQHAAHERL++
Sbjct: 435 HPAMAGQAVQEDQPEPPEQRAEELPLGAARGQVHENYIIAQTRDGMVIVDQHAAHERLVY 494

Query: 441 EKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREI 500
           EK+++      + +Q LL P+I++L E +CA ++   ++L + G+  E FG  A+A+RE 
Sbjct: 495 EKLKRQMAENGVAAQALLIPDIVELSENDCARLLSVADELQKFGLGIEAFGGGAVAVRET 554

Query: 501 PAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRL 560
           PAIL   N   ++RDI+DE+ D   +  +Q +IE IL+ +AC+GSIRSGR M+  EMN L
Sbjct: 555 PAILGTVNAEAMVRDILDELDDQGESQLVQAKIEAILSRVACHGSIRSGRWMRGEEMNAL 614

Query: 561 LREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LREME  P+S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 615 LREMEATPHSGQCNHGRPTYVELKLADIERLFGR 648


>gi|254427517|ref|ZP_05041224.1| DNA mismatch repair protein MutL [Alcanivorax sp. DG881]
 gi|196193686|gb|EDX88645.1| DNA mismatch repair protein MutL [Alcanivorax sp. DG881]
          Length = 622

 Score =  558 bits (1438), Expect = e-156,   Method: Composition-based stats.
 Identities = 203/618 (32%), Positives = 340/618 (55%), Gaps = 25/618 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI+ L  ++ NQIAAGE++ERP+  +KEL+EN+LDA S  +   +  GG    ++ DNG 
Sbjct: 3   KIQLLDSRLANQIAAGEVVERPASVLKELLENALDAGSESISVDVEQGGVKLVRVRDNGN 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+A+ RH TSKI   DD   I T GFRGEAL +I +VS L+L S       G 
Sbjct: 63  GIERDDLPLALSRHATSKIRGLDDLEAIGTLGFRGEALAAISSVSRLSLASNVEGEAEGW 122

Query: 120 QIAISGEKISSVR-PVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+ + G  ++    P     GT V +RDLFF  PAR  FL++E+ E N + +V RR+A++
Sbjct: 123 QVTVEGRDMAPTVAPAGHPRGTTVTMRDLFFNTPARRRFLRTEKTEFNHLEEVFRRIALS 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
               +F  +  +   +++     +     R++++ G+ F+  AV ++ + + + L G+ G
Sbjct: 183 EFNTAFRLTHNQKVIHQLPAGLDDTLRAARVAKLCGKGFMEQAVAVDVERDGLRLHGWMG 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y ++NGR ++DK +   +R AYA+ +  GR+P  VL LE+DP  VDVN
Sbjct: 243 LPTFSRSQADLQYFYVNGRVIRDKVVSHAVRQAYADVLYHGRHPAYVLFLELDPAMVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKK-----------GISTSSVLSKKMISSFHQ 347
           VHP K  +RFR   ++  F+  S+ +AI                  ++      ++    
Sbjct: 303 VHPTKHEVRFREQRMVHGFLYSSLHRAIAGVRPGQELAGSVVDEGATAAGMDTAMAPSQG 362

Query: 348 DNAPKTHLPKYATSLTNTQEKLFLQ----------ENRLSTNDLLPSDDPTYSEDNDPVE 397
           + +  +      +SL+    + +              +      L     + S  +    
Sbjct: 363 NMSLTSPAGAGMSSLSRPAGQAYPPTGGSAFYGQGARQADAYGALVGQQVSESAPSMMPP 422

Query: 398 ESE-ATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQT 456
            SE  T   LG A AQ+H  +I+++   G+V+VD HAAHER+ +E+++Q +   K+ SQ 
Sbjct: 423 ASEDETVPPLGYAVAQLHGIFILAENQQGMVVVDMHAAHERITYERLKQSWADDKVRSQP 482

Query: 457 LLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDI 516
           LL P  + +   E     +  E   RLG   ER GP  + +RE+PA+L   +   ++RD+
Sbjct: 483 LLVPVSLAVSSREADFAEQQPEVFSRLGFGVERAGPETLVVREVPALLRNGDSESMVRDV 542

Query: 517 IDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHG 576
           + +++   ++  +  +++ +L+TMAC+GS+R+ R++   EMN LLR+ME    S QCNHG
Sbjct: 543 LSDLLAQGSSERIAQKLDELLSTMACHGSVRANRRLTIPEMNALLRDMEATERSGQCNHG 602

Query: 577 RPTFIKLKLSDIEKLFGR 594
           RPT+ ++ + D+++LF R
Sbjct: 603 RPTWTQMSIKDLDRLFMR 620


>gi|225686071|ref|YP_002734043.1| DNA mismatch repair protein [Brucella melitensis ATCC 23457]
 gi|256262806|ref|ZP_05465338.1| DNA mismatch repair protein [Brucella melitensis bv. 2 str. 63/9]
 gi|254766161|sp|C0RKF6|MUTL_BRUMB RecName: Full=DNA mismatch repair protein mutL
 gi|225642176|gb|ACO02089.1| DNA mismatch repair protein MutL [Brucella melitensis ATCC 23457]
 gi|263092627|gb|EEZ16848.1| DNA mismatch repair protein [Brucella melitensis bv. 2 str. 63/9]
 gi|326410397|gb|ADZ67461.1| DNA mismatch repair protein [Brucella melitensis M28]
          Length = 623

 Score =  558 bits (1438), Expect = e-156,   Method: Composition-based stats.
 Identities = 272/622 (43%), Positives = 395/622 (63%), Gaps = 28/622 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG
Sbjct: 1   MTIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL SRP   ++G +
Sbjct: 61  SGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSRPQDADSGFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + ++G  +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P
Sbjct: 121 VCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ +      ++M    +      ERI QV+G +F  NA+ ++ + + + L G+ GI
Sbjct: 181 HIRFSLAGTDRTPFEMPATGTGAEATLERIGQVLGREFGENALAIDAERDGVRLAGFVGI 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNRGNA   + ++NGR V+DK I   +R AY++ I   R+PV VL L +DP  VDVNV
Sbjct: 241 PSFNRGNALHQFAYVNGRPVRDKQIFGALRGAYSDVIARDRHPVAVLFLTLDPALVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD-NAPKTHLPKY 358
           HPAK+ +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F  +    +   P+ 
Sbjct: 301 HPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRP 360

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDP--------------------------TYSED 392
           A S +    +      R   +                                  + +  
Sbjct: 361 ANSYSPASWRTAPPAPRSEWSPQTAQTAHRPLDLQAAPALRENGQAVLGDVAVPASDARA 420

Query: 393 NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
           +      E     LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++  I
Sbjct: 421 SVAEAPVELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHARPI 480

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
             Q LL PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+ QL
Sbjct: 481 AGQMLLIPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLGEMNVQQL 540

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           +RD+ DEI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P S  
Sbjct: 541 IRDLADEIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPGSGT 600

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 601 CNHGRPTYIELKLTDIERLFGR 622


>gi|304311527|ref|YP_003811125.1| DNA mismatch repair enzyme (predicted ATPase) [gamma
           proteobacterium HdN1]
 gi|301797260|emb|CBL45480.1| DNA mismatch repair enzyme (predicted ATPase) [gamma
           proteobacterium HdN1]
          Length = 646

 Score =  558 bits (1437), Expect = e-156,   Method: Composition-based stats.
 Identities = 209/642 (32%), Positives = 352/642 (54%), Gaps = 49/642 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L  ++ NQIAAGE++ERP+  +KEL+EN+LDA ++R++  +  GG    ++ DNG 
Sbjct: 3   RIELLPPRLANQIAAGEVVERPASVLKELLENALDAGATRIDIDVEEGGVKLIRVRDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +E+P+A+ RH TSKI   +D   + T GFRGEAL SI +VS L L +   +N TG 
Sbjct: 63  GIPKDEMPLALARHATSKIHQIEDLEGVVTLGFRGEALASIASVSRLQLSASDNENGTGW 122

Query: 120 QIAISGEKISSVRPVA-MNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           ++   G+ ++++        GT +EV DLFF  PAR  FL++E+ E N + +V R++A++
Sbjct: 123 RVETEGQDMAAMVSATAHPRGTTLEVHDLFFNTPARRKFLRAEKTEFNHLEEVFRKLALS 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           + +  F+      N +++   ++      RI+ ++G  F+ NAV +     ++ L G+ G
Sbjct: 183 HFETGFSLRHNGRNLHQLKPATSELEQDRRIASLLGSVFVENAVRVEVAIGDLRLWGWMG 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR ++DK +   +R AY + +   R+P  VL  E+DPR VDVN
Sbjct: 243 LPTFSRAQADCQYFFVNGRVIRDKVVNHAVRQAYRDVLYHDRHPAYVLFFELDPRMVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKK------------------ 340
           VHP K  +RFR    + +F+ +S+ +AI +   ++++  ++                   
Sbjct: 303 VHPTKHEVRFRESRQVHDFLYRSLHRAIAEITPASATPAAQSGMAGQAPLSASEIPFGAN 362

Query: 341 ----------MISSFHQDNAPKTHLPKYAT------------------SLTNTQEKLFLQ 372
                     ++ +      P   +P  +                   S    +      
Sbjct: 363 ANANVDHSGMLLGASSAAYIPSGFVPNPSALPDQAAPQQTVLPIGIGGSWQAPRRDSGNS 422

Query: 373 ENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQH 432
              ++    L        E+       E     LG A AQ+H  +I++Q  +GL++VD H
Sbjct: 423 YRAMAGYQALHPLPEQSPENTLTPSVREGEIPPLGFALAQLHGVFILAQNQNGLIVVDMH 482

Query: 433 AAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGP 492
           AAHER+ +E+M+Q +   ++ SQTLL P    + + E  LI E  E   RLG + ER GP
Sbjct: 483 AAHERITYERMKQTWAEDRLRSQTLLVPIGFAVSQREADLIDEMPETFTRLGFRIERVGP 542

Query: 493 NAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKM 552
            ++ +R++PA+L++  +  L+RD++ +++    +  +++ I  +L TMAC+GS+R+ R++
Sbjct: 543 ESLLVRDVPALLAECRVESLVRDVLGDLLVHGNSQRIEEHINALLGTMACHGSVRANRQL 602

Query: 553 QSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
             +EMN LLR+ME    S QCNHGRPT++ L L +++KLF R
Sbjct: 603 SLMEMNALLRDMEATERSGQCNHGRPTWVSLSLKELDKLFLR 644


>gi|304393197|ref|ZP_07375125.1| DNA mismatch repair protein MutL [Ahrensia sp. R2A130]
 gi|303294204|gb|EFL88576.1| DNA mismatch repair protein MutL [Ahrensia sp. R2A130]
          Length = 620

 Score =  558 bits (1437), Expect = e-156,   Method: Composition-based stats.
 Identities = 263/619 (42%), Positives = 393/619 (63%), Gaps = 25/619 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E I+NQIAAGE++ERP+  ++EL++N++DA + R++ VIA GGK   ++TD+G
Sbjct: 1   MPVRRLHETIVNQIAAGEVVERPASVVRELLDNAIDAGAKRIDLVIASGGKGLIRVTDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM ++++ +AV+RHCTSK++DD  +IHT GFRGEALPSIG+VS LT+ +R   +++G +
Sbjct: 61  RGMDADDLALAVERHCTSKLTDDLLDIHTLGFRGEALPSIGSVSRLTIRTRQDGSDSGYE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I++ G KI+ VRP A N GT+VEV DLF+  PARL FLK+E+ ET  I DV+RR A+A+P
Sbjct: 121 ISVDGGKITQVRPAAFNRGTVVEVADLFYATPARLKFLKTERAETTAILDVLRRAALAHP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
           ++ F+                +  +  R  QV+G DF  NA+ ++ +   + L G   +P
Sbjct: 181 EIHFSLGGPDRQPVDHPAAQGDDAWLHRARQVLGVDFAENALTIDAEREGVRLTGLAALP 240

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGNA   +V +NGR+V+D+ +   IR AY + +  GR+P+V L + I+P  VDVNVH
Sbjct: 241 TFNRGNALSQFVTVNGRSVKDRQLTGAIRGAYMDHLARGRHPMVSLDIAIEPELVDVNVH 300

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           PAKS +RFR+P ++R  I+ ++++AI   G   SS     M+++F      +  +   A 
Sbjct: 301 PAKSEVRFRDPGLVRGLIVGALRQAIEAAGHRASSRGGVDMMAAFTPGGLGEQAVRAAAG 360

Query: 361 SLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDND----PVEESEATHYQLGIA------- 409
            L       F Q    S  +       + +         ++E+ AT    G         
Sbjct: 361 GLAENAAGHFDQTGYTSPGNANHDWQQSPNRPVQAGPIGLQEAPATFDMTGAPSADQRPS 420

Query: 410 --------------CAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQ 455
                          AQ+H+NYII+QT  GLVIVDQHAAHERL++E+M+       + +Q
Sbjct: 421 ENTDTYLANPLGAARAQVHENYIIAQTEGGLVIVDQHAAHERLVYERMKAQIAEKGVEAQ 480

Query: 456 TLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRD 515
            LL P+I+DL E + A +++H  +L +LG+  E FGP  +A+RE P +L + N   LL+D
Sbjct: 481 MLLIPQIVDLAEDDAARLLDHSVELAQLGLCFEEFGPGTLAVRETPTLLGEVNAAALLQD 540

Query: 516 IIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNH 575
           + DEI +  T  T+++RI+++ ATMAC+GS+RSGR+++  EM+ LLR+ME  PNS QCNH
Sbjct: 541 LADEIAEWGTATTVRERIDHVAATMACHGSVRSGRRLRPQEMDALLRDMEATPNSGQCNH 600

Query: 576 GRPTFIKLKLSDIEKLFGR 594
           GRPT+++LKLSDIE+LFGR
Sbjct: 601 GRPTYVELKLSDIERLFGR 619


>gi|84515075|ref|ZP_01002438.1| DNA mismatch repair protein [Loktanella vestfoldensis SKA53]
 gi|84511234|gb|EAQ07688.1| DNA mismatch repair protein [Loktanella vestfoldensis SKA53]
          Length = 607

 Score =  558 bits (1437), Expect = e-156,   Method: Composition-based stats.
 Identities = 262/599 (43%), Positives = 387/599 (64%), Gaps = 17/599 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+ENS+DA + R+E VIA GGK+  +++D+G G
Sbjct: 18  IRQLDEAAINRIAAGEVLERPASAVKELVENSIDAGAQRIEVVIADGGKTLIRVSDDGCG 77

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M ++++P+A+ RH TSKI   D  NI +FGFRGEAL S+GAV  L + SR P +     I
Sbjct: 78  MAADDLPLALSRHATSKIDGSDLLNITSFGFRGEALASLGAVGRLLITSRTPGDG-AHSI 136

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           A+SG +IS VRP A+  GT+VE+RD+F+  PARL FL++++ E   +TDV++R+A+A P 
Sbjct: 137 AVSGGRISDVRPAALTSGTVVELRDMFYATPARLKFLRTDRAEAQAVTDVVKRLAMAEPF 196

Query: 182 VSFTFS--TIKSNRYKMNFQSTNGNFPERIS----QVIGEDFINNAVELNEKSNEITLQG 235
           V+F     +    R      +  G+  + +      V+G DF +NA+ ++ + +   L G
Sbjct: 197 VTFILRDASDGDTRVVFRADAQTGDLFDALHGRLQTVLGRDFADNALRIDAERDGFHLTG 256

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y  +PT++RG A   ++F+NGR V+DK +L  +R AY + +   R+PV  L ++ DP  V
Sbjct: 257 YAALPTYSRGAAVAQFLFVNGRPVRDKMLLGALRAAYMDVLSRDRHPVAALFVDCDPMLV 316

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL 355
           DVNVHPAKS +RFR+P ++R  I+  ++ A+   G   SS ++   + +           
Sbjct: 317 DVNVHPAKSEVRFRDPGVVRGLIVSGLRHALAGAGHRASSTVADATLGAME--------- 367

Query: 356 PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQ 415
           P++AT      ++       L+     P      S   +P  +  +    LG A AQ+H+
Sbjct: 368 PQHATPRVYQMDRPSFSARSLTFQAQAPGFAEMPSARVEPPADDTSADLPLGAARAQVHE 427

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           NYII+QT  G+VIVD HAAHERL++EK++    +  + +Q LL PEI++L + E A +++
Sbjct: 428 NYIIAQTATGIVIVDGHAAHERLVYEKLKSQMATNGVAAQALLIPEIVELSDHETAALLD 487

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
             +DL RLG+  E FG NAIA+RE PAIL + N   +LRDI DE+ D   + ++Q RIE 
Sbjct: 488 IADDLARLGLTIEPFGGNAIAVRETPAILGEINAAAMLRDISDELADQGDSASVQARIEA 547

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           IL+ +AC+GSIR+GR+MQ+ EMN LLREME  P+S QCNHGRPT+++LKLSDIE+LFGR
Sbjct: 548 ILSRVACHGSIRTGRRMQAAEMNALLREMEATPHSGQCNHGRPTYVELKLSDIERLFGR 606


>gi|254516807|ref|ZP_05128865.1| DNA mismatch repair protein MutL [gamma proteobacterium NOR5-3]
 gi|219674312|gb|EED30680.1| DNA mismatch repair protein MutL [gamma proteobacterium NOR5-3]
          Length = 624

 Score =  557 bits (1436), Expect = e-156,   Method: Composition-based stats.
 Identities = 217/622 (34%), Positives = 346/622 (55%), Gaps = 28/622 (4%)

Query: 1   MK-IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDN 59
           M  I++L  ++ NQIAAGE++ERP+  +KEL+ENSLDA + RV+  I   G    ++ DN
Sbjct: 1   MPVIKRLPARLANQIAAGEVVERPASVVKELLENSLDAGALRVDIDIEAAGTKLIRVRDN 60

Query: 60  GFGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNT 117
           GFG+++E++P+A+ RH TSKI   DD   + +FGFRGEAL SIG+VSHL + S   +  +
Sbjct: 61  GFGISAEDLPLALDRHATSKIGSLDDLEQVGSFGFRGEALASIGSVSHLIVTSNTAEAGS 120

Query: 118 -GAQIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRM 175
                + SG  +    +P A   GT VEVRDLFF  PAR  FL++E+ E N + DV++R+
Sbjct: 121 EAHSASCSGRDMQVTLKPAAHPQGTTVEVRDLFFNTPARRKFLRTERTEFNHLDDVVKRL 180

Query: 176 AIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQG 235
           A++   VSF           +       +   R++ + G  F+ +AV ++  + E+ L G
Sbjct: 181 ALSRFDVSFGLRHNGRQLQDLRRCDDEADRLRRVALLCGPGFVEHAVAIDRDATELRLHG 240

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           +   P+F+R  A+  + ++NGR ++DK +   +R A+++ +  GR+P  VL LE+DP +V
Sbjct: 241 WVAQPSFSRSQADLQHFYVNGRYIRDKLVAHAVRQAFSDVLYQGRHPAFVLYLELDPAEV 300

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSS-------------------- 335
           DVNVHP K  +RFR+   + +FI  ++ KA+     S +S                    
Sbjct: 301 DVNVHPTKHEVRFRDGRSVHSFIYSTLHKALADIRPSDTSMPAQASSSPVSASAGRLDLL 360

Query: 336 --VLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDN 393
              L ++      +  A  T +     S  + Q          +            +E  
Sbjct: 361 TGELVRQREMGLVEQGAGTTAVFSEHGSRGDFQSGRGSSTGFDAATAASYQQLYGSAEGR 420

Query: 394 DPVEESEATHYQL-GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
           + V E +A      G A AQ+H  YI++Q  +GLV+VD HAAHER+ +E+++Q  +   I
Sbjct: 421 NGVAEGDAAEVPPLGYALAQLHGVYILAQNREGLVLVDMHAAHERITYERLKQARDEQGI 480

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
            SQ LL P+ + +   E  L+ EH      LG++ +  G  ++ IREIP  L   N+ +L
Sbjct: 481 RSQPLLVPQSVSVSSREALLLEEHASLFQSLGLRVDIAGEESLIIREIPVSLQGANVEEL 540

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           LRD++ ++++  T+  +    + +L+TMAC+GS+R+ R++   EMN LLR+ME    S Q
Sbjct: 541 LRDVLADLLEYGTSERIARHEDELLSTMACHGSVRANRRLTVPEMNALLRDMEITERSGQ 600

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT+  L + ++++LF R
Sbjct: 601 CNHGRPTWTSLSVQELDRLFLR 622


>gi|306845535|ref|ZP_07478104.1| DNA mismatch repair protein MutL [Brucella sp. BO1]
 gi|306273856|gb|EFM55683.1| DNA mismatch repair protein MutL [Brucella sp. BO1]
          Length = 623

 Score =  557 bits (1436), Expect = e-156,   Method: Composition-based stats.
 Identities = 271/622 (43%), Positives = 392/622 (63%), Gaps = 28/622 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG
Sbjct: 1   MTIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL SR    ++G +
Sbjct: 61  SGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSRSQDADSGFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + ++G  +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P
Sbjct: 121 VCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ +      ++M    +      ERI QV+G +F  NA+ ++ + + + L G+ GI
Sbjct: 181 HIRFSLAGTDRTPFEMPATGTGAEATLERIGQVLGREFGENALAIDAERDGVRLAGFVGI 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNRGNA   + ++NGR V+DK I   +R AY++ I   R+PV VL L +DP  VDVNV
Sbjct: 241 PSFNRGNALHQFAYVNGRPVRDKQIFGALRGAYSDVIARDRHPVAVLFLTLDPALVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD-NAPKTHLPKY 358
           HPAK+ +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F  +    +   P+ 
Sbjct: 301 HPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRP 360

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVE--------------------- 397
           A S +    +      R   +           +                           
Sbjct: 361 ANSYSPASWRTAPPAPRSEWSPQTAHPAHRPLDLQAAPAFRENEQAVLGDVAVPAADARA 420

Query: 398 -----ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
                  E     LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++  I
Sbjct: 421 SVAEVPVELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHARPI 480

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
             Q LL PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+ QL
Sbjct: 481 AGQMLLIPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLGEMNVQQL 540

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           +RD+ DEI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P S  
Sbjct: 541 IRDLADEIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPGSGT 600

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 601 CNHGRPTYIELKLTDIERLFGR 622


>gi|114763561|ref|ZP_01442966.1| DNA mismatch repair protein [Pelagibaca bermudensis HTCC2601]
 gi|114543841|gb|EAU46853.1| DNA mismatch repair protein [Roseovarius sp. HTCC2601]
          Length = 621

 Score =  557 bits (1436), Expect = e-156,   Method: Composition-based stats.
 Identities = 260/621 (41%), Positives = 399/621 (64%), Gaps = 28/621 (4%)

Query: 1   MK--IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITD 58
           M+  IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA + RV   +A GGK+  ++TD
Sbjct: 1   MRPIIRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGARRVTIELADGGKTLIRVTD 60

Query: 59  NGFGMTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNT 117
           +G GM+++E+P+A+ RH TSKI   D  NIH+FGFRGEALPS+GAV  LT+ SR      
Sbjct: 61  DGCGMSADELPLALSRHATSKIDGSDLLNIHSFGFRGEALPSLGAVGRLTIQSRASGEE- 119

Query: 118 GAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
            A+IA++G ++++V+P A+N GT+V +RDLFF  PARL FL+S++ E   I++VI+R+A+
Sbjct: 120 AAEIAVAGGQMAAVKPCALNGGTVVTLRDLFFATPARLKFLRSDRAEMQAISEVIKRLAM 179

Query: 178 AYPKVSFTFS--TIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEI 231
           A P V FT    +   +R        +G+  +    R++QV+G +F +NA+ ++ +    
Sbjct: 180 AEPSVGFTLRDVSEGKDRTTFRADPCSGDLFDALRGRLAQVMGAEFTDNALNIDAEREGF 239

Query: 232 TLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEID 291
            L G   +PT++RG++   ++F+NGR VQD+ +L  +R AYA+ +   R+P V L ++ D
Sbjct: 240 RLTGLAALPTYSRGSSVAQHLFVNGRPVQDRLLLGALRGAYADYLSRERHPAVALFVDCD 299

Query: 292 PRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAP 351
           P +VDVNVHPAKS +RFR P ++R  I+ +++ A+ + G   S+ ++   + +   + + 
Sbjct: 300 PHKVDVNVHPAKSEVRFREPGLVRGLIVSALRHALAEAGHRASTTVAGATLGAMRPEPSG 359

Query: 352 KTHLPK---------------YATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPV 396
              + +                A        + F  +              ++S   DPV
Sbjct: 360 PPRVYQMDRPSQGALSSAYRAQAPMTPAEPYQPFEAQAPRPAETGFAEFAGSFSGRVDPV 419

Query: 397 EESEATHYQL---GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKIT 453
           EES     +    G A  Q+H+NYII+QT DG+VIVDQHAAHERL++EK++       + 
Sbjct: 420 EESPQGSDETLPLGAARGQVHENYIIAQTGDGIVIVDQHAAHERLVYEKLKHQMAERGVA 479

Query: 454 SQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLL 513
           +Q LL PEI++L   + + ++   +DL R+G+  E FG +A+A+RE PAIL + N   LL
Sbjct: 480 AQALLIPEIVELSADDLSRLLSIADDLSRMGLTIEAFGGSAVAVRETPAILGEVNAKALL 539

Query: 514 RDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQC 573
            DI+DEI D  ++  +Q++IE IL+ +AC+GSIRSGR+M++ EMN LLREME  P+S QC
Sbjct: 540 TDILDEIADFGSSQLVQEKIEAILSRVACHGSIRSGRRMRAEEMNALLREMEATPHSGQC 599

Query: 574 NHGRPTFIKLKLSDIEKLFGR 594
           NHGRPT+++LKLSDIE+LFGR
Sbjct: 600 NHGRPTYVELKLSDIERLFGR 620


>gi|254524173|ref|ZP_05136228.1| DNA mismatch repair protein MutL [Stenotrophomonas sp. SKA14]
 gi|219721764|gb|EED40289.1| DNA mismatch repair protein MutL [Stenotrophomonas sp. SKA14]
          Length = 634

 Score =  557 bits (1436), Expect = e-156,   Method: Composition-based stats.
 Identities = 221/626 (35%), Positives = 348/626 (55%), Gaps = 35/626 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            IR L + +INQIAAGE++ERP+  +KEL+EN++DA +SRV+  +  GG    +I DNG 
Sbjct: 9   PIRPLPDILINQIAAGEVVERPASVVKELVENAIDAGASRVDIDLEEGGVRLIRIRDNGS 68

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  E++P+AV RH TSKI+D  D  ++ T GFRGEALPSI +VS  TL SR   +  G+
Sbjct: 69  GIAPEQLPLAVSRHATSKIADLDDLESVATLGFRGEALPSIASVSRFTLASRRAHDEHGS 128

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + I G KI  V P A  PGT VEVR+LF+ +PAR  FL++E+ E   I + +R +A+A 
Sbjct: 129 ALQIEGGKIGEVTPRAHAPGTTVEVRELFYNVPARRKFLRAERTELGHIEEWLRSLALAR 188

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V    S       +        +    +++ +GEDF N AV ++     + L G+   
Sbjct: 189 PDVELRVSHNGKASRRYKPGDLYSDAR--LAETLGEDFANQAVRVDHSGAGLRLHGWIAQ 246

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P ++R +A+Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VDVNV
Sbjct: 247 PHYSRASADQQYLYVNGRSVRDRSVAHAVKMAYGDVLYHGRQPAYVLFLELDPTRVDVNV 306

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI---------NKKGISTSSVLSKKMISSFHQDNA 350
           HPAK  +RFR+  ++ +F+ ++++ A+          + G   +  +            A
Sbjct: 307 HPAKHEVRFRDSRLVHDFVYRTLKDALADTRAGMSAQEIGALPAHPVDAATTPMASSAGA 366

Query: 351 PKTHLPKYATSLT-----------NTQEKLFLQ-----------ENRLSTNDLLPSDDPT 388
               L +     +             Q+ L LQ               S  +   +  P 
Sbjct: 367 SGFGLVRGPAPGSGSGGGGGFSGWRPQQPLGLQVADAPAAYAALYAAPSGAERGATLPPM 426

Query: 389 YSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFN 448
            SE+  PV  ++A    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++   +
Sbjct: 427 PSENGLPVTSADAGVPPLGYAIAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKNAHD 486

Query: 449 STKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKN 508
              + SQ LL P  + + E E        E L  LG +  R GP A+ +R IPA+L+   
Sbjct: 487 GIGLQSQPLLVPITLAVGEREADTAESEAETLAALGFEVTRAGPGALHVRSIPALLAHAE 546

Query: 509 IPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNP 568
              LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME   
Sbjct: 547 PEGLLRDVLTDLREHGQSRRVASARDELLSTMACHGAVRANRRLTVPEMNALLRDMEITE 606

Query: 569 NSSQCNHGRPTFIKLKLSDIEKLFGR 594
            S QCNHGRPT+ +  L++I++ F R
Sbjct: 607 RSGQCNHGRPTWARFSLAEIDRWFLR 632


>gi|163745482|ref|ZP_02152842.1| DNA mismatch repair protein [Oceanibulbus indolifex HEL-45]
 gi|161382300|gb|EDQ06709.1| DNA mismatch repair protein [Oceanibulbus indolifex HEL-45]
          Length = 623

 Score =  557 bits (1436), Expect = e-156,   Method: Composition-based stats.
 Identities = 253/609 (41%), Positives = 380/609 (62%), Gaps = 18/609 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA + R+    A GGK+  ++TD+G G
Sbjct: 15  IRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGARRITVEYADGGKTMIRVTDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           +  +++ +A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR      GA+I
Sbjct: 75  IAPDDLALALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLTITSRAAGFE-GAEI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            + G ++   RP A+N GTIV +RDLFF  PARL FL++++ E   I DVI+R+A+A P 
Sbjct: 134 TVDGGRMGEARPAALNSGTIVTLRDLFFATPARLKFLRTDRAEAQAIGDVIKRLAMAEPF 193

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           V F     S     R     ++  G+  E    R++QV+G +F  N++ ++     + L 
Sbjct: 194 VRFVLRDVSGDGKGRDVFRAEAEQGDLFEALHGRLAQVLGREFAENSLPIDAMREGLHLT 253

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           G+  +PT++RG+A   Y+F+NGR V+DK +   +R AY++ +   R+P   L +E  P  
Sbjct: 254 GFAALPTYSRGSAVAQYLFVNGRPVRDKLLTGALRGAYSDFLSRDRHPAAALFVECPPTL 313

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKT- 353
           VDVNVHPAKS +RFR+P + R  I+ +++ A+ + G   S+ +++  + +   +      
Sbjct: 314 VDVNVHPAKSEVRFRDPGLARGLIVSALRHALAEAGHRASTTVAQATLGAMQPEPQGARV 373

Query: 354 --------HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQ 405
                     P  A      + +             +       +   +   E+ A  Y 
Sbjct: 374 YQMDRAGMDRPSPAARQAAYEAQAPGFAETAGVWGRVEGTPMPAAPVVEEASEAPAPDYP 433

Query: 406 LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDL 465
           LG A  Q+H+NYII+QT +G+VIVDQHAAHERL++EK+++  N   + +Q LL PEI++L
Sbjct: 434 LGTARGQVHENYIIAQTANGMVIVDQHAAHERLVYEKLKRQMNDNGVAAQALLIPEIVEL 493

Query: 466 LEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSST 525
              +CA ++E  +DL +LG+  E FG +AIA+RE PAIL   N   L+ D++DE+ D  +
Sbjct: 494 SANDCARLLELADDLAKLGLGIEAFGGSAIAVRETPAILGTVNARALILDVLDELADGDS 553

Query: 526 TYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKL 585
           +  +Q +IE IL+ +AC+GSIRSGR M++ EMN LLREME  P+S QCNHGRPT+++LKL
Sbjct: 554 SNIVQAKIEAILSRVACHGSIRSGRWMRAEEMNALLREMEATPHSGQCNHGRPTYVELKL 613

Query: 586 SDIEKLFGR 594
           +DIE+LFGR
Sbjct: 614 ADIERLFGR 622


>gi|260166999|ref|ZP_05753810.1| DNA mismatch repair protein [Brucella sp. F5/99]
 gi|261756386|ref|ZP_06000095.1| DNA mismatch repair protein mutL [Brucella sp. F5/99]
 gi|261736370|gb|EEY24366.1| DNA mismatch repair protein mutL [Brucella sp. F5/99]
          Length = 623

 Score =  557 bits (1436), Expect = e-156,   Method: Composition-based stats.
 Identities = 272/622 (43%), Positives = 394/622 (63%), Gaps = 28/622 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG
Sbjct: 1   MTIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL SRP   ++G +
Sbjct: 61  SGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSRPQDADSGFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + ++G  +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P
Sbjct: 121 VCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ +      ++M    +      ERI QV+G +F  NA+ ++ + + + L G+ GI
Sbjct: 181 HIRFSLAGTDRTPFEMPATGTGAEATLERIGQVLGREFGENALAIDAERDGVRLAGFVGI 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNRGNA   + ++NGR V+DK I   +R AY++ I   R+PV VL L +DP  VDVNV
Sbjct: 241 PSFNRGNALHQFAYVNGRPVRDKQIFGALRGAYSDVIARDRHPVAVLFLTLDPALVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD-NAPKTHLPKY 358
           HPAK+ +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F  +    +   P+ 
Sbjct: 301 HPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRP 360

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTY--------------------------SED 392
           A S +    +      R   +                                    +  
Sbjct: 361 ANSYSPASWRTAPPAPRSEWSPQTAHPAHRPLDLQAAPALRENGQAVLGDVAVPAADARA 420

Query: 393 NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
           +      E     LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++  I
Sbjct: 421 SVAEAPVELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHARPI 480

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
             Q LL PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+ QL
Sbjct: 481 AGQMLLIPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLDEMNVQQL 540

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           +RD+ DEI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P S  
Sbjct: 541 IRDLADEIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPGSGT 600

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 601 CNHGRPTYIELKLTDIERLFGR 622


>gi|197106626|ref|YP_002132003.1| DNA mismatch repair protein MutL [Phenylobacterium zucineum HLK1]
 gi|238690138|sp|B4RA70|MUTL_PHEZH RecName: Full=DNA mismatch repair protein mutL
 gi|196480046|gb|ACG79574.1| DNA mismatch repair protein MutL [Phenylobacterium zucineum HLK1]
          Length = 622

 Score =  557 bits (1435), Expect = e-156,   Method: Composition-based stats.
 Identities = 239/621 (38%), Positives = 370/621 (59%), Gaps = 27/621 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L  ++IN+IAAGE++ERP+ A+KEL+EN+LDA ++++E    GGG +   + D+G
Sbjct: 1   MPIRRLPPELINRIAAGEVVERPASAVKELVENALDAGATKIEVQADGGGLTRILVADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD------DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQ 114
            G+++EE+P+AV+RH TSK++       D   I T GFRGEALPSIG+V+ L++ SR  +
Sbjct: 61  CGLSAEELPVAVERHATSKLNPGEDGEYDLLRIGTLGFRGEALPSIGSVARLSIASRARK 120

Query: 115 NNTGAQIAISGEKI------SSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLI 168
            +     A +           S        G  VEVRDLF+  PARL F+KSE+ E   I
Sbjct: 121 ADGSQAEAHAIFVEGGAVGAVSPAAFPGPHGARVEVRDLFYATPARLKFMKSERAEALAI 180

Query: 169 TDVIRRMAIAYPKVSFTFSTIKSNRYKMNFQSTNGN-FPERISQVIGEDFINNAVELNEK 227
           T+ ++R A+A+  VSF          ++  ++   +    R+S ++G +F +NA+ ++ +
Sbjct: 181 TEELKRQAMAHEAVSFALDVDGRRTLRLPAEAAGPDGRLARLSAIMGREFSDNALAIDHE 240

Query: 228 SNEITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLL 287
              + L G+ G+PTFNRGNA   Y+F+NGR V+D+ +   +R AYA+ +   R+P+  L 
Sbjct: 241 REGVRLSGFAGLPTFNRGNAAHQYLFVNGRPVRDRLLQGALRAAYADFLARDRHPLAALY 300

Query: 288 LEIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH- 346
           +E+DP QVDVNVHPAK+ +RFR+P ++R  I+  ++ A+   G   S+ +S   +  F  
Sbjct: 301 VELDPSQVDVNVHPAKAEVRFRDPGLVRGLIVGGLRHALAAAGHRASTTVSMAALGGFRP 360

Query: 347 -------------QDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDN 393
                                 P  A +       L     R     L        +E  
Sbjct: 361 QSMPPPQPSAAGFSAWRQGGWTPSPAAAAAQILPGLSEVSARAEPEALDAYAAGGMAEAA 420

Query: 394 DPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKIT 453
            P    +   Y LG A AQ+H+ YI++QT DG+VIVDQHAAHERL++E+M+ +     + 
Sbjct: 421 SPAPVFDPVDYPLGAARAQVHETYIVAQTRDGVVIVDQHAAHERLVYERMKAEMAEGGVA 480

Query: 454 SQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLL 513
            Q LL PE+++L   E   ++   ++L  LG+  E FGP A+ +RE+PA+L + +   L+
Sbjct: 481 RQALLLPEVVELDPAEAERVVARADELAALGLVVEAFGPGAVLVREVPALLGETDAAGLV 540

Query: 514 RDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQC 573
           RDI D++ ++     L++R+E +  TMAC+GS+R+GR++ + EMN LLR+ME  P+S QC
Sbjct: 541 RDIADDLSENGQALALKERLEEVCGTMACHGSVRAGRRLTAPEMNALLRQMEATPHSGQC 600

Query: 574 NHGRPTFIKLKLSDIEKLFGR 594
           NHGRPT+++LKL+DIE+LFGR
Sbjct: 601 NHGRPTYVELKLADIERLFGR 621


>gi|15964569|ref|NP_384922.1| DNA mismatch repair protein [Sinorhizobium meliloti 1021]
 gi|307309315|ref|ZP_07588978.1| DNA mismatch repair protein MutL [Sinorhizobium meliloti BL225C]
 gi|307320051|ref|ZP_07599472.1| DNA mismatch repair protein MutL [Sinorhizobium meliloti AK83]
 gi|20455110|sp|Q92RP4|MUTL_RHIME RecName: Full=DNA mismatch repair protein mutL
 gi|15073747|emb|CAC45388.1| Probable DNA mismatch repair protein [Sinorhizobium meliloti 1021]
 gi|306894266|gb|EFN25031.1| DNA mismatch repair protein MutL [Sinorhizobium meliloti AK83]
 gi|306900184|gb|EFN30802.1| DNA mismatch repair protein MutL [Sinorhizobium meliloti BL225C]
          Length = 605

 Score =  557 bits (1435), Expect = e-156,   Method: Composition-based stats.
 Identities = 286/606 (47%), Positives = 409/606 (67%), Gaps = 14/606 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I++LSE +INQIAAGE+IERP+ A KELIEN+LDA ++R+E   AGGGK+  ++TDNG
Sbjct: 1   MAIKQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIATAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM+  ++ +A++RHCTSK++D  ++I T GFRGEALPSIG+V+ L++ +R  +   GA 
Sbjct: 61  IGMSPADLELAIRRHCTSKLNDSLADIRTLGFRGEALPSIGSVARLSITTRTAEAREGAA 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ++G +    RP A   GT+VEVRDLFF  PARL F+KSE+ E   I++V+RRMAIA+P
Sbjct: 121 ITVTGGRSEPARPSAAIVGTVVEVRDLFFATPARLKFMKSEKAEAAAISEVVRRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
           +V F  S   S+R  + F +T  +   R++QV+G DF +NA+E++ +     L G+ G+P
Sbjct: 181 RVRFVLS--GSDRTTLEFPATGDDRLARMAQVLGRDFRDNAIEIDAEREGARLTGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+ Q Y F+NGR VQDK I+S +R AYAETIP GRYP+ VL + +DP  VDVNVH
Sbjct: 239 TFNRGNSLQQYAFVNGRPVQDKLIMSALRAAYAETIPQGRYPIAVLSITLDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSV----LSKKMISSFHQDNAPKTHLP 356
           PAKS +RFR+P +IR  II +I++A+ ++G   ++     L +     FH+    +   P
Sbjct: 299 PAKSDVRFRDPGLIRGLIIGAIREALTREGDRAATTGAHGLMRAFRPEFHRAGQQRPQEP 358

Query: 357 KYATSLTNTQ------EKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEAT--HYQLGI 408
             A +  +         + F +  + + +D       + +   +    ++     + LG 
Sbjct: 359 WSAAASPHRPLRFEEAARGFAEAPQAAFSDFAQPSARSAAAAVEATRATDGQAASFPLGA 418

Query: 409 ACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEG 468
           A AQ+H+NYI++QT DGLVIVDQHAAHERL+FE MR   ++  + +Q LL PEI+ L E 
Sbjct: 419 ARAQLHENYIVAQTDDGLVIVDQHAAHERLVFETMRTALHARPVPAQALLIPEIVGLPED 478

Query: 469 ECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYT 528
           +C  +M H E+  RLG+  ERFGP A+A+RE PA+L + +   L+R + DE+ +  T   
Sbjct: 479 DCDRLMAHAEEFTRLGLAIERFGPAAVAVRETPAMLGEMDAAGLVRQLADELAEWDTASG 538

Query: 529 LQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDI 588
           L  R+E + ATMAC+GS+RSGR++++ EMN LLR+ME  P S QCNHGRPT+I+LKL+DI
Sbjct: 539 LAGRLEYLAATMACHGSVRSGRRLRTEEMNALLRQMEATPGSGQCNHGRPTYIELKLADI 598

Query: 589 EKLFGR 594
           E+LFGR
Sbjct: 599 ERLFGR 604


>gi|325916959|ref|ZP_08179201.1| DNA mismatch repair protein MutL [Xanthomonas vesicatoria ATCC
           35937]
 gi|325536810|gb|EGD08564.1| DNA mismatch repair protein MutL [Xanthomonas vesicatoria ATCC
           35937]
          Length = 623

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 224/624 (35%), Positives = 347/624 (55%), Gaps = 33/624 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    +I DNG
Sbjct: 1   MAIRQLPEILINQIAAGEVVERPASVVKELVENALDAGATRVDIDLEEGGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+   E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TL+SR      G
Sbjct: 61  GGIPPHELPLAVSRHATSKIASLDDLETVATLGFRGEALPSIASVSRFTLISRRHDAQHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           A + I G ++  V P A  PGT VEVR+LFF +PAR  FL++E+ E   I + +R +A+A
Sbjct: 121 AALQIEGGRLGEVTPHAHAPGTTVEVRELFFNVPARRKFLRAERTELGHIEEWLRSLALA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P V    S       +        +    + + +GEDF   A+ ++     + L G+  
Sbjct: 181 RPDVELRVSHNGKPSRRYKPGDLYSDAR--LGETLGEDFARQALRVDHSGAGLRLHGWVA 238

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P ++R + +Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VDVN
Sbjct: 239 QPHYSRASTDQQYLYVNGRSVRDRSVAHAVKMAYGDVLFHGRQPAYVLFLELDPARVDVN 298

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSV-----------------LSKKM 341
           VHPAK  +RFR   +I +F+ +++Q A+ +     +                   L    
Sbjct: 299 VHPAKHEVRFREARLIHDFVYRTLQDALAQTRAGATPNSIGNDGAGYLAAGGMGNLPGGA 358

Query: 342 ISSFHQDNAPKTHLPKYATSLTNTQEKLFLQ--ENRLSTNDL---------LPSDDPTYS 390
           ++ +            YA   T +Q  L L+  E R + + L           S  P +S
Sbjct: 359 VTPYTGTPGNGGGSGSYAN-WTPSQSPLGLRVDEARAAYSALYAPLPGSVQQSSSLPQFS 417

Query: 391 EDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST 450
               PV   ++    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++   +S 
Sbjct: 418 GTGLPVTAEDSGVPPLGYAVAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKHAHDSI 477

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
            + +Q LL P  + + E E        E L  LG +  R GP ++ +R IPA+L+     
Sbjct: 478 GLHAQPLLVPMTLAVGEREADTAEREAETLGTLGFEITRAGPQSLHVRSIPALLANAEPE 537

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
            LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME    S
Sbjct: 538 ALLRDVLGDLREHGQSRRIASARDELLSTMACHGAVRANRRLTVPEMNALLRDMEATERS 597

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
            QCNHGRPT+ +  LSDI++ F R
Sbjct: 598 GQCNHGRPTWARFTLSDIDRWFLR 621


>gi|221640592|ref|YP_002526854.1| DNA mismatch repair protein [Rhodobacter sphaeroides KD131]
 gi|221161373|gb|ACM02353.1| DNA mismatch repair protein MutL [Rhodobacter sphaeroides KD131]
          Length = 616

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 256/602 (42%), Positives = 381/602 (63%), Gaps = 11/602 (1%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+EN+LDA + R+   IA GGK+  ++TD+G G
Sbjct: 15  IRQLDEAAINRIAAGEVVERPASAVKELVENALDAGARRIAVDIACGGKTLIRVTDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT++++P+A+ RH TSKI   D  +I +FGFRGEALPS+ AV  LT+ SR  +   GAQI
Sbjct: 75  MTADDLPLALSRHATSKIDGSDLLDIRSFGFRGEALPSLAAVGRLTITSRVAEGE-GAQI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           A+S  +I  VRP A+  GT+VE+RDLFF  PARL FL++++ ET  I +V+RR+A+A P+
Sbjct: 134 AVSAGRIEPVRPAALGAGTVVELRDLFFATPARLKFLRTDRAETQAIAEVVRRLALAEPE 193

Query: 182 VSFTFSTI--KSNRYKMNFQSTNGNF----PERISQVIGEDFINNAVELNEKSNEITLQG 235
           V FT +       R     ++  G+       R+++V+G +F  NA+ ++     + LQG
Sbjct: 194 VGFTLTDHSAGEPRLLFRAEAEGGDLFDALHRRVARVVGAEFAENALRIDVAREGLRLQG 253

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y  +PT++RG+    ++F+NGR V D+ +L  +R  Y + +   RYP  VL L  DP++V
Sbjct: 254 YAALPTYSRGSGVAQFLFVNGRPVLDRMLLGALRAGYMDVLSRDRYPAAVLNLICDPQRV 313

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL 355
           DVNVHPAK+ +RFR    +R  I+ ++++A+   G   S+ ++ + + +F  +       
Sbjct: 314 DVNVHPAKAEVRFREAGEVRGLIVTALRQALAGAGHRASTTVAGETLEAFRPERPAAAGP 373

Query: 356 PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE---SEATHYQLGIACAQ 412
              +      +          +     P+           VE     EA    LG A AQ
Sbjct: 374 GSASRIYQMDRPSAAAVARSFAFQAPEPAMPGLAEAPAARVEAPAAEEAHDRPLGAARAQ 433

Query: 413 IHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECAL 472
           IH N+I++QT  GLVIVDQHAAHERL++EK+++  + T I  Q LL PEI++L   + A 
Sbjct: 434 IHGNWILAQTESGLVIVDQHAAHERLVYEKLKRQRDETGIARQALLIPEIVELSPTDAAR 493

Query: 473 IMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDR 532
           ++E  ++L   G+  E FG  A+A+RE+PAIL K     LLRDI+D++ D  ++  LQ R
Sbjct: 494 LLEAADELASAGLVIEPFGGGAVAVREVPAILGKVEAAPLLRDILDDLADLGSSDRLQAR 553

Query: 533 IENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLF 592
           ++ +L+ MAC+GS+RSGR +++ EMN LLREME  P S QCNHGRPT+++LKL+DIE+LF
Sbjct: 554 MDAVLSRMACHGSVRSGRALRAEEMNALLREMEATPLSGQCNHGRPTYVELKLADIERLF 613

Query: 593 GR 594
           GR
Sbjct: 614 GR 615


>gi|119385437|ref|YP_916493.1| DNA mismatch repair protein [Paracoccus denitrificans PD1222]
 gi|119375204|gb|ABL70797.1| DNA mismatch repair protein MutL [Paracoccus denitrificans PD1222]
          Length = 606

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 266/601 (44%), Positives = 395/601 (65%), Gaps = 9/601 (1%)

Query: 1   MK--IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITD 58
           M+  IR+L E   N+IAAGE++ERP+ A+KEL+EN+LDA +SR+E  IA GGK+  +++D
Sbjct: 8   MRPIIRQLDEAAANRIAAGEVVERPASAVKELVENALDAGASRIEVAIAKGGKALIRVSD 67

Query: 59  NGFGMTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNT 117
           +G GMT+E++P+A+ RH TSKI   D  +I +FGFRGEALPS+GAV  L++ SR    + 
Sbjct: 68  DGCGMTAEDLPLALARHATSKIDGSDLLDIRSFGFRGEALPSLGAVGRLSITSRAAGFD- 126

Query: 118 GAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           GAQIA++G +I  V+P A N GT+VE+RDLFF  PARL FL+S++ ET  + +VIRR+A+
Sbjct: 127 GAQIAVAGGRIGPVKPAAGNRGTVVELRDLFFATPARLKFLRSDRAETQAVAEVIRRLAM 186

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNF----PERISQVIGEDFINNAVELNEKSNEITL 233
           A P V FT S     R      +  G        R+++V+G DFI+NA+ ++   + ITL
Sbjct: 187 AEPYVGFTLSDEDEGRVLFRADAEQGELFGALQTRLARVMGRDFIDNALAVDATRDGITL 246

Query: 234 QGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPR 293
            G+  +PT++RG A   ++++NGR V+DK +   +R  Y + +  GR+P  VL L  DP 
Sbjct: 247 TGFAALPTYSRGAAVAQHLYVNGRPVRDKLLTGALRAGYMDVLASGRHPAAVLFLTCDPH 306

Query: 294 QVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKT 353
           QVDVNVHPAK+ +RFR P I R  ++ +++ A+   G   SS ++   + +   + A + 
Sbjct: 307 QVDVNVHPAKAEVRFREPDIARGLVVSALRHALAGAGHRASSTVAMAALGAARPEPASEQ 366

Query: 354 HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQI 413
              +Y  S    +         L+      ++ PT   +  P    E T   LG A AQ+
Sbjct: 367 PR-RYQASYAPARPSAPAIAASLAFQAPGFAEAPTARVEPQPEALPEPTQAPLGAARAQL 425

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
           H+N+I++QT DG+VIVDQHAAHERL++E+++   ++T I SQ LL PEI++L E +   I
Sbjct: 426 HENWIVAQTADGIVIVDQHAAHERLVYERLKAQLDATGIASQALLIPEIVELSEADAHRI 485

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRI 533
           +    +L  LG+  E FG  A+A+RE+PA++ + N   L+RDI+D++ D   +  L+ R+
Sbjct: 486 LAIAGELAALGLVIEPFGGGAVAVREVPALIQRLNAAALIRDILDDLADQGASDRLRARV 545

Query: 534 ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFG 593
           + +L++MAC+GS+RSGR+M + EMN LLREME+ P S QCNHGRPT+I+LKL+DIE+LFG
Sbjct: 546 DAVLSSMACHGSVRSGRRMSADEMNALLREMERVPKSGQCNHGRPTWIELKLADIERLFG 605

Query: 594 R 594
           R
Sbjct: 606 R 606


>gi|254719953|ref|ZP_05181764.1| DNA mismatch repair protein [Brucella sp. 83/13]
 gi|265984961|ref|ZP_06097696.1| DNA mismatch repair protein mutL [Brucella sp. 83/13]
 gi|306838542|ref|ZP_07471380.1| DNA mismatch repair protein MutL [Brucella sp. NF 2653]
 gi|264663553|gb|EEZ33814.1| DNA mismatch repair protein mutL [Brucella sp. 83/13]
 gi|306406409|gb|EFM62650.1| DNA mismatch repair protein MutL [Brucella sp. NF 2653]
          Length = 623

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 271/622 (43%), Positives = 393/622 (63%), Gaps = 28/622 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG
Sbjct: 1   MTIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL SRP   ++G +
Sbjct: 61  SGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSRPQDADSGFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + ++G  +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P
Sbjct: 121 VCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ +      ++M    +      ERI QV+G +F  NA+ ++ + + + L G+ GI
Sbjct: 181 HIRFSLAGTDRTPFEMPATGTGAEATLERIGQVLGREFGENALAIDAERDGVRLAGFVGI 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNRGNA   + ++NGR V+DK I   +R  Y++ I   R+PV VL L +DP  VDVNV
Sbjct: 241 PSFNRGNALHQFAYVNGRPVRDKQIFGALRGTYSDVIARDRHPVAVLFLTLDPALVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD-NAPKTHLPKY 358
           HPAK+ +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F  +    +   P+ 
Sbjct: 301 HPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRP 360

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDP--------------------------TYSED 392
           A S +    +      R   +                                    +  
Sbjct: 361 ANSYSPASWRTAPPAPRSEWSPQTAHPAHRPLDLQAAPAFRENGQAVLGDVAAPAADARA 420

Query: 393 NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
           +      E     LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++  I
Sbjct: 421 SVAEAPVELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHARPI 480

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
             Q LL PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+ QL
Sbjct: 481 AGQILLIPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLGEMNVQQL 540

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           +RD+ DEI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P S  
Sbjct: 541 IRDLADEIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPGSGT 600

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 601 CNHGRPTYIELKLTDIERLFGR 622


>gi|209966848|ref|YP_002299763.1| DNA mismatch repair protein MutL, putative [Rhodospirillum centenum
           SW]
 gi|209960314|gb|ACJ00951.1| DNA mismatch repair protein MutL, putative [Rhodospirillum centenum
           SW]
          Length = 617

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 239/616 (38%), Positives = 366/616 (59%), Gaps = 22/616 (3%)

Query: 1   MK-IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDN 59
           M  +R+L E+++N+IAAGE++ERP+ A+KEL+EN+LDA +SR+E V+  GGK+   + D+
Sbjct: 1   MPTLRRLPERLVNRIAAGEVVERPAAAVKELVENALDAGASRIEVVLRDGGKALIGVADD 60

Query: 60  GFGMTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
           G GM  EE+ +AV+RH TSK+  DD ++I T GFRGEALPSIGAVS L++ SRP   ++ 
Sbjct: 61  GCGMAPEELELAVERHATSKLPDDDLTHIRTLGFRGEALPSIGAVSRLSITSRPRGADSA 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
             I + G     V P A   GT +EVRDLF+  PARL FLK  + E+    D + R+A+A
Sbjct: 121 HAILVEGGAKGPVMPAAGGIGTRIEVRDLFYATPARLKFLKGNRTESEHARDAVERLAMA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQST--NGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
           +P V+F  +       ++   +         R+  V+G +F  NA+ ++     + L G+
Sbjct: 181 HPHVTFLLTDEGRTPLRLPAATGDLMEARLVRLGAVLGREFQENALPVDAARGPVRLVGH 240

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
            G+PT NR  A   Y+F+NGR V+D+ ++  +R AYA+ +   R+P++ L LE+ P +VD
Sbjct: 241 IGLPTLNRPTAAGQYLFVNGRPVKDRLLVGAVRGAYADFLARDRHPMLALFLELPPEEVD 300

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSS-------VLSKKMISSFHQDN 349
           VNVHPAK+ +RFR+  ++R  I+ +++ A+ + G   S+              +      
Sbjct: 301 VNVHPAKTEVRFRDQALVRGLIVGALKHALAQAGHRASTGVAAAALASFAPHDAPLPPPV 360

Query: 350 APKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE----------S 399
                  + A           L E  ++ N  LP      S   D +             
Sbjct: 361 QSALPWQRPAGGFAPAAVPRGLAEMAMAFNAPLPGSPVPASAPPDGLHPAAPVEATTGTE 420

Query: 400 EATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLT 459
            A  + LG A AQ+H  YI++QT DG+VIVDQHAAHERL++E+M+ D  +  +  Q LL 
Sbjct: 421 PARAFPLGAARAQLHTTYIVAQTEDGIVIVDQHAAHERLVYERMKHDLLAGGVKRQGLLI 480

Query: 460 PEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILS-KKNIPQLLRDIID 518
           PE+++L   +   + E   +L  LG+  E FG   + +RE+PA+L  + ++  L+RD+ D
Sbjct: 481 PEVVELDPADAERLGERAAELAELGLVLEPFGTGCVVVREVPALLGARADVRGLVRDLAD 540

Query: 519 EIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRP 578
           E+ +      L++R+E + + MAC+GS+R+GR M + EMN LLR+ME  P+S QCNHGRP
Sbjct: 541 ELAELGDALALKERLEAVCSRMACHGSVRAGRPMNADEMNALLRQMEATPHSGQCNHGRP 600

Query: 579 TFIKLKLSDIEKLFGR 594
           T+++LKL+DIE+LFGR
Sbjct: 601 TYVELKLADIERLFGR 616


>gi|15837362|ref|NP_298050.1| DNA mismatch repair protein [Xylella fastidiosa 9a5c]
 gi|20455160|sp|Q9PFB8|MUTL_XYLFA RecName: Full=DNA mismatch repair protein mutL
 gi|9105652|gb|AAF83570.1|AE003917_4 DNA mismatch repair protein MutL [Xylella fastidiosa 9a5c]
          Length = 619

 Score =  556 bits (1433), Expect = e-156,   Method: Composition-based stats.
 Identities = 216/619 (34%), Positives = 346/619 (55%), Gaps = 27/619 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE+++RP+  +KEL+EN++DA ++RV+  +   G    +I DNG
Sbjct: 1   MPIRQLPEILINQIAAGEVVQRPASVVKELVENAIDAGATRVDIELEAAGGRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            GM ++E+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TLMSR   +  G
Sbjct: 61  HGMAAQELPLAVLRHATSKIASLDDLEAVATLGFRGEALPSIVSVSRFTLMSRRAMDEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           A + I G  +  V P A  PGT VEVRDLF+ +PAR  FL++E+ E   I +  R +A+A
Sbjct: 121 AVLQIEGGTLGEVIPHAHAPGTTVEVRDLFYNVPARRKFLRAERTELGHIEEWARSLALA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +P +    S       +        +    + +++GEDF + A+ ++     + L G   
Sbjct: 181 HPDLELRLSHNGKLSRRYKPGDWYSDAR--LIEILGEDFAHQALRVDHSGAGLRLHGCIV 238

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P ++R N +Q Y+++NGR V+D+ +   ++ AY++ +  GR+P  VL LE+DP +VDVN
Sbjct: 239 QPHYSRSNTDQQYLYVNGRAVRDRSVAHAVKQAYSDVLYQGRHPAYVLFLELDPARVDVN 298

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHPAK  +RFR+  +I +F+ +++Q  + +    T  +              P  H   +
Sbjct: 299 VHPAKQEVRFRDARLIHDFVYRTVQGTLAQTRAGTPPLAVGAGDVGGEGARPPVRHAVSF 358

Query: 359 AT----------SLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHY---- 404
           +           S + +   L      +S  D   +    Y+     V ++         
Sbjct: 359 SGRRGGASHVLGSYSASTAPLMQSAPSVSVADAPAAYAALYAAPPTQVIDAVPQMQTGLP 418

Query: 405 ---------QLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQ 455
                     LG A AQ+H  YI+++  DGL++VD HAAHER+ +E++++  +   + +Q
Sbjct: 419 LAAGAGDVPPLGYAIAQLHGIYILAECADGLIVVDMHAAHERIGYERLKRAHDGIGLRTQ 478

Query: 456 TLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRD 515
            LL P  + + E E  +     E L  LG +  R GP ++ +R IPA+L++     LLRD
Sbjct: 479 PLLVPMTLMVAEREADVAECEAETLASLGFEVTRSGPGSLQVRSIPALLAQAEPEILLRD 538

Query: 516 IIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNH 575
           ++ ++ +   T  + +  + +LATMAC+G++R+ R++   EMN LLR+ME    S QCNH
Sbjct: 539 VLSDLSEHGHTRRVAEARDTLLATMACHGAVRAQRRLSISEMNALLRDMEATERSGQCNH 598

Query: 576 GRPTFIKLKLSDIEKLFGR 594
           GRPT+ +  L++I++ F R
Sbjct: 599 GRPTWARFSLAEIDRWFLR 617


>gi|332559571|ref|ZP_08413893.1| DNA mismatch repair protein [Rhodobacter sphaeroides WS8N]
 gi|332277283|gb|EGJ22598.1| DNA mismatch repair protein [Rhodobacter sphaeroides WS8N]
          Length = 616

 Score =  556 bits (1433), Expect = e-156,   Method: Composition-based stats.
 Identities = 256/602 (42%), Positives = 381/602 (63%), Gaps = 11/602 (1%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+EN+LDA + R+   IA GGK+  ++TD+G G
Sbjct: 15  IRQLDEAAINRIAAGEVVERPASAVKELVENALDAGARRIAVDIACGGKTLIRVTDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT++++P+A+ RH TSKI   D  +I +FGFRGEALPS+ AV  LT+ SR  +   GAQI
Sbjct: 75  MTADDLPLALSRHATSKIDGSDLLDIRSFGFRGEALPSLAAVGRLTITSRVAEGE-GAQI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           A+S  +I  VRP A+  GT+VE+RDLFF  PARL FL++++ ET  I +V+RR+A+A P+
Sbjct: 134 AVSAGRIEPVRPAALGAGTVVELRDLFFATPARLKFLRTDRAETQAIAEVVRRLALAEPE 193

Query: 182 VSFTFSTI--KSNRYKMNFQSTNGNF----PERISQVIGEDFINNAVELNEKSNEITLQG 235
           V FT +       R     ++  G+       R+++V+G +F  NA+ ++     + LQG
Sbjct: 194 VGFTLTDHSAGEPRLLFRAEAEGGDLFDALHRRVARVVGAEFAENALRIDVAREGLRLQG 253

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y  +PT++RG+    ++F+NGR V D+ +L  +R  Y + +   RYP  VL L  DP++V
Sbjct: 254 YAALPTYSRGSGVAQFLFVNGRPVLDRMLLGALRAGYMDVLSRDRYPAAVLNLICDPQRV 313

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL 355
           DVNVHPAK+ +RFR    +R  I+ ++++A+   G   S+ ++ + + +F  +       
Sbjct: 314 DVNVHPAKAEVRFREAGEVRGLIVTALRQALAGAGHRASTTVAGETLEAFRPERPAAAGP 373

Query: 356 PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE---SEATHYQLGIACAQ 412
              +      +          +     P+           VE     EA    LG A AQ
Sbjct: 374 GPASRIYQMDRPSAAAVARSFAFQAPEPAMPGLAEAPAARVEAPVAEEAHDRPLGAARAQ 433

Query: 413 IHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECAL 472
           IH N+I++QT  GLVIVDQHAAHERL++EK+++  + T I  Q LL PEI++L   + A 
Sbjct: 434 IHGNWILAQTESGLVIVDQHAAHERLVYEKLKRQRDETGIARQALLIPEIVELSPTDAAR 493

Query: 473 IMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDR 532
           ++E  ++L   G+  E FG  A+A+RE+PAIL K     LLRDI+D++ D  ++  LQ R
Sbjct: 494 LLEAADELASAGLVIEPFGGGAVAVREVPAILGKVEAAPLLRDILDDLADLGSSDRLQAR 553

Query: 533 IENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLF 592
           ++ +L+ MAC+GS+RSGR +++ EMN LLREME  P S QCNHGRPT+++LKL+DIE+LF
Sbjct: 554 MDAVLSRMACHGSVRSGRALRAEEMNALLREMEATPLSGQCNHGRPTYVELKLADIERLF 613

Query: 593 GR 594
           GR
Sbjct: 614 GR 615


>gi|89067221|ref|ZP_01154734.1| DNA mismatch repair protein [Oceanicola granulosus HTCC2516]
 gi|89046790|gb|EAR52844.1| DNA mismatch repair protein [Oceanicola granulosus HTCC2516]
          Length = 608

 Score =  556 bits (1433), Expect = e-156,   Method: Composition-based stats.
 Identities = 251/599 (41%), Positives = 379/599 (63%), Gaps = 12/599 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+EN++DA ++R+E   A GGK   ++TD+G G
Sbjct: 14  IRQLDEAAINRIAAGEVVERPASAVKELVENAIDAGATRIEIDYADGGKRLIRVTDDGCG 73

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           +  +++P+A+ RH TSKI   D   I TFGFRGEALPS+GAV  LT+ SR       A I
Sbjct: 74  IAGDDLPLALSRHATSKIDGSDLLEISTFGFRGEALPSLGAVGRLTITSRCGDA--AASI 131

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            ++G +  +VRP A++ GT VE+RDLF   PARL FL++++ E   I + ++R+A+A P 
Sbjct: 132 TVTGGRAEAVRPAALSRGTRVELRDLFHATPARLKFLRTDRAEAQAIAETVKRLALAEPF 191

Query: 182 VSFTFS--TIKSNRYKMNFQSTNGNFPERI----SQVIGEDFINNAVELNEKSNEITLQG 235
           V+FT +  +  S R      + +G+  + +    +QV+G DF  NA+ L+ +     L G
Sbjct: 192 VAFTLTDLSGDSPRTVFRADAQSGDLFDALHGRTAQVLGRDFAANAIPLDAEREGHHLTG 251

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y  +PT++RG++ Q ++F+NGR VQD+ ++  +R AY + +   R+P  VL ++  PR V
Sbjct: 252 YAALPTYSRGSSVQQFLFVNGRPVQDRLLIGALRAAYMDVLSRDRHPAAVLFIDCAPRLV 311

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL 355
           DVNVHPAKS +RFR+   +R  I+  ++ A+   G   SS ++   + +F  +  P    
Sbjct: 312 DVNVHPAKSQVRFRDGGSVRGLIVSGLRHALAGAGHRASSTVAGATLGAFRAEPGP---A 368

Query: 356 PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQ 415
           P    +     ++   +           +  P+   +             LG A AQ+H+
Sbjct: 369 PANEPARVYQMDRPAPRAAMPPMPGFAEAPAPSARIEAPAAPAPGDERRPLGAARAQVHE 428

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           NYI++QT  G+V+VDQHAAHERL++EK+++      I +Q LL PEI++L E +CAL++ 
Sbjct: 429 NYIVAQTETGIVLVDQHAAHERLVYEKLKRQSAENGIAAQALLIPEIVELSESDCALLLS 488

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           H + L  LG+  E FG  A+A+RE PA+L + +   L+RDI+DE+ D   +  L+ RI+ 
Sbjct: 489 HADTLATLGLVLEPFGGGAVAVRETPALLGQVDAAALVRDILDELADLGESTALRARIDA 548

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           IL+ +AC+GSIRSGR+M++ EMN LLREME  P S QCNHGRPT+++LKLSDIE+LFGR
Sbjct: 549 ILSRVACHGSIRSGRQMRAEEMNALLREMEATPLSGQCNHGRPTYVELKLSDIERLFGR 607


>gi|192293214|ref|YP_001993819.1| DNA mismatch repair protein [Rhodopseudomonas palustris TIE-1]
 gi|238692573|sp|B3Q7Y9|MUTL_RHOPT RecName: Full=DNA mismatch repair protein mutL
 gi|192286963|gb|ACF03344.1| DNA mismatch repair protein MutL [Rhodopseudomonas palustris TIE-1]
          Length = 595

 Score =  556 bits (1432), Expect = e-156,   Method: Composition-based stats.
 Identities = 236/599 (39%), Positives = 368/599 (61%), Gaps = 10/599 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E I+N+IAAGE++ERP+  +KEL+EN++DA SSR++    GGG+    I D+G
Sbjct: 1   MPVRQLPEIIVNRIAAGEVVERPASVVKELVENAIDAGSSRIDIFSDGGGRRKIVIADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT+ ++ +AV RH TSK+ D D   I T GFRGEALPSIGAV+ L++ +R        
Sbjct: 61  SGMTAADLALAVDRHATSKLDDEDLLQIRTLGFRGEALPSIGAVAKLSITTRHASEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + + G   + + P A++ GT VEV DLFF  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 TLRVEGGDKTPIAPAALSQGTRVEVADLFFATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           P ++FT +  +                  R+  ++G DF  NA+E+  +   + ++G+  
Sbjct: 181 PDIAFTLAGEERAPVTWAAALPGAPGQLIRLGDILGADFRANAIEVRAEREGVVVEGFAA 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P   + NA   Y+F+NGR V+DK IL  +R AY++ +P  R+PVV L + +D R+VD N
Sbjct: 241 SPALTKANALGQYLFVNGRPVRDKLILGAVRAAYSDYLPRDRHPVVALFVTLDSREVDAN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHPAK+ +RFRN  ++R  I+ +++  + ++G  T++  +  +IS+F   + P  +    
Sbjct: 301 VHPAKTEVRFRNAGLVRALIVHALKDGLAREGRRTAANSAGSVISTFRPASMPPANWDWR 360

Query: 359 ATSLTN---TQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQ 415
           A+       +    F +  + + +   PS D   +E        +     LG A  QIH+
Sbjct: 361 ASPSYPVGGSAAPSFAERAQAAFDVGAPSADIRPTEVT-----PDLLDRPLGAARTQIHE 415

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
            YI+SQT DGL++VDQHAAHER+++E+++    +  +  Q LL P+I+++ E     ++ 
Sbjct: 416 TYIVSQTRDGLIVVDQHAAHERIVYERLKASLEANGVQRQILLIPDIVEMDEATVERLVA 475

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
             E+L + G+  E FGP A+A+RE P++L K +   LLRD+ + + +      L+ R+ +
Sbjct: 476 RGEELAKFGLVIESFGPGAVAVRETPSLLGKTDAGGLLRDLAEHMAEWDEALPLERRLMH 535

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           + ATMAC+GS+R+GR ++  EMN LLREME  PNS QCNHGRPT+++L L+DIEKLFGR
Sbjct: 536 VAATMACHGSVRAGRVLKPEEMNALLREMEATPNSGQCNHGRPTYVELTLTDIEKLFGR 594


>gi|194366527|ref|YP_002029137.1| DNA mismatch repair protein [Stenotrophomonas maltophilia R551-3]
 gi|194349331|gb|ACF52454.1| DNA mismatch repair protein MutL [Stenotrophomonas maltophilia
           R551-3]
          Length = 634

 Score =  555 bits (1431), Expect = e-156,   Method: Composition-based stats.
 Identities = 217/627 (34%), Positives = 345/627 (55%), Gaps = 36/627 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            IR L + +INQIAAGE++ERP+  +KEL+EN++DA +SRV+  +  GG    +I DNG 
Sbjct: 8   PIRPLPDILINQIAAGEVVERPASVVKELVENAIDAGASRVDIDLEEGGVRLIRIRDNGS 67

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  E++P+AV RH TSKI+  DD  ++ T GFRGEALPSI +VS  TL SR   +  G+
Sbjct: 68  GIAPEQLPLAVSRHATSKIADLDDLESVATLGFRGEALPSIASVSRFTLSSRRAHDEHGS 127

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + I G KI  V P A  PGT VEVR+LF+ +PAR  FL++E+ E   I + +R +A+A 
Sbjct: 128 ALQIEGGKIGEVTPRAHAPGTTVEVRELFYNVPARRKFLRAERTELGHIEEWLRSLALAR 187

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V    S       +        +    +++ +GEDF N AV ++     + L G+   
Sbjct: 188 PDVELRVSHNGKASRRYKPGDLYSDTR--LAETLGEDFANQAVRVDHSGAGLRLHGWIAQ 245

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P ++R +A+Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VDVNV
Sbjct: 246 PHYSRASADQQYLYVNGRSVRDRSVAHAVKMAYGDVLYHGRQPAYVLFLELDPTRVDVNV 305

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HPAK  +RFR+  ++ +F+ ++++ A+       S+              A        A
Sbjct: 306 HPAKHEVRFRDSRLVHDFVYRTLKDALADTRAGMSAQEIGAGAVHPVDAAAAPVASTAGA 365

Query: 360 TSLT---------------------NTQEKLFLQ-----------ENRLSTNDLLPSDDP 387
           +                          Q+ L LQ               S  +   +  P
Sbjct: 366 SGFGLVRGPAPGAGSGGGGGGFSGWRPQQPLGLQVADAPAAYAALYAAPSGAERGAALPP 425

Query: 388 TYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDF 447
             +E+  PV  ++A    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++   
Sbjct: 426 MPTENGLPVTSADAGVPPLGYAIAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKNAH 485

Query: 448 NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKK 507
           +   + SQ +L P  + + E E        + L  LG +  R GP ++ +R IPA+L+  
Sbjct: 486 DGIGLQSQPMLVPITLAVGEREADTAESEADTLAALGFEVTRAGPGSLHVRSIPALLAHA 545

Query: 508 NIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKN 567
               LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME  
Sbjct: 546 EPEGLLRDVLTDLREHGQSRRVATARDELLSTMACHGAVRANRRLTVPEMNALLRDMEIT 605

Query: 568 PNSSQCNHGRPTFIKLKLSDIEKLFGR 594
             S QCNHGRPT+ +  L++I++ F R
Sbjct: 606 ERSGQCNHGRPTWARFSLAEIDRWFLR 632


>gi|21231736|ref|NP_637653.1| DNA mismatch repair protein [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66768138|ref|YP_242900.1| DNA mismatch repair protein [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188991275|ref|YP_001903285.1| DNA mismatch repair protein [Xanthomonas campestris pv. campestris
           str. B100]
 gi|25090745|sp|Q8P8E4|MUTL_XANCP RecName: Full=DNA mismatch repair protein mutL
 gi|81305885|sp|Q4UVP3|MUTL_XANC8 RecName: Full=DNA mismatch repair protein mutL
 gi|229486329|sp|B0RRZ8|MUTL_XANCB RecName: Full=DNA mismatch repair protein mutL
 gi|21113440|gb|AAM41577.1| DNA mismatch repair protein [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66573470|gb|AAY48880.1| DNA mismatch repair protein [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|167733035|emb|CAP51233.1| DNA mismatch repair protein MutL [Xanthomonas campestris pv.
           campestris]
          Length = 624

 Score =  555 bits (1431), Expect = e-156,   Method: Composition-based stats.
 Identities = 217/624 (34%), Positives = 340/624 (54%), Gaps = 32/624 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +INQIAAGE++ERP+  +KEL+EN+LDA ++RV+  +  GG    +I DNG
Sbjct: 1   MAIRQLPEILINQIAAGEVVERPASVVKELVENALDAGATRVDIDLEEGGVRLIRIRDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  EE+P+AV RH TSKI+  DD   + T GFRGEALPSI +VS  TL SR P    G
Sbjct: 61  GGIAPEELPLAVSRHATSKIASLDDLETVATLGFRGEALPSIASVSRFTLASRRPDAEHG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           + + I G ++  V P A  PGT VEVR+LFF +PAR  FL++E+ E   I + +R +A+A
Sbjct: 121 SALQIEGGRLGEVMPRAHAPGTTVEVRELFFNVPARRKFLRAERTELGHIEEWLRSLALA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P V    S       +        +    + + +GEDF   A+ ++     + L G+  
Sbjct: 181 RPDVELRVSHNGKPSRRYKPGDLYSDAR--LGETLGEDFARQALRVDHSGAGLRLHGWVA 238

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P ++R + +Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VDVN
Sbjct: 239 QPHYSRASTDQQYLYVNGRSVRDRSVAHAVKMAYGDVLFHGRQPAYVLFLELDPARVDVN 298

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDN--------- 349
           VHPAK  +RFR   +I +F+ +++Q A+ +              ++              
Sbjct: 299 VHPAKHEVRFREARLIHDFVYRTLQDALAQTRAGALPADVGVGGAAALGIGAVAAQGGGS 358

Query: 350 --------APKTHLPKYATSLTNTQEKLFLQENRLST-----------NDLLPSDDPTYS 390
                    P         S   +Q  L L+ +               + L     P  S
Sbjct: 359 YVADAGAGHPGAGSGSGYASWAPSQAPLGLRVDEARAAYAALYAPAAGSALRDDGQPVLS 418

Query: 391 EDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST 450
               P    ++    LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++Q  +S 
Sbjct: 419 GTGLPATAHDSGVPPLGYAVAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKQAHDSI 478

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
            + +Q LL P  + + E E        + L  LG +  R GP ++ +R IPA+L+  +  
Sbjct: 479 GLHAQPLLVPMTLAVGEREADTAEREADTLASLGFEITRSGPQSLHVRSIPALLANADPE 538

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
            LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME    S
Sbjct: 539 ALLRDVLGDLREHGQSRRIATARDELLSTMACHGAVRANRRLTVPEMNALLRDMEATERS 598

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
            QCNHGRPT+ +  L +I++ F R
Sbjct: 599 GQCNHGRPTWARFTLGEIDRWFLR 622


>gi|90422900|ref|YP_531270.1| DNA mismatch repair protein [Rhodopseudomonas palustris BisB18]
 gi|123275477|sp|Q219I5|MUTL_RHOPB RecName: Full=DNA mismatch repair protein mutL
 gi|90104914|gb|ABD86951.1| DNA mismatch repair protein MutL [Rhodopseudomonas palustris
           BisB18]
          Length = 599

 Score =  555 bits (1430), Expect = e-156,   Method: Composition-based stats.
 Identities = 238/598 (39%), Positives = 367/598 (61%), Gaps = 4/598 (0%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E ++N+IAAGE++ERP+  +KEL+EN++DA +SR++    GGG+    ITD+G
Sbjct: 1   MPVRQLPETVVNRIAAGEVVERPASVVKELVENAIDAGASRIDIFTDGGGRRRIGITDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT  ++ +AV RH TSK+ D D   I T GFRGEALPSIG+V+ L++ +R        
Sbjct: 61  AGMTHADLTLAVDRHATSKLDDEDLLAIRTLGFRGEALPSIGSVAKLSITTRHAAEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            +A+ G   S + P A++ GT VEV DLF+  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 ALAVEGGAKSPIVPAALSHGTRVEVSDLFYATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           P ++F+ +  +                  R+  ++G DF +NA+E+  + + + ++G+  
Sbjct: 181 PDIAFSMAGEERAPVTWAAALPGAAGRLTRLGDILGGDFRSNAIEVRSERDGVVVEGFAA 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P+  R NA   Y+F+NGR V+DK I+  +R AY++ +P  R+PVV L + +D R+VD N
Sbjct: 241 APSLTRANALGQYLFVNGRPVRDKLIIGAVRAAYSDYLPRDRHPVVALFVSLDSREVDAN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHPAK+ +RFR+  ++R  I+ ++++ + ++G  T++  +   ISSF    AP+ +    
Sbjct: 301 VHPAKTEVRFRDAGLVRALIVHALKEGLAREGKRTAANDAGATISSFRPSFAPRANWDWR 360

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDP--TYSEDNDPVEESEATHYQLGIACAQIHQN 416
           ++                         D     ++       ++ T   LG A  QIHQ 
Sbjct: 361 SSPSYPVAGSAAFDAAAGFAEREQSGFDVGAPSADVRSYQPSADFTDRPLGAARTQIHQT 420

Query: 417 YIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEH 476
           YI++QT DGLV+VDQHAAHERL++EK++    +  +  Q LL PEI++L E     ++  
Sbjct: 421 YIVAQTRDGLVVVDQHAAHERLVYEKLKASLATNGVQRQILLIPEIVELDEATVERLVAR 480

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E+L   G+  E FGP A+A+RE P++L K +   LLRD+ + + +      L+ R+ ++
Sbjct: 481 GEELATFGLVVESFGPGAVAVRETPSLLGKTDAGALLRDLAEHMAEWDEALPLERRLLHV 540

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            ATMAC+GS+R+GR ++  EMN LLREME  PNS QCNHGRPT+++LKLSDIEKLFGR
Sbjct: 541 AATMACHGSVRAGRVLKPEEMNALLREMEDTPNSGQCNHGRPTYVELKLSDIEKLFGR 598


>gi|163758427|ref|ZP_02165515.1| putative DNA mismatch repair protein [Hoeflea phototrophica DFL-43]
 gi|162284716|gb|EDQ34999.1| putative DNA mismatch repair protein [Hoeflea phototrophica DFL-43]
          Length = 620

 Score =  555 bits (1430), Expect = e-156,   Method: Composition-based stats.
 Identities = 283/621 (45%), Positives = 395/621 (63%), Gaps = 29/621 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M+I +L E +INQIAAGE+IERP+  +KEL+EN++DA +SRVE   AGGGK+  ++ D+G
Sbjct: 1   MRIHQLPETLINQIAAGEVIERPASVVKELVENAIDAGASRVEIATAGGGKALIRVIDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM +E++ +AV+RHCTSKI     +I T GFRGEALPSIG+V+ LTL SRP       +
Sbjct: 61  RGMDAEDLQLAVRRHCTSKIDQRLDDIRTLGFRGEALPSIGSVARLTLRSRPADAAHANE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I+++G   S ++P A N GT VEVRDLFF  PARL FLKS++ ET  IT+V+RR+AIA+P
Sbjct: 121 ISLAGGVPSPLKPAAANKGTTVEVRDLFFATPARLKFLKSDRAETAAITEVVRRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V FT S    +R  ++  +T  +   RI QV+G +F  N + L+    EI L G+ G+P
Sbjct: 181 SVRFTLS--GPDRSTLDLAATGEDRLARIGQVLGAEFAANTIALDAMREEIELTGHIGLP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           T+N+ N+   Y F+NGR VQDK ILS IR AY++T+P GRYPV VL + +DP  VDVNVH
Sbjct: 239 TWNKANSLSQYAFVNGRPVQDKQILSAIRAAYSDTLPRGRYPVAVLWITLDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH--------QDNAPK 352
           PAK+ +RFR+P ++R  ++ +I++A+   G   S      ++ +F         Q     
Sbjct: 299 PAKADVRFRDPGLVRGLLVGAIRQALLAGGDQASPSARADLVRAFSSTSPAGSDQSLPGS 358

Query: 353 THLP------------------KYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDND 394
           + +P                  ++A + + +             +          S   D
Sbjct: 359 SSMPPAFHRDGNSAGLAGGWTGQWAAAQSPSWPLDGAAPGFGEASQAEFEAAAAPSGRFD 418

Query: 395 PVEESEATHYQL-GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKIT 453
              E+E       G A AQ+H+NYI+SQT+DG+VIVDQHAAHERL+FE+++       + 
Sbjct: 419 KAPETEPDARHPLGAARAQVHENYILSQTSDGMVIVDQHAAHERLVFERLKTALREGSVA 478

Query: 454 SQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLL 513
           SQ LL PEIIDL E +C  + E   +L   G+  ERFGP AIA+RE PA+L + ++  L+
Sbjct: 479 SQILLLPEIIDLPEDDCDRLAERAGELAGFGLVLERFGPGAIAVRETPAMLGETDVTGLV 538

Query: 514 RDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQC 573
           RD+ DEI +  +T  LQ+R+E + +TMAC+GS+RSGR++   EM+ LLREME+ P S QC
Sbjct: 539 RDLADEITEWDSTGGLQERLEAVASTMACHGSVRSGRRLTREEMDALLREMERTPGSGQC 598

Query: 574 NHGRPTFIKLKLSDIEKLFGR 594
           NHGRPT+I+LKLSDIEKLF R
Sbjct: 599 NHGRPTYIELKLSDIEKLFSR 619


>gi|88704498|ref|ZP_01102212.1| DNA mismatch repair protein mutL [Congregibacter litoralis KT71]
 gi|88701549|gb|EAQ98654.1| DNA mismatch repair protein mutL [Congregibacter litoralis KT71]
          Length = 629

 Score =  555 bits (1430), Expect = e-156,   Method: Composition-based stats.
 Identities = 214/627 (34%), Positives = 349/627 (55%), Gaps = 33/627 (5%)

Query: 1   MK-IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDN 59
           M  I++L  ++ NQIAAGE++ERP+  +KEL+ENSLDA + RV+  I   G    +I D+
Sbjct: 1   MPLIKRLPPRLANQIAAGEVVERPASVVKELLENSLDAGARRVDLDIEAAGTKLIRIRDD 60

Query: 60  GFGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNT 117
           G G+ S+++P+A+ RH TSKI   DD   + +FGFRGEAL SIG+VSHL + S   +  +
Sbjct: 61  GSGIASDDLPLALDRHATSKIESLDDLEQVGSFGFRGEALASIGSVSHLVVTSNTAEAGS 120

Query: 118 -GAQIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRM 175
            G   + SG  +    +P A   GT VEVRDLFF  PAR  FL++E+ E N + DV++R+
Sbjct: 121 DGQAASCSGRDMEVTLKPAAHPRGTTVEVRDLFFNTPARRKFLRTERTEFNHLDDVVKRI 180

Query: 176 AIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQG 235
           A++   VSF           +       +   R++ + G  F+ NAV ++  + ++ L G
Sbjct: 181 ALSRFDVSFALRHNGRQLRDLRRCDNEADQLRRVASLCGPAFVENAVAIDRNAGDLRLHG 240

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           +   P+F+R  A+  + ++NGR ++DK ++  +R A+++ +  GR+P  VL LE+DP +V
Sbjct: 241 WVAQPSFSRSQADLQHFYVNGRYIRDKLVVHAVRQAFSDVLYQGRHPAFVLYLELDPAEV 300

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH--------- 346
           DVNVHP K  +RFR+   + +FI  ++ KA+     S S+V ++  +S            
Sbjct: 301 DVNVHPTKHEVRFRDGRSVHSFIYSTLHKALADIRPSDSAVPTQASMSPVSASTGRLDLL 360

Query: 347 ------------QDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDND 394
                       ++               +  ++   Q  R +      +   +Y +   
Sbjct: 361 TGELVRQQEMGLREQGAGRLTAANPGVFADRGDRGDFQGGRGAPAGFDDATAASYRQLYA 420

Query: 395 PVEES-------EATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDF 447
             ++         A    LG A AQ+H  YI++Q  +G+V+VD HAAHER+ +E+++Q  
Sbjct: 421 SPDKPGSVEEGDGADIPPLGYALAQLHGIYILAQNREGMVLVDTHAAHERITYERLKQAR 480

Query: 448 NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKK 507
           +   I SQ LL P+ + +   E  L+ EH      LG++ +  G  ++ IREIP  L   
Sbjct: 481 DEQGIRSQPLLVPQSVSVSSREAILVEEHAALFESLGLRVDVAGEESLLIREIPVSLQGA 540

Query: 508 NIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKN 567
           ++ QLLRD++ ++++  ++  +    + +L+TMAC+GS+R+ R++   EMN LLR+ME  
Sbjct: 541 DVEQLLRDVLADLLEYGSSERIARHEDELLSTMACHGSVRANRRLTVPEMNALLRDMEVT 600

Query: 568 PNSSQCNHGRPTFIKLKLSDIEKLFGR 594
             S QCNHGRPT+  L + D+++LF R
Sbjct: 601 ERSGQCNHGRPTWTALSVQDLDRLFLR 627


>gi|325292085|ref|YP_004277949.1| DNA mismatch repair protein [Agrobacterium sp. H13-3]
 gi|325059938|gb|ADY63629.1| DNA mismatch repair protein [Agrobacterium sp. H13-3]
          Length = 609

 Score =  555 bits (1430), Expect = e-156,   Method: Composition-based stats.
 Identities = 300/607 (49%), Positives = 411/607 (67%), Gaps = 15/607 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I++LSE +INQIAAGE+IERPS A KEL+EN++DA ++R+E   AGGGK   +ITDNG
Sbjct: 4   MAIKQLSETLINQIAAGEVIERPSSATKELVENAIDAGATRIEIATAGGGKGLVRITDNG 63

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM+  ++ +AV+RHCTSKIS    +I T GFRGEALPSIG+V+ L++ SR      G+ 
Sbjct: 64  SGMSPADLELAVRRHCTSKISTTLDDIRTLGFRGEALPSIGSVAKLSITSRQHGAEQGSV 123

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I+++G K+S VRP A N GTIVEVRDLFF  PARL FLK+E+ E   IT+V++RMAIA+P
Sbjct: 124 ISVTGGKVSEVRPAAANAGTIVEVRDLFFATPARLKFLKTERAEAAAITEVVKRMAIAFP 183

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            + F  S   ++R  +   ST  +   R++Q++G +F +NA+E++    ++TL G+ G+P
Sbjct: 184 HIRFVLS--GTDRSTLEIPSTGDDHLARMAQILGAEFKDNAIEIDAGREDVTLSGFAGVP 241

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+   YVF+NGR VQDK +LS IR AYAET+P GRYPV VL L +DP  VDVNVH
Sbjct: 242 TFNRGNSAHQYVFVNGRPVQDKLLLSAIRGAYAETVPHGRYPVAVLSLTLDPAFVDVNVH 301

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           PAKS +RFR+P ++R  I+ +I++A+ + G   ++  + +M+++F    +P    P  A 
Sbjct: 302 PAKSDVRFRDPGLVRGLIVGAIRQALTRDGDRAATTGASQMMNAFRPGYSPSNLRPSAAA 361

Query: 361 ----------SLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEES---EATHYQLG 407
                      L  +    F +  +   +D+          +      S   E + Y LG
Sbjct: 362 TWSAAASPSRPLAVSGNMQFAEAVQSRFSDITMPTARAEPREVYEASASPSLEPSQYPLG 421

Query: 408 IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLE 467
            A AQ+HQNYI++QT DGLVIVDQHAAHERL+FE+MR   +S +  SQ LL PEIIDL E
Sbjct: 422 AARAQLHQNYIVAQTEDGLVIVDQHAAHERLVFEEMRNALHSRRPPSQVLLIPEIIDLPE 481

Query: 468 GECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTY 527
            +C  +M+H      LG+  ERFGP A+A+RE PA+L + N+  L+R + DEI +     
Sbjct: 482 EDCDRLMDHAAGFDALGLVIERFGPGAVAVRETPAMLGEVNVQGLVRQLADEIAEWDAAS 541

Query: 528 TLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSD 587
           TL +++E + ATMAC+GS+RSGR+M+  EMN LLR+ME  P S QCNHGRPT+I+LKLSD
Sbjct: 542 TLANKLEYVAATMACHGSVRSGRRMRPEEMNALLRQMENTPGSGQCNHGRPTYIELKLSD 601

Query: 588 IEKLFGR 594
           IE+LFGR
Sbjct: 602 IERLFGR 608


>gi|49475080|ref|YP_033121.1| DNA mismatch repair protein [Bartonella henselae str. Houston-1]
 gi|81827745|sp|Q6G4R4|MUTL_BARHE RecName: Full=DNA mismatch repair protein mutL
 gi|49237885|emb|CAF27081.1| DNA mismatch repair protein mutL [Bartonella henselae str.
           Houston-1]
          Length = 612

 Score =  555 bits (1430), Expect = e-156,   Method: Composition-based stats.
 Identities = 272/612 (44%), Positives = 396/612 (64%), Gaps = 19/612 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  +KEL+EN++DAE++R+E V   GGK+F +++DNG
Sbjct: 1   MIIRHLSENIINQIAAGEVIERPANVVKELVENAIDAEATRIEIVTTNGGKNFIRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++++ +AV RHCTSKI+DD  NI   GFRGEALPSIG+V+ L L SR     + A+
Sbjct: 61  CGIPADQLTLAVSRHCTSKITDDVHNICFLGFRGEALPSIGSVAKLKLTSRTQNAESAAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ++  KI   +P A NPGTIVEVRDLFF  PARL F+K+++ ETN ITD+I+R+AIA+P
Sbjct: 121 IIVTAGKIVGPKPAAANPGTIVEVRDLFFVTPARLKFMKTDRAETNSITDMIKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGN-FPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ S       ++   + N     +RI+Q++G++F  N++ LN +   + L G+  +
Sbjct: 181 HIHFSLSGSDRTSLELPATANNTQGQLQRITQIMGKEFAPNSIVLNAERESVRLTGFACL 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNR N+   + ++NGR V+DKF+   IR AYA+ +   RYPV +L +++ P  VDVNV
Sbjct: 241 PSFNRSNSLHQFAYVNGRPVRDKFLWGAIRGAYADVMTRDRYPVSILFIDLPPADVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HP K+ +RFR+P  IR  I+ +I++A++  G+ ++S  S+ M+++F      KT    Y 
Sbjct: 301 HPTKADVRFRDPGFIRGLIVGAIREALHHTGVRSTSTRSEAMLAAFQTQKPLKTFKSTYK 360

Query: 360 TSLTNTQE-----------------KLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEAT 402
            S  + Q                   + L+E+     + L          N P   SE  
Sbjct: 361 PSSYSPQPYHVESASMVNKPLDIISPVGLKEDAPPLMEGLDIPSGDAYTPNTPAA-SEEC 419

Query: 403 HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEI 462
            Y LG A AQIH+NYII+QT D L+IVDQHAAHERL++E ++    S  + SQ LL PEI
Sbjct: 420 SYPLGAARAQIHKNYIIAQTQDSLIIVDQHAAHERLVYEALKNALYSKPLPSQLLLIPEI 479

Query: 463 IDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIID 522
           ++L E +   ++ H + L + G+  E FGP AI +RE P++L + N+  L++D+ DE  +
Sbjct: 480 VELSEEDATCLLTHKDALQKFGLGIEAFGPGAIVVRETPSLLGEINVEALIKDLADEAAE 539

Query: 523 SSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIK 582
             TT  L+  ++ + ATMAC+GSIRSGR +   EMN LLR++E  PN+  CNHGRPT+I+
Sbjct: 540 YDTTDNLKTMLDYVAATMACHGSIRSGRLLHPEEMNALLRQIEATPNTGTCNHGRPTYIE 599

Query: 583 LKLSDIEKLFGR 594
           LKL+DIE+LFGR
Sbjct: 600 LKLADIERLFGR 611


>gi|110835066|ref|YP_693925.1| DNA mismatch repair protein [Alcanivorax borkumensis SK2]
 gi|110648177|emb|CAL17653.1| DNA mismatch repair protein MutL [Alcanivorax borkumensis SK2]
          Length = 622

 Score =  555 bits (1429), Expect = e-156,   Method: Composition-based stats.
 Identities = 200/618 (32%), Positives = 333/618 (53%), Gaps = 25/618 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI+ L  ++ NQIAAGE++ERP+  +KEL+EN+LDA S  +   +  GG    ++ DNG 
Sbjct: 3   KIQLLDSRLANQIAAGEVVERPASVLKELLENALDAGSESISVDVEQGGVKLLRVRDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+A+ RH TSKI   DD   I T GFRGEAL +I +VS L+L S       G 
Sbjct: 63  GIERDDLPLALSRHATSKIRGLDDLEAIGTLGFRGEALAAISSVSRLSLASNVEGEPEGW 122

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           Q+ + G  ++    P     GT V +RDLFF  PAR  FL++E+ E N + +V RR+A++
Sbjct: 123 QVTVEGRDMAPSVSPAGHPRGTTVTMRDLFFNTPARRRFLRTEKTEFNHLEEVFRRIALS 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
               +F  +  +   +++     +     R++++ G+ FI  AV ++ + + + L G+ G
Sbjct: 183 EFNTAFRLTHNQKVIHQLPAGLDDTLRAARVAKLCGKGFIEQAVPVDVERDGLRLHGWMG 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y ++NGR ++DK +   +R AY++ +  GR+P  VL LE+DP  VDVN
Sbjct: 243 LPTFSRSQADLQYFYVNGRVIRDKVVSHAVRQAYSDVLYHGRHPAYVLFLELDPAMVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINK--------------------KGISTSSVLS 338
           VHP K  +RFR   ++  F+  S+ + I                         + +    
Sbjct: 303 VHPTKHEVRFREQRMVHGFLYSSLHRVIAGVRPGQELAGSVADEGGPAAGMDAAMAPSQG 362

Query: 339 KKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE 398
              ++S        +H P  A   T      + Q  R +                  +  
Sbjct: 363 NMSLTSPTGSGGSLSHPPGQAYPSTGGGVFGYGQGARQADAYGALVRGHVGESAPAVMPP 422

Query: 399 SEATHYQL--GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQT 456
           +         G A AQ+H  +I+++   G+V+VD HAAHER+ +E+++Q +   K+ SQ 
Sbjct: 423 ANENETVPPLGYAVAQLHGIFILAENEQGMVVVDMHAAHERITYERLKQSWAEDKVRSQP 482

Query: 457 LLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDI 516
           LL P  + +   E     +  E   RLG   +R GP  + +RE+PA+L   +   ++RD+
Sbjct: 483 LLVPVSLAVSSREADFAEQQPEVFSRLGFVVQRAGPETLVVREVPALLRNGDSESMVRDV 542

Query: 517 IDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHG 576
           + +++   ++  +  +++ +L+TMAC+GS+R+ R++   EMN LLR+ME    S QCNHG
Sbjct: 543 LSDLLAEGSSERIAQKLDELLSTMACHGSVRANRRLTIAEMNALLRDMEATERSGQCNHG 602

Query: 577 RPTFIKLKLSDIEKLFGR 594
           RPT+ ++ + D+++LF R
Sbjct: 603 RPTWTQMSIKDLDRLFMR 620


>gi|91978493|ref|YP_571152.1| DNA mismatch repair protein [Rhodopseudomonas palustris BisB5]
 gi|123166645|sp|Q131I8|MUTL_RHOPS RecName: Full=DNA mismatch repair protein mutL
 gi|91684949|gb|ABE41251.1| DNA mismatch repair protein MutL [Rhodopseudomonas palustris BisB5]
          Length = 597

 Score =  555 bits (1429), Expect = e-155,   Method: Composition-based stats.
 Identities = 235/596 (39%), Positives = 361/596 (60%), Gaps = 2/596 (0%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E I+N+IAAGE++ERP+  +KEL+EN++DA + RV+    GGG+    I D+G
Sbjct: 1   MPVRQLPETIVNRIAAGEVVERPASVVKELVENAIDAGACRVDVFSDGGGRRKIVIADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT  ++ +AV RH TSK+ D D   I T GFRGEALPSIGAV+ L+L +R        
Sbjct: 61  GGMTQADLALAVDRHATSKLDDEDLLAIRTLGFRGEALPSIGAVARLSLTTRHAAEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            +++ G   S + P A++ GT VEV DLFF  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 TLSVEGGAKSPISPAALSQGTRVEVADLFFATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           P ++FT +  +                  R+  ++G DF  NA+E+  +   + ++G+  
Sbjct: 181 PDIAFTLAGEERAPVTWAAALPGAPGRLTRLGDILGADFRANAIEVGSEREGVAVEGFAA 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P+  R NA   Y+F+NGR V+DK IL  +R AYA+ +P  R+PVV L + +D R+VD N
Sbjct: 241 SPSLTRANALGQYLFVNGRPVRDKLILGAVRAAYADYLPRDRHPVVALFVTLDSREVDAN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHPAK+ +RFRN  ++R  I+ ++++ + ++G  T++  +   IS+F   + P  +    
Sbjct: 301 VHPAKTEVRFRNAGLVRALIVHALKEGLAREGRRTAANSAGAAISNFRPASMPPGNWDWR 360

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYI 418
           ++             +               ++        E     LG A  QIH+ YI
Sbjct: 361 SSPSYPVGGGSSAAPSFGERPQAAFDVGGPSADIRPHEAAPELLDRPLGAARTQIHETYI 420

Query: 419 ISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDE 478
           +SQT DGL++VDQHAAHER+++E+++   ++  +  Q LL P+I+++ E     ++   E
Sbjct: 421 VSQTRDGLIVVDQHAAHERIVYERLKASLDANGVQRQILLIPDIVEMDEATVERLVARAE 480

Query: 479 DLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILA 538
           +L + G+  E FGP A+A+RE P++L K N   LLRD+ + + +      L+ R+ ++ A
Sbjct: 481 ELSKFGLVVESFGPGAVAVRETPSLLGKVNAASLLRDLAEHMAEWDEALPLERRLMHVAA 540

Query: 539 TMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           TMAC+GS+R+GR ++  EMN LLREME  PNS QCNHGRPT+++L L+DIEKLFGR
Sbjct: 541 TMACHGSVRAGRVLKPEEMNALLREMEATPNSGQCNHGRPTYVELTLADIEKLFGR 596


>gi|126736240|ref|ZP_01751983.1| DNA mismatch repair protein [Roseobacter sp. CCS2]
 gi|126714406|gb|EBA11274.1| DNA mismatch repair protein [Roseobacter sp. CCS2]
          Length = 603

 Score =  555 bits (1429), Expect = e-155,   Method: Composition-based stats.
 Identities = 256/599 (42%), Positives = 380/599 (63%), Gaps = 17/599 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+ENS+DA ++R+E VIA GGK+  ++TD+G G
Sbjct: 14  IRQLDDAAINRIAAGEVLERPASAVKELVENSIDAGATRIEVVIADGGKTLIRVTDDGCG 73

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT  ++PMA+ RH TSKI   D  NI +FGFRGEALPS+GA   L + SR       A I
Sbjct: 74  MTPSDLPMAMLRHATSKIDGSDLLNIQSFGFRGEALPSLGATGRLKITSRAKNAE-AAMI 132

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           A++G +   V+P A++ GT++E+RD+F+  PARL FL++++ E   +TDV++R+A+A P 
Sbjct: 133 AVAGGQAEGVKPAALSAGTVIELRDMFYATPARLKFLRTDRAEAQAVTDVVKRLAMAEPF 192

Query: 182 VSFTFSTI--KSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQG 235
           V+F         NR      +  G+  +    R+  V+G+DF  NA+ ++ +     L G
Sbjct: 193 VTFILRDASKGDNRTVFRADAETGDLFDALHGRLRAVLGKDFAENALRIDTEREGFHLTG 252

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y  +PT++RG A   ++F+NGR V+DK +L  +R AY + +   R+PV  L ++ DP  V
Sbjct: 253 YAALPTYSRGAAVAQFLFVNGRPVRDKMLLGALRAAYMDVLSRDRHPVAALFVDCDPTLV 312

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL 355
           DVNVHPAKS +RFR+P  +R  I+  ++ A+   G   S+ ++   + +           
Sbjct: 313 DVNVHPAKSEVRFRDPGTVRGLIVSGLRHALADAGHRASTTVANATLGAI---------T 363

Query: 356 PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQ 415
           P+         ++       ++     P      S   +P+ E +     LG A AQ+H+
Sbjct: 364 PERTEPRVYQMDRPSFSARSMTFQAQAPGFGEMPSARFEPMVEDDPDDLPLGAARAQVHE 423

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           NYII+QT +G+VIVDQHAAHERL++EK++       + +Q LL PEI++L E E A + +
Sbjct: 424 NYIIAQTENGIVIVDQHAAHERLVYEKLKAQMAENGVAAQALLIPEIVELSENEAAQLRD 483

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
             +DL + G+  E FG  AIA+RE PAIL + N   ++RDI+DE+ D   + ++Q RIE 
Sbjct: 484 IADDLAKFGLTIEPFGGGAIAVRETPAILGEVNAEAMIRDILDELADQGDSASVQARIEA 543

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           IL+ +AC+GSIRSGR+MQ+ EMN LLREME  P S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 544 ILSRVACHGSIRSGRRMQAAEMNALLREMEATPLSGQCNHGRPTYVELKLADIERLFGR 602


>gi|254486044|ref|ZP_05099249.1| DNA mismatch repair protein MutL [Roseobacter sp. GAI101]
 gi|214042913|gb|EEB83551.1| DNA mismatch repair protein MutL [Roseobacter sp. GAI101]
          Length = 613

 Score =  555 bits (1429), Expect = e-155,   Method: Composition-based stats.
 Identities = 255/600 (42%), Positives = 378/600 (63%), Gaps = 10/600 (1%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA + ++    A GGK+  ++TD+G G
Sbjct: 15  IRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGARQITVEYADGGKTLIRVTDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           + + ++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR    + GA+I
Sbjct: 75  IPAVDLPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLTITSRVAGQD-GAEI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            ++G +   VRP A+N GT+V +RDLFF  PARL FL++++ E   I D+I+R+A+A P 
Sbjct: 134 TVNGGQTGPVRPAALNGGTVVTLRDLFFATPARLKFLRTDRAEAQAIADIIKRLAMAEPF 193

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGN----FPERISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT    S     R     ++  G+       R++QV+G +F +N++ ++ +   + L 
Sbjct: 194 VRFTLRDVSGDGQGRDVFRAEAEQGDMFAALHGRLAQVLGREFADNSLPIDAEREGLHLT 253

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           G+  +PT++RG A   Y+F+NGR V+DK ++  +R AY + +   R+P   L L+  P  
Sbjct: 254 GFAALPTYSRGTAVAQYLFVNGRPVRDKLLVGALRGAYFDLLSRDRHPAAALFLDCAPTL 313

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR+P + R  I+  ++ A+   G   S+ ++   + +   +      
Sbjct: 314 VDVNVHPAKSEVRFRDPGLARGLIVSGLRHALADAGHRASTTVADATLGAMRPEQTGARV 373

Query: 355 LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIH 414
                 SL         Q    +    +     T +      E  E   Y LG A  Q+H
Sbjct: 374 YQMDRPSLGARTAAYQAQSPGFAETAGMWGRVETPAAPVTE-EPQETPDYPLGTARGQVH 432

Query: 415 QNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIM 474
           +NYII+QT  G+VIVDQHAAHERL++EK+++      + +Q LL PEI+DL   +CA ++
Sbjct: 433 ENYIIAQTATGMVIVDQHAAHERLVYEKLKRQMAENGVAAQALLIPEIVDLSASDCARLL 492

Query: 475 EHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIE 534
           +  ++L RLG+  E FG +AIA+RE PAIL   N   ++ D++DE+ D + + T+Q RIE
Sbjct: 493 DVADELTRLGLTIEAFGGSAIAVRETPAILGTVNAKAMILDVLDELADQNESNTVQARIE 552

Query: 535 NILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            IL+ +AC+GSIRSGR M+  EMN LLREME  P+S QCNHGRPT+++LKLSDIE+LFGR
Sbjct: 553 AILSRVACHGSIRSGRWMRGEEMNALLREMEATPHSGQCNHGRPTYVELKLSDIERLFGR 612


>gi|319408063|emb|CBI81717.1| DNA mismatch repair protein MutL [Bartonella schoenbuchensis R1]
          Length = 615

 Score =  554 bits (1427), Expect = e-155,   Method: Composition-based stats.
 Identities = 267/614 (43%), Positives = 391/614 (63%), Gaps = 20/614 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  +KEL+EN++DA ++R+E V A GGK+  +++DNG
Sbjct: 1   MIIRHLSETIINQIAAGEVIERPANVVKELVENAIDAGATRIEIVTANGGKNLIRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+  +++ +A+ RHCTSK+ DD  NI   GFRGEALPSIG+V+ L L+SR    ++ A+
Sbjct: 61  CGIPKDQLTLAISRHCTSKLVDDVHNICFLGFRGEALPSIGSVAKLKLVSRTQDADSAAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ++  KI   +P A N GT VEVRDLFF  PARL F+K++  E N ITD+I+R+AIA+P
Sbjct: 121 IIVTAGKIEGPKPAAANSGTTVEVRDLFFVTPARLKFMKTDSAEMNAITDMIKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGN-FPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ S       ++     N     ERI+Q++G++F +N + LN +     L G+  +
Sbjct: 181 HIRFSLSGKDRTLIELPATENNTQGQLERITQIMGKEFGSNTITLNAERETARLTGFACL 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNRGN+   +V++NGR V+DKF+   IR AY + +   R+ V +L +++ P  VDVNV
Sbjct: 241 PSFNRGNSLHQFVYVNGRPVRDKFLSGAIRGAYTDVMAPNRHAVSILFIDLPPADVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKT-HLPKY 358
           HPAK+ +RFR+P +IR  II +I +A+ + GI  SS  SK M+++F + ++ KT   P  
Sbjct: 301 HPAKADVRFRDPGLIRGLIIGAIHEALRQTGIRPSSTGSKAMLAAFQRQSSFKTFRSPSP 360

Query: 359 ATSLTNTQEKLFLQENRLS------------------TNDLLPSDDPTYSEDNDPVEESE 400
               + + +  ++     S                  T  +   + P+          SE
Sbjct: 361 HQPFSYSPQPQYVAPGTTSADHKPVDIPDFSGLREDITPMIEYVNTPSSDVGFVNTSTSE 420

Query: 401 ATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTP 460
             +Y LG A AQIH+NYI++QT + L+IVDQHAAHERL++E ++    S  + SQ LL P
Sbjct: 421 ELYYPLGAAKAQIHKNYIVAQTKNSLIIVDQHAAHERLVYEALKNALYSKPLPSQLLLIP 480

Query: 461 EIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEI 520
           EI++L E + A ++ H + L + G+  E FG  AI +RE P +L + N   L++D++DE 
Sbjct: 481 EIVELSEEDAACLLVHKDVLQKFGLGIEAFGSGAIVVRETPTMLGEINAQALIKDLVDEA 540

Query: 521 IDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTF 580
            +  TT  L+  + ++ ATMAC+ SIRSGR +   EMN LLR+ME  PNSS CNHGRPT+
Sbjct: 541 SEYDTTDNLKAMLNHVAATMACHSSIRSGRLLHPKEMNALLRQMEATPNSSTCNHGRPTY 600

Query: 581 IKLKLSDIEKLFGR 594
           I+LKL+DIE+LFGR
Sbjct: 601 IELKLADIERLFGR 614


>gi|126463518|ref|YP_001044632.1| DNA mismatch repair protein [Rhodobacter sphaeroides ATCC 17029]
 gi|126105182|gb|ABN77860.1| DNA mismatch repair protein MutL [Rhodobacter sphaeroides ATCC
           17029]
          Length = 616

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 257/602 (42%), Positives = 380/602 (63%), Gaps = 11/602 (1%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+EN+LDA + R+   IA GGK+  ++TD+G G
Sbjct: 15  IRQLDEAAINRIAAGEVVERPASAVKELVENALDAGARRIAVDIACGGKTLIRVTDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT+E++P+A+ RH TSKI   D  +I +FGFRGEALPS+ AV  LT+ SR  +   GAQI
Sbjct: 75  MTAEDLPLALSRHATSKIDGSDLLDIRSFGFRGEALPSLAAVGRLTITSRVTEGE-GAQI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           A+S  +I  VRP A+  GT+VE+RDLFF  PARL FL++++ ET  I +V+RR+A+A P+
Sbjct: 134 AVSAGRIEPVRPAALGAGTVVELRDLFFATPARLKFLRTDRAETQAIAEVVRRLALAEPE 193

Query: 182 VSFTFSTI--KSNRYKMNFQSTNGNF----PERISQVIGEDFINNAVELNEKSNEITLQG 235
           V FT +       R     ++  G+       R+++V+G +F  NA+ ++     + LQG
Sbjct: 194 VGFTLTYHSAGEPRLLFRAEAEGGDLFDALHRRVARVVGAEFAENALRIDVAREGLRLQG 253

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y  +PT++RG+    ++F+NGR V D+ +L  +R  Y + +   RYP  VL L  DP++V
Sbjct: 254 YAALPTYSRGSGVAQFLFVNGRPVLDRMLLGALRAGYMDVLSRDRYPAAVLNLICDPQRV 313

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL 355
           DVNVHPAK+ +RFR    +R  I+ ++++A+   G   S+ ++ + + +F  +       
Sbjct: 314 DVNVHPAKAEVRFREAGEVRGLIVTALRQALAGAGHRASTTVAGETLEAFRPEMPAAASP 373

Query: 356 PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE---SEATHYQLGIACAQ 412
                     +          +     P+           VE     EA    LG A AQ
Sbjct: 374 APATRIYQMDRPSAAAVARSFAFQAPEPAMPGLAEAPAARVEAPVAEEAHDRPLGAARAQ 433

Query: 413 IHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECAL 472
           IH N+I++QT  GLVIVDQHAAHERL++EK+++  + T I  Q LL PEI++L   + A 
Sbjct: 434 IHGNWILAQTASGLVIVDQHAAHERLVYEKLKRQRDETGIARQALLIPEIVELSPTDAAR 493

Query: 473 IMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDR 532
           ++E  ++L   G+  E FG  A+A+RE+PAIL K     LLRDI+D++ D  ++  LQ R
Sbjct: 494 LLEAADELASAGLVIEPFGGGAVAVREVPAILGKVEAAPLLRDILDDLADLGSSDRLQAR 553

Query: 533 IENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLF 592
           ++ +L+ MAC+GS+RSGR +++ EMN LLREME  P S QCNHGRPT+++LKL+DIE+LF
Sbjct: 554 MDAVLSRMACHGSVRSGRALRAEEMNALLREMEATPLSGQCNHGRPTYVELKLADIERLF 613

Query: 593 GR 594
           GR
Sbjct: 614 GR 615


>gi|190575209|ref|YP_001973054.1| DNA mismatch repair protein [Stenotrophomonas maltophilia K279a]
 gi|190013131|emb|CAQ46763.1| putative DNA mismatch repair protein [Stenotrophomonas maltophilia
           K279a]
          Length = 634

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 216/627 (34%), Positives = 339/627 (54%), Gaps = 36/627 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            IR L E +INQIAAGE++ERP+  +KEL+EN++DA +SRV+  +  GG    +I DNG 
Sbjct: 8   PIRPLPEILINQIAAGEVVERPASVVKELVENAIDAGASRVDIDLEEGGVRLIRIRDNGS 67

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  E++P+AV RH TSKI+D  D  ++ T GFRGEALPSI +VS  TL SR   +  G+
Sbjct: 68  GIAPEQLPLAVSRHATSKIADLDDLESVATLGFRGEALPSIASVSRFTLSSRRAHDEHGS 127

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + I G KI  V P A  PGT VEVR+LF+ +PAR  FL++E+ E   I + +R +A+A 
Sbjct: 128 ALQIEGGKIGEVTPRAHAPGTTVEVRELFYNVPARRKFLRAERTELGHIEEWLRSLALAR 187

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V    S       +        +    +++ +GEDF N AV ++     + L G+   
Sbjct: 188 PDVELRVSHNGKASRRYKPGDLYSDAR--LAETLGEDFANQAVRVDHSGAGLRLHGWIAQ 245

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P ++R +A+Q Y+++NGR+V+D+ +   ++ AY + +  GR P  VL LE+DP +VDVNV
Sbjct: 246 PHYSRASADQQYLYVNGRSVRDRSVAHAVKMAYGDVLYHGRQPAYVLFLELDPTRVDVNV 305

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMIS---------------- 343
           HPAK  +RFR+  ++ +F+ ++++ A+       S+                        
Sbjct: 306 HPAKHEVRFRDSRLVHDFVYRTLKDALADTRAGMSAQEIGAGPVHPVDAAAAPMASSAGA 365

Query: 344 -----SFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE 398
                +        +       S    Q+ L LQ              P  +E    +  
Sbjct: 366 SGFGLARGPAPGAGSGGGGGGFSGWRPQQPLGLQVADAPAAYAALYAAPAGAERGAALPP 425

Query: 399 SEATH-----------YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDF 447
             A +             LG A AQ+H  YI+++  +GL++VD HAAHER+ +E+++   
Sbjct: 426 MPAENGLPVTSADAGVPPLGYAIAQLHGIYILAENAEGLIVVDMHAAHERIGYERLKNAH 485

Query: 448 NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKK 507
           +   + SQ LL P  + + E E        E L  LG +  R GP ++ +R IPA+L+  
Sbjct: 486 DGIGLQSQPLLVPITLAVGEREADTAESEAETLAALGFEVTRAGPGSLHVRSIPALLAHA 545

Query: 508 NIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKN 567
               LLRD++ ++ +   +  +    + +L+TMAC+G++R+ R++   EMN LLR+ME  
Sbjct: 546 EPEGLLRDVLTDLREHGQSRRVASARDELLSTMACHGAVRANRRLTVPEMNALLRDMEIT 605

Query: 568 PNSSQCNHGRPTFIKLKLSDIEKLFGR 594
             S QCNHGRPT+ +  L++I++ F R
Sbjct: 606 ERSGQCNHGRPTWARFSLAEIDRWFLR 632


>gi|302383491|ref|YP_003819314.1| DNA mismatch repair protein MutL [Brevundimonas subvibrioides ATCC
           15264]
 gi|302194119|gb|ADL01691.1| DNA mismatch repair protein MutL [Brevundimonas subvibrioides ATCC
           15264]
          Length = 617

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 236/616 (38%), Positives = 360/616 (58%), Gaps = 22/616 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L  + +N+IAAGE++ERP+ AIKEL+EN+LDA ++R+E    GGG S   I D+G
Sbjct: 1   MPIRRLPPETVNRIAAGEVVERPASAIKELVENALDAGATRIEVQADGGGLSRILIADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD------FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQ 114
            GM  +++ +AV+RH TSK+  D         I T GFRGEALPSIG+V+ LT+ SR P 
Sbjct: 61  HGMAPDQLALAVERHATSKLEPDDAGDVDLLRISTLGFRGEALPSIGSVARLTITSRSPG 120

Query: 115 NNTGAQIAIS-GEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIR 173
            +          ++  +        G  VEVRDLF+  PARL F+KSE+ E   I++ I+
Sbjct: 121 GDAHQITVEGGDQRPVAPAGFPGPHGARVEVRDLFYATPARLKFMKSERSEAMAISEEIK 180

Query: 174 RMAIAYPKVSFTFSTIKSNRYKMNF-QSTNGNFPERISQVIGEDFINNAVELNEKSNEIT 232
           R A+A+  V+FT         ++      +    +R++ ++G DF  NA+ +++    I 
Sbjct: 181 RQAMAHEGVAFTLDLDGRTTLRLPAEHPGDEGRLKRLAALLGRDFEANALLIDQSREGIR 240

Query: 233 LQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDP 292
           L GY G+PT++RGN    Y+F+NGR V+D+ +   +R AYA+ +   R+P  VL LEIDP
Sbjct: 241 LSGYAGLPTYSRGNGGHQYLFVNGRPVRDRLLQGALRGAYADFLARDRHPAAVLFLEIDP 300

Query: 293 RQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPK 352
             VDVNVHPAK+ +RFR+P ++R  I+ +++ A++  G   S+ ++  +++ F       
Sbjct: 301 LFVDVNVHPAKAEVRFRDPALVRGLIVGALRHALHAAGHRASTTVADSVLAGFTAHTGAA 360

Query: 353 THLPKYATS--------------LTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE 398
                  +                    + +     R +  +  P     + E +     
Sbjct: 361 FSPSSQTSQGFAGGFSGWTGWDRPVAANQDIPGLSERSARVEAPPPGFTGWPEQSGAANT 420

Query: 399 SEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLL 458
           S+     LG A AQ+H  YI++QT DGLV+VDQHAAHERL++E+M+       +T Q LL
Sbjct: 421 SDPIDQPLGAARAQVHGTYIVAQTRDGLVVVDQHAAHERLVYERMKVQMAQGSVTRQALL 480

Query: 459 TPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIID 518
           TPE+++L   E   ++   ++L  LG+  E FG  A+ +RE PA+L   ++  L+RDI D
Sbjct: 481 TPEVVELDPAEADRVLARADELAELGLIVEPFGGGAVLVRETPALLGDTDVQGLIRDIAD 540

Query: 519 EIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRP 578
           ++ +      L +R+  +  TMAC+GS+R+GR + + EMN LLR+ME  P+S QCNHGRP
Sbjct: 541 DLAEHGAALALSERLGEVCGTMACHGSVRAGRVLSAPEMNALLRQMEATPHSGQCNHGRP 600

Query: 579 TFIKLKLSDIEKLFGR 594
           T+++LKL D+EKLFGR
Sbjct: 601 TYVELKLHDLEKLFGR 616


>gi|75676732|ref|YP_319153.1| DNA mismatch repair protein [Nitrobacter winogradskyi Nb-255]
 gi|123745646|sp|Q3SPJ0|MUTL_NITWN RecName: Full=DNA mismatch repair protein mutL
 gi|74421602|gb|ABA05801.1| DNA mismatch repair protein MutL [Nitrobacter winogradskyi Nb-255]
          Length = 603

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 230/602 (38%), Positives = 359/602 (59%), Gaps = 8/602 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E ++N+IAAGE++ERP+  +KEL+EN++DA ++R++    GGG+    +TD+G
Sbjct: 1   MPVRQLPETVVNRIAAGEVVERPASVVKELVENAIDAGATRIDVFTDGGGRRRIGVTDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM   ++ +AV RH TSK+ D D   I T GFRGEALPSIGAV+ L + +R  +     
Sbjct: 61  AGMAKGDLALAVDRHATSKLDDEDLLGIRTLGFRGEALPSIGAVARLCITTREAREPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + + G + S + P A+  GT VEV DLF+  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 SLTVEGGRKSEIIPAALTNGTRVEVGDLFYATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKS-NRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           P + FT +  +                  R+  ++G DF   A+ +  +   + ++G+  
Sbjct: 181 PDIGFTLAGEERAPVTWTAALPGAAGRLTRLGDILGGDFRAAAIPVRAEREGVIVEGFAA 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P+  R NA   Y+F+NGR V+DK IL  +R AY++ +P  R+PV  L +  DPR+VD N
Sbjct: 241 APSLTRANALGQYLFVNGRPVRDKLILGAVRAAYSDYLPRDRHPVAALFVTADPREVDAN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHPAK+ +RFRN  ++R  I+ ++++ + ++G  T++     ++++F    +P+     +
Sbjct: 301 VHPAKTEVRFRNAGLVRALIVHALKEGLAREGRRTAANRDGAVLTAFRPAPSPRPANWDW 360

Query: 359 ATSLTNTQEK------LFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQ 412
             S     +               +    L    P+     D     +     LG A  Q
Sbjct: 361 RESPAAPADARPWIGGPPAAAFAEAGQAALDVGAPSADVRFDAHPPLDLVDRPLGAARTQ 420

Query: 413 IHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECAL 472
           IH+ YI+SQT DGL++VDQHAAHER+++E+++       +  Q LL P+I++L E     
Sbjct: 421 IHETYIVSQTRDGLIVVDQHAAHERIVYERLKTALARDGVQRQILLIPDIVELDEATVEK 480

Query: 473 IMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDR 532
           +++   +L + G+  E FGP A+A+RE P++L K N   LLRD+ + + +   T  L+ R
Sbjct: 481 LIDRATELEKFGLAIESFGPGAVAVRETPSLLGKINAAALLRDLAEHMTEWEETLPLERR 540

Query: 533 IENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLF 592
           + ++ ATMAC+GS+R+GR ++  EMN LLREME  PNS QCNHGRPT+++LKL DIEKLF
Sbjct: 541 LMHVAATMACHGSVRAGRILKPEEMNALLREMEATPNSGQCNHGRPTYVELKLDDIEKLF 600

Query: 593 GR 594
           GR
Sbjct: 601 GR 602


>gi|114331804|ref|YP_748026.1| DNA mismatch repair protein MutL [Nitrosomonas eutropha C91]
 gi|114308818|gb|ABI60061.1| DNA mismatch repair protein MutL [Nitrosomonas eutropha C91]
          Length = 608

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 215/610 (35%), Positives = 332/610 (54%), Gaps = 20/610 (3%)

Query: 1   MK-IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDN 59
           M+ I+ L + +I+QIAAGE+IERP+  +KEL+ENS+DA ++ +   IA GG    ++TDN
Sbjct: 1   MRAIKLLPDGLISQIAAGEVIERPASVLKELLENSIDAGATEITVNIAQGGLKLIRVTDN 60

Query: 60  GFGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNT 117
           G G+ +EE+P+A+ RH TSKI+  +D  +I + GFRGE L SI +VS+L+L+S  P    
Sbjct: 61  GSGIPAEELPLALTRHATSKIASQEDLHSITSLGFRGEGLASIASVSYLSLISHQPAGKH 120

Query: 118 GAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
             +I   G ++ S  P +   GT VEVRDLFF +PAR  FLK+E  E     +V RRMA+
Sbjct: 121 AWEIRSEGTRLMSPEPSSHMAGTTVEVRDLFFNLPARRKFLKTEATEFAHCEEVFRRMAL 180

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           ++  ++FT     +    +          ERI  V+GE+F   A  ++E+S  I LQG  
Sbjct: 181 SHADITFTLRHNGN----LRSHWQAAEAAERIGAVLGEEFSGAATWMDEQSAGIGLQGML 236

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
            +P ++R   +  Y F+NGR ++DK I   +R AY + + L R+   VL L IDP QVDV
Sbjct: 237 ALPAYSRATRDMQYFFVNGRFIRDKLITHALREAYRDVLHLDRHAAFVLYLAIDPEQVDV 296

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAIN--KKGISTSSVLSKKMISSFHQDNAPKTHL 355
           NVHP K+ +RFR    I  FI   + KA+   + G+++SS +      +      P    
Sbjct: 297 NVHPTKTEVRFREARAIHQFIYHGVSKALALPRSGVASSSPVGAVWPGAQDASVDPTRTG 356

Query: 356 PKYATSLTNTQEKLFLQENRLSTN-----------DLLPSDDPTYSEDNDPVEESEATHY 404
              A    N   +  L   R++                 +      +  +   +      
Sbjct: 357 FTPAVPTLNYPRQARLPSERVAQPFNFYQVLTGGESGATAMQNQLRQTGEGESDENPAMP 416

Query: 405 QLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIID 464
            LG A   +   YI++Q   GLVIVD HAAHER+++E+++   +   +++Q LL P    
Sbjct: 417 PLGFALGLLRGIYILAQNQKGLVIVDMHAAHERIVYEQLKTQLDQQVLSAQRLLIPVTFH 476

Query: 465 LLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSS 524
               + A + E+   L +L  +        + IR +P  L   +  +L+R ++DEI +  
Sbjct: 477 ADSLDIATVEENQALLQQLCFEVSTLSATTLVIRTVPTTLQHADAEKLVRALLDEIRNGD 536

Query: 525 TTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLK 584
               L  R   +LATMAC+G++R+ R++  IEMN LLR+ME    S QCNHGRPT+ ++ 
Sbjct: 537 PAQLLAARRNELLATMACHGAVRANRQLTLIEMNELLRKMEVTERSDQCNHGRPTWFEIS 596

Query: 585 LSDIEKLFGR 594
           L++++K+F R
Sbjct: 597 LAELDKMFMR 606


>gi|309781394|ref|ZP_07676130.1| DNA mismatch repair protein MutL [Ralstonia sp. 5_7_47FAA]
 gi|308919807|gb|EFP65468.1| DNA mismatch repair protein MutL [Ralstonia sp. 5_7_47FAA]
          Length = 647

 Score =  553 bits (1424), Expect = e-155,   Method: Composition-based stats.
 Identities = 201/631 (31%), Positives = 329/631 (52%), Gaps = 45/631 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            IR L +++I+QIAAGE++ERP+  +KEL+EN+LDA +++++  +  GG     ITDNG 
Sbjct: 22  PIRPLPDQLISQIAAGEVVERPASVVKELLENALDAGATQIQIKLEEGGVRRIAITDNGV 81

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++E+P+A+ RH TSKI   ++  ++ T GFRGEAL SI +V+ LTL SR   +    
Sbjct: 82  GIPADELPVALMRHATSKIGSLEELESVATLGFRGEALASIASVAELTLTSRTANDAHAT 141

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI     +    +P +   GT V+V+ L+F  PAR  FLK+EQ E     +VIRR A+A 
Sbjct: 142 QI---IAQTGRAQPASGGVGTTVDVQHLYFNTPARRKFLKTEQTELGHCMEVIRRTALAR 198

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V+ +           N    +     R + V+G +F    +   E + E+ L G+ G+
Sbjct: 199 PDVAISVHHNGKPLEHWNATQADS----RSAAVLGTEFARARLPFEESAGELRLFGFAGL 254

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT +RG A+  + ++NGR V+D+ +   +R+AY + +   R+P  VL LE+ P  VDVNV
Sbjct: 255 PTASRGRADHQFFYVNGRFVRDRLLTHAVRSAYEDVLHGDRFPAYVLCLELPPEAVDVNV 314

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLP--- 356
           HP+K  +RFR+   +  F+  ++Q+A+++        L   + ++           P   
Sbjct: 315 HPSKIEVRFRDSRAVHQFVYHAVQRALSRHAGEQGDSLRTDIAAAPEVAGVTTAPSPADN 374

Query: 357 --KYATSLTNTQEKLFLQENRLST-----NDLLPSDDPTYSEDNDPVEESEATH------ 403
             ++   +   Q  L + + R         D  P      +   D    +          
Sbjct: 375 TTRWINQMAARQTSLGIAQPRAEYLSMMRGDSTPMPAMRPAWMTDVPSAATLFDGGTATA 434

Query: 404 --------------------YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKM 443
                               + LG A AQ+H  Y+++Q T G+V+VD HAAHER+++E++
Sbjct: 435 QAPAAVAEPVAAPPADDDDAHPLGFAVAQLHGIYVLAQNTRGMVLVDMHAAHERILYEQL 494

Query: 444 RQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAI 503
           +    + ++  Q LL P        E     E  + L  LG       P  +A+R +P +
Sbjct: 495 KTALETKRVEVQPLLIPVTFAASPVEIGTAEEFRDTLTLLGFDISAVSPTTLAVRSVPTL 554

Query: 504 LSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLRE 563
           L K +   L RD++ ++     +  L +R   +LAT+AC+ ++R+ R++   EMN LLR 
Sbjct: 555 LQKADAQALARDVLRDLHAYGGSRVLAERQNELLATLACHSAVRANRRLNLDEMNALLRR 614

Query: 564 MEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ME    + QCNHGRPT+I+L ++D+++LF R
Sbjct: 615 MEATERADQCNHGRPTWIQLTVADLDRLFLR 645


>gi|77464678|ref|YP_354182.1| DNA mismatch repair protein [Rhodobacter sphaeroides 2.4.1]
 gi|77389096|gb|ABA80281.1| DNA mismatch repair protein MutL [Rhodobacter sphaeroides 2.4.1]
          Length = 632

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 256/602 (42%), Positives = 382/602 (63%), Gaps = 11/602 (1%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+EN+LDA + R+   IA GGK+  ++TD+G G
Sbjct: 31  IRQLDEAAINRIAAGEVVERPASAVKELVENALDAGARRIAVDIACGGKALIRVTDDGCG 90

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT++++P+A+ RH TSKI   D  +I +FGFRGEALPS+ AV  LT+ SR  +   GAQI
Sbjct: 91  MTADDLPLALSRHATSKIDGSDLLDIRSFGFRGEALPSLAAVGRLTITSRVAEAE-GAQI 149

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           A+S  +I  VRP A+  GT+VE+RDLFF  PARL FL++++ ET  I +V+RR+A+A P+
Sbjct: 150 AVSAGRIEPVRPAALGAGTVVELRDLFFATPARLKFLRTDRAETQAIAEVVRRLALAEPE 209

Query: 182 VSFTFSTI--KSNRYKMNFQSTNGNF----PERISQVIGEDFINNAVELNEKSNEITLQG 235
           V FT +       R     ++  G+       R+++V+G +F  NA+ ++     + LQG
Sbjct: 210 VGFTLTDHSAGEPRLLFRAEAEGGDLFDALHRRVARVVGAEFAENALRIDVAREGLRLQG 269

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y  +PT++RG+    ++F+NGR V D+ +L  +R  Y + +   RYP  VL L  DP++V
Sbjct: 270 YAALPTYSRGSGVAQFLFVNGRPVLDRMLLGALRAGYMDVLSRDRYPAAVLNLICDPQRV 329

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL 355
           DVNVHPAK+ +RFR    +R  I+ ++++A+   G   S+ ++ + + +F  +       
Sbjct: 330 DVNVHPAKAEVRFREAGEVRGLIVTALRQALAGAGHRASTTVAGETLEAFRPERPAAAGP 389

Query: 356 PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE---SEATHYQLGIACAQ 412
              +      +  +       +     P+           VE     EA    LG A AQ
Sbjct: 390 GPASRIYQMDRPSVAAVARSFAFQAPEPAMPGLAEAPAARVEAPAAEEAHDRPLGAARAQ 449

Query: 413 IHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECAL 472
           IH N+I++QT  GLVIVDQHAAHERL++EK+++  + T I  Q LL PEI++L   + A 
Sbjct: 450 IHGNWILAQTESGLVIVDQHAAHERLVYEKLKRQRDETGIARQALLIPEIVELSPTDAAR 509

Query: 473 IMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDR 532
           ++E  ++L   G+  E FG  A+A+RE+PAIL K     LLRDI+D++ D  ++  LQ R
Sbjct: 510 LLEAADELASAGLVIEPFGGGAVAVREVPAILGKVEAAPLLRDILDDLADLGSSDRLQAR 569

Query: 533 IENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLF 592
           ++ +L+ MAC+GS+RSGR +++ EMN LLREME  P S QCNHGRPT+++LKL+DIE+LF
Sbjct: 570 MDAVLSRMACHGSVRSGRALRAEEMNPLLREMEATPLSGQCNHGRPTYVELKLADIERLF 629

Query: 593 GR 594
           GR
Sbjct: 630 GR 631


>gi|87122647|ref|ZP_01078524.1| DNA mismatch repair protein [Marinomonas sp. MED121]
 gi|86162105|gb|EAQ63393.1| DNA mismatch repair protein [Marinomonas sp. MED121]
          Length = 637

 Score =  552 bits (1422), Expect = e-155,   Method: Composition-based stats.
 Identities = 223/633 (35%), Positives = 361/633 (57%), Gaps = 40/633 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  +KEL+ENSLDA +++++  +  GG    +I DNG 
Sbjct: 3   RINLLSPRLANQIAAGEVVERPASVVKELLENSLDAGATQLDVEVEQGGVRQIKIRDNGA 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+A+ RH TSKI   DD   + + GFRGEAL SI +VS L L S+        
Sbjct: 63  GIVKDDLPLALSRHATSKIHTLDDLEAVQSLGFRGEALASISSVSRLLLTSKAKGEQDAW 122

Query: 120 QIAISGEKI-SSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           ++   G+ + ++V+P +   GT +EVRDLFF  PAR  FL++++ E N +++V++R+A++
Sbjct: 123 RVEAEGKDMGANVKPASHPEGTCIEVRDLFFNTPARRKFLRTDKTEFNHLSEVVKRLALS 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F  S      Y +   +   +   R++ ++G+ F+ NA+ ++ ++  + L G+ G
Sbjct: 183 RYDVAFRLSHDGKQVYDLRAVTDQMHAEHRLATLLGKSFVQNALAIDVEAAGLRLWGWIG 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL LE+DP  VDVN
Sbjct: 243 LPTFSRSQADLQYFFVNGRVVKDKLVAHAVRQAYRDVLYNGRHPTFVLYLELDPATVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ----------- 347
           VHP K  +RFR+  ++ +F+   I K +       ++ L     ++  Q           
Sbjct: 303 VHPTKHEVRFRDGRLVHDFLFSKIHKVLADVRPEATAELDVVDNAAVSQSITQQDSLTLS 362

Query: 348 DNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSE---------------- 391
           + +P T       S  +      +   ++S    + S    ++                 
Sbjct: 363 NRSPMTPGAMGDVSWMSAASSAPVTSGQVSGQMGVMSQMADFAHQVTSSDVPVSNVNPLT 422

Query: 392 ---------DNDPVEESEATHYQL-GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFE 441
                      D V E+E +     G A AQ+H  YI+S+   GL++VD HAAHER+++E
Sbjct: 423 GEVIERAPMYKDGVAEAERSGMPPLGFAIAQLHGIYILSENQHGLIVVDMHAAHERILYE 482

Query: 442 KMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIP 501
           KM+  F + +I SQ LL P  I + + E  L+ E DE     G++ ER GP +I +RE+P
Sbjct: 483 KMKNAFYAKQIVSQPLLVPINISVAQSEADLVEEADEVFSSFGLRVERSGPESIMVREVP 542

Query: 502 AILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLL 561
            ILS+ ++  L+RD++ ++I   TT  L+ R   ++ATMAC+GS+R+ RK+   EMN LL
Sbjct: 543 VILSQGHVENLVRDVVSDLIMHGTTDILEARSNELMATMACHGSVRANRKLTIAEMNSLL 602

Query: 562 REMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           R+ME    S QCNHGRPT+ ++ +S+++KLF R
Sbjct: 603 RDMEITERSGQCNHGRPTWTQMTMSELDKLFLR 635


>gi|92118635|ref|YP_578364.1| DNA mismatch repair protein [Nitrobacter hamburgensis X14]
 gi|123083577|sp|Q1QIP3|MUTL_NITHX RecName: Full=DNA mismatch repair protein mutL
 gi|91801529|gb|ABE63904.1| DNA mismatch repair protein MutL [Nitrobacter hamburgensis X14]
          Length = 603

 Score =  552 bits (1422), Expect = e-155,   Method: Composition-based stats.
 Identities = 230/602 (38%), Positives = 363/602 (60%), Gaps = 8/602 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E ++N+IAAGE++ERP+  +KEL+EN++DA + R++    GGG+    ITD+G
Sbjct: 1   MPVRQLPETVVNRIAAGEVVERPASVVKELVENAIDAGAGRIDIFTDGGGRRRIGITDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT  ++ +AV RH TSK+ D D   I T GFRGEALPSIGAV+ L + +R        
Sbjct: 61  GGMTKADLALAVDRHATSKLDDEDLLRIRTLGFRGEALPSIGAVAKLGITTRHGSEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + + G + S++ P A+  GT VEV DLF+  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 SLTVEGGRKSAIVPAALTQGTRVEVSDLFYATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKS-NRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           P ++FT +  +                  R+  ++G DF  +A+ +  + + +T++G+  
Sbjct: 181 PDIAFTLAGEERAPVTWTAALPGAAGQLTRLGDILGADFRCSAIAVRAERDGVTVEGFAA 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P+  R NA   Y+F+NGR V+DK I+  +R AY++ +P  R+PVV L +   P++VD N
Sbjct: 241 APSLTRANALGQYLFVNGRPVRDKLIIGAVRAAYSDYLPRDRHPVVALFVTTAPQEVDAN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHPAK+ +RFRN  ++R  I+ ++++ + ++G  T++     ++++F     P+     +
Sbjct: 301 VHPAKTEVRFRNAGLVRALIVHALKEGLAREGRRTAANSDGAVLTAFRPAAVPRPANWDW 360

Query: 359 ATSLTNT------QEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQ 412
             S  +                            P+    +DP   ++     LG A  Q
Sbjct: 361 RQSPASPVGAGPWSGGATAAAFAAPGQTAFDVGAPSADVRSDPNPVADLIDRPLGAARTQ 420

Query: 413 IHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECAL 472
           IH+ YI++QT DGL++VDQHAAHER+++EK++       +  Q LL P+I++L E     
Sbjct: 421 IHETYIVTQTRDGLIVVDQHAAHERIVYEKLKAALERDGVQRQILLIPDIVELDEATVEK 480

Query: 473 IMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDR 532
           +++   +L + G+  E FGP A+A+RE P++L K N   LLRD+ + + +      L+ R
Sbjct: 481 LIDRAPELEKFGLAIESFGPGAVAVRETPSLLGKTNAAALLRDLAEHMAEWDEALPLERR 540

Query: 533 IENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLF 592
           + ++ ATMAC+GS+R+GR ++  EMN LLREME  PNS QCNHGRPT+++LKL+DIEKLF
Sbjct: 541 LMHVAATMACHGSVRAGRILKPEEMNALLREMEDTPNSGQCNHGRPTYVELKLADIEKLF 600

Query: 593 GR 594
           GR
Sbjct: 601 GR 602


>gi|92113401|ref|YP_573329.1| DNA mismatch repair protein [Chromohalobacter salexigens DSM 3043]
 gi|123387512|sp|Q1QY28|MUTL_CHRSD RecName: Full=DNA mismatch repair protein mutL
 gi|91796491|gb|ABE58630.1| DNA mismatch repair protein MutL [Chromohalobacter salexigens DSM
           3043]
          Length = 644

 Score =  552 bits (1422), Expect = e-155,   Method: Composition-based stats.
 Identities = 200/637 (31%), Positives = 337/637 (52%), Gaps = 44/637 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L  ++ NQIAAGE++ERP+  +KEL+EN++DA S R+E  +  GG    ++ D+G 
Sbjct: 6   RIHILDPRLANQIAAGEVVERPASVVKELVENAIDAGSQRIEIDLESGGARLIRVRDDGR 65

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNT-G 118
           G+  E++P+A+ RH TSKI+  DD   + + GFRGEAL SI +VS L L+S      + G
Sbjct: 66  GIDQEDLPLALSRHATSKIASLDDLEGVDSLGFRGEALASISSVSRLELISNTHDEPSDG 125

Query: 119 AQIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
            ++   G ++     P     G+ V VRDLFF  PAR  FL++E+ E   + +  RR+A+
Sbjct: 126 WRVVAEGRQMEPRVTPAPHPRGSSVVVRDLFFNTPARRKFLRTEKTEFGHVEEAFRRLAL 185

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           +   + +     +   +++     + +   R+  ++G  F+ NA+ ++ ++  + L G+ 
Sbjct: 186 SRYDIGWILRHNQKVVHQLRAGDASTSMERRVGALLGRKFLENALHVDIEATGLRLWGWV 245

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PT +R  A+Q Y F+NGR V+D+ +   +R AY + +  GR+PV VL LE+DP  VDV
Sbjct: 246 GLPTHSRAQADQQYFFVNGRVVRDRLVAHAVRQAYRDVMFHGRHPVFVLYLELDPHVVDV 305

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKK----------------- 340
           NVHP K  +RFR+  ++ +F+  S+ +A+     + +S                      
Sbjct: 306 NVHPTKHEVRFRDGRLVHDFLFSSLHRALADVRPNATSTEGGDEATPSTDATTATAAEAS 365

Query: 341 -------------MISSFHQDNAPKTH-----LPKYATSLTNTQEKLFLQENRLSTNDLL 382
                         +++  +   P  H     +  Y       +  L   + + +  +  
Sbjct: 366 AGQAEPRWQQQGMALAAGQERERPAAHRVREFMAGYRALHPEHEASLLTPQPQEAAEEAA 425

Query: 383 PSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEK 442
            +  P  S      E  +     LG A AQ+H  YI+SQT  GLV+VD HAAHER+ +E+
Sbjct: 426 GTPAPPASSSPAMAETDDTQAPPLGYAVAQLHGVYILSQTERGLVVVDMHAAHERITYER 485

Query: 443 MRQDFNSTK-----ITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAI 497
           M+Q  +        + +Q LL P  I     E            RLG++ +  GP  + +
Sbjct: 486 MKQQVHGDGQALGRLQTQPLLVPVSIAASAREVETAENERATFERLGVELDVAGPETLLV 545

Query: 498 REIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEM 557
           R++P +L   ++  L+ D++ ++     +  L+  I  +L++MAC+GS+R+ R++   EM
Sbjct: 546 RQVPVLLGNADVEALIHDMLGDLERFGRSDRLEVHINELLSSMACHGSVRANRRLTVPEM 605

Query: 558 NRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           N LLR+ME+   S QCNHGRPT+ ++ + +++KLF R
Sbjct: 606 NALLRDMERTERSGQCNHGRPTWTEMSMHELDKLFLR 642


>gi|237748580|ref|ZP_04579060.1| DNA mismatch repair protein mutL [Oxalobacter formigenes OXCC13]
 gi|229379942|gb|EEO30033.1| DNA mismatch repair protein mutL [Oxalobacter formigenes OXCC13]
          Length = 629

 Score =  552 bits (1422), Expect = e-155,   Method: Composition-based stats.
 Identities = 209/606 (34%), Positives = 333/606 (54%), Gaps = 18/606 (2%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            I+ L++ +I+QIAAGE++ERPS  +KEL+EN++DA S+++E  +  GG     I DNG 
Sbjct: 27  SIQLLTDTLISQIAAGEVVERPSAVVKELLENAVDAGSTQIEIRLENGGIKRIAIIDNGC 86

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  E++ +A+ RH TSKI+   D  N+ T GFRGEAL SI +V+ LTL SR  +     
Sbjct: 87  GIPPEQLRLALTRHATSKIASLNDLENVATLGFRGEALASIASVADLTLQSRTAEEPHAW 146

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+  +     ++ P +   GT V+V +L+   PAR  FLKSEQ E     +V+RR+A+A 
Sbjct: 147 QMRGNDPT-GTLSPCSGGFGTTVDVHELYSNTPARRKFLKSEQTEYGHCAEVVRRIALAQ 205

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKS----NEITLQG 235
           P + FT         + N      N  +R +QV+GE F  + + ++       N + L G
Sbjct: 206 PGIRFTLMHNGKATAQWNAH----NLSQRCNQVLGEQFAQSQLPIDITVGEGANSLRLYG 261

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           + G PT +R   +  Y ++NGR V+D+ +   +R AY + +   RYP  +L L +DP  V
Sbjct: 262 FIGQPTASRTRGDMQYFYVNGRFVRDRLLTHAVRAAYEDVLHGNRYPAYLLYLTLDPSLV 321

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINK----KGISTSSVLSKKMISSFHQDNAP 351
           DVNVHPAK  +RFR+   I +FI QS+ + + +       +  S+   +  +        
Sbjct: 322 DVNVHPAKIEVRFRDSRSIHHFIHQSVSRTLAQTMEPHAAADESIAYAETPARSPVSWHS 381

Query: 352 KTHLP-KYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDND--PVEESEATHYQLGI 408
            T  P  Y             +++R              +E +D   ++E     + LG 
Sbjct: 382 NTPSPVSYGVEQKTASYGALFRQSREQEESHSSPLPMPATELSDLFRIDEKTEEDFPLGF 441

Query: 409 ACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEG 468
           A AQ+H  YI++Q   GLV+VD HAAHER+++EK++   +   + +QTLL P  + + E 
Sbjct: 442 ALAQLHDIYILAQNRHGLVLVDMHAAHERIVYEKLKTALDEKTLQTQTLLIPVTMKVSEV 501

Query: 469 ECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYT 528
           E    +E+ E L  LG       P  IA+R +P +L + +    LR+I+ ++ +  T+  
Sbjct: 502 EAGTALENRETLQELGFDISALTPETIAVRTVPTLLREADTANALRNILRDMHEYGTSSI 561

Query: 529 LQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDI 588
            +++   +LAT+AC+ ++R+ R +   EMN LLR+ME+   + QCNHGRPT+ +L LS++
Sbjct: 562 AKEKRNELLATVACHNAVRANRSLTITEMNALLRQMEQTERADQCNHGRPTWTQLGLSEL 621

Query: 589 EKLFGR 594
           + LF R
Sbjct: 622 DALFLR 627


>gi|152980279|ref|YP_001352152.1| DNA mismatch repair protein [Janthinobacterium sp. Marseille]
 gi|166232093|sp|A6SV55|MUTL_JANMA RecName: Full=DNA mismatch repair protein mutL
 gi|151280356|gb|ABR88766.1| DNA mismatch repair protein [Janthinobacterium sp. Marseille]
          Length = 613

 Score =  552 bits (1422), Expect = e-155,   Method: Composition-based stats.
 Identities = 204/606 (33%), Positives = 331/606 (54%), Gaps = 17/606 (2%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            I+ LS+++I+QIAAGE++ERPS  +KEL+EN+LDA ++ +   +  GG     ITDNG 
Sbjct: 10  PIQPLSDQLISQIAAGEVVERPSAVVKELLENALDAGATAITVRLEQGGVKRIAITDNGR 69

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+T E++P+A+ RH TSKI+   +  N+ T GFRGEAL SI +V+ LTL SR        
Sbjct: 70  GITPEQLPLALARHATSKINSLNELENVGTLGFRGEALASIASVAQLTLTSRTADAQHAW 129

Query: 120 QI--AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           +I      ++ ++V P +  PGT V+V+DL+F  PAR  FLK+EQ E     +V+RR+A+
Sbjct: 130 EISGVQGSDQKNTVAPSSGAPGTTVDVQDLYFNTPARRKFLKTEQTEFGHCAEVVRRIAL 189

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           + P V+F+ S                +  +R + ++G +F    + L E +  + L G+ 
Sbjct: 190 SRPDVAFSLSHNGKTVDHW----AVNDIAKRSAHILGSEFSGARLPLEETAGPLHLHGFI 245

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PT ++   +  Y ++NGR V+DK ++  +R+AY + +   RYP  V+ L++DP  VDV
Sbjct: 246 GLPTASKARGDAQYFYVNGRFVRDKLLMHAVRSAYQDVLHGDRYPSYVISLDLDPALVDV 305

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINK-----KGISTSSVLSKKMISSFHQDNAPK 352
           NVHP+K  +RFR+   +  F+  ++ +A+ +      G   S   +      + ++    
Sbjct: 306 NVHPSKIEVRFRDSRSVHQFVFHAVSRALAQTSATAFGAVPSPTPAPSGALPWLREQQQT 365

Query: 353 THLPKYATSLTNTQEKLF----LQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGI 408
           T  P++       Q           +   T           +  N P +      + LG 
Sbjct: 366 TFAPQFQQQYGVAQTTANYGALFNTDGAVTPLGTEPAPAFAAFTNSPAQTMSDDEFPLGF 425

Query: 409 ACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEG 468
           A AQ+H  +I++Q T GLV+VD HAAHER+++E+++   +   +  Q LL P      + 
Sbjct: 426 ALAQLHGIFILAQNTKGLVLVDMHAAHERILYEQLKNALDDNAMQVQPLLIPITFYADDV 485

Query: 469 ECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYT 528
           E     +  E L  LG       P  +AIR +P +L   +   L RD++ ++ +   +  
Sbjct: 486 EVGTAEDSKETLLSLGFDIAVMSPTTLAIRAVPTLLKNADAQSLARDVLRDVREYGGSRV 545

Query: 529 LQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDI 588
           L +R   +L T+AC+ ++R+ R +   EMN LLR+ME    + QCNHGRPT+++L LSD+
Sbjct: 546 LVERRNELLGTLACHTAVRANRMLTGPEMNALLRQMEATERADQCNHGRPTWVQLGLSDL 605

Query: 589 EKLFGR 594
           +KLF R
Sbjct: 606 DKLFER 611


>gi|94311840|ref|YP_585050.1| DNA mismatch repair protein [Cupriavidus metallidurans CH34]
 gi|93355692|gb|ABF09781.1| methyl-directed mismatch repair protein [Cupriavidus metallidurans
           CH34]
          Length = 655

 Score =  551 bits (1421), Expect = e-155,   Method: Composition-based stats.
 Identities = 206/643 (32%), Positives = 336/643 (52%), Gaps = 57/643 (8%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            IR L +++I+QIAAGE++ERP+  +KEL+EN+LDA ++++   +  GG     ITDNG 
Sbjct: 18  PIRPLPDQLISQIAAGEVVERPASVVKELLENALDAGATQLGIRLEEGGVRRIVITDNGC 77

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++E+P+A+ RH TSKI+  D+  ++ T GFRGEAL SI +VSHL L SR        
Sbjct: 78  GIPADELPVALMRHATSKIASLDELESVLTLGFRGEALASIASVSHLVLTSRTATATHAT 137

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI+        ++P +   GT+++V+ L+F  PAR  FLKSEQ E     ++IRR A+A 
Sbjct: 138 QISADT---GHLQPASGGVGTMIDVQHLYFNTPARRKFLKSEQTELGHCLEMIRRAALAR 194

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V+ +           N     G+   R +QV+G DF    + L+E+++ + L G+ G+
Sbjct: 195 PDVTISVHHNGKPLEHWNA----GDVATRTAQVLGSDFARARLPLDEQADALHLYGFAGL 250

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT +RG  +Q Y F+NGR V+DK +   +R+AY + +   R+P  V+ L++ P  VDVNV
Sbjct: 251 PTASRGRPDQQYFFVNGRFVRDKLLNHAVRSAYQDVLHGDRFPSYVICLDLPPELVDVNV 310

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH----- 354
           HP+K  +RFR    +  F+  ++Q+ + ++       L  ++     + + P        
Sbjct: 311 HPSKIEVRFRESRAVHQFVYHAVQRCLARQAGEQGDSLHSEIADEAGRPSMPAARPVGAP 370

Query: 355 --------------------------------------LPKYATSLTNTQEKLFLQENRL 376
                                                          + Q   +L + + 
Sbjct: 371 GAPGAAPQWVNYSAGRQTELGIAQPRQAYLGMVRDAAGQGSARPWQPSPQPPAWLADAQA 430

Query: 377 STNDLLPS-----DDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQ 431
           +  D  P                P        + LG A AQ+H  Y+++Q   GLV+VD 
Sbjct: 431 ARADEPPGLLDRLPQQPLQPSTLPAAGEGDDDHPLGYAVAQLHGIYVLAQNARGLVLVDM 490

Query: 432 HAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFG 491
           HAAHER+++E+++    + ++  Q LL P  +     E     EH E L  LG   +   
Sbjct: 491 HAAHERILYEQIKTALEARELAVQPLLIPVTLPASPVEIGAAEEHQETLQLLGFDIKPVS 550

Query: 492 PNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRK 551
           P  +A+R IPA+L + +   L RD++ ++     +  L +R   +LAT+AC+ ++R+ RK
Sbjct: 551 PTTLAVRAIPALLKQADTEALARDVLRDLQAYGGSRVLAERQNELLATLACHSAVRANRK 610

Query: 552 MQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +   EMN LLR+ME+   + QCNHGRPT+++L ++++++LF R
Sbjct: 611 LTVEEMNALLRQMEQTERADQCNHGRPTWVQLTVAELDRLFLR 653


>gi|319784249|ref|YP_004143725.1| DNA mismatch repair protein MutL [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170137|gb|ADV13675.1| DNA mismatch repair protein MutL [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 624

 Score =  551 bits (1421), Expect = e-155,   Method: Composition-based stats.
 Identities = 273/624 (43%), Positives = 400/624 (64%), Gaps = 31/624 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+LSE +INQIAAGE+IERP+  +KEL+EN+LDA +SRVE V +GGG +  ++TD+G
Sbjct: 1   MPIRQLSETMINQIAAGEVIERPASVVKELVENALDAGASRVEIVTSGGGLNLIRVTDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+   E+ +A+ RHCTSK+++D ++I + GFRGEALPSIG+VS L++ SR   +++ A+
Sbjct: 61  SGIPERELALAIARHCTSKLTEDINDIRSLGFRGEALPSIGSVSRLSIRSRTAASDSAAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I I G ++  VRP A N GT VEVRDLFF  PARL F+K E+ E++  +DV++R+AIA+P
Sbjct: 121 IGIEGGRVLPVRPAAANRGTTVEVRDLFFATPARLKFMKGERAESSATSDVVKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNF--QSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            V FT +    +  ++     S  G+    ++QV+G DF +N++ L+   + + L G+  
Sbjct: 181 AVRFTLAGSDRSTLELPAADDSAEGSLRR-VAQVMGTDFPDNSIALDAMRDGVHLTGHAS 239

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           IP+F R NA Q Y ++NGR V+DK I   IR AYA+ +P  R+ V VL L +DP  VDVN
Sbjct: 240 IPSFTRANALQQYAYVNGRPVRDKLIAGAIRGAYADVLPRDRHAVTVLFLTLDPAIVDVN 299

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ----------- 347
           VHPAK+ +RFR+P ++R  I+ +I++A+   G+  ++  +  M+++F             
Sbjct: 300 VHPAKADVRFRDPGLVRGLIVGAIRQALADAGVRAATTGAAGMMAAFRPGAASYGHGGPA 359

Query: 348 ------DNAPKTHLPKYATSLTNTQEKLF-------LQENRLSTNDLLPSDDPTYSEDND 394
                 D A +   P       + Q  L         ++  L  ++    D    +  + 
Sbjct: 360 NGHRSYDAAYRASGPSGFDPARSPQRPLDMGFDGAGFEQRGLRESEQAAFDAGPLASADA 419

Query: 395 PVEESEATHYQLGIACA----QIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST 450
              + EA    LG        Q+H+NYI++QT D L+IVDQHAAHERL++E ++   +S 
Sbjct: 420 RAGQDEAAETLLGAVLGAARAQVHENYIVAQTRDSLIIVDQHAAHERLVYEALKNALHSR 479

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
            + SQ LL PEIIDL E +   +  H E L R G+  ERFGP A+A+RE P++L + N+ 
Sbjct: 480 PVPSQMLLLPEIIDLPEEDAERLALHSETLARFGLGIERFGPGAVAVRETPSMLGEANVQ 539

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
           QL+RD+ DEI D+ T  TL++R++ I ATMAC+GS+RSGR +++ EMN LLR+ME  P S
Sbjct: 540 QLVRDLADEIADNDTVDTLKERLDKIAATMACHGSVRSGRLLKAEEMNALLRQMEATPGS 599

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
             CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 600 GTCNHGRPTYIELKLADIERLFGR 623


>gi|153010372|ref|YP_001371586.1| DNA mismatch repair protein [Ochrobactrum anthropi ATCC 49188]
 gi|166232099|sp|A6X3F3|MUTL_OCHA4 RecName: Full=DNA mismatch repair protein mutL
 gi|151562260|gb|ABS15757.1| DNA mismatch repair protein MutL [Ochrobactrum anthropi ATCC 49188]
          Length = 626

 Score =  551 bits (1421), Expect = e-155,   Method: Composition-based stats.
 Identities = 275/626 (43%), Positives = 395/626 (63%), Gaps = 33/626 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V  GGGK+  ++TDNG
Sbjct: 1   MPIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTGGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+  +E+P+AV RHCTSK+SDD  +I   GFRGEALPSIG+V+ LTL SRP   ++G +
Sbjct: 61  SGIPVDELPLAVSRHCTSKLSDDVHDIRALGFRGEALPSIGSVAKLTLKSRPQDADSGFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           +++SG  +   RP A+N GTI EVRDLFF  PARL F+K+++ E + ITDV++R+AIA+P
Sbjct: 121 VSVSGGHLDGPRPSALNRGTIAEVRDLFFATPARLKFMKTDRAEASAITDVVKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            V F+ +       ++    S      ERI+QV+G++F  NA+ ++ + + + L G+ GI
Sbjct: 181 HVRFSLAGTDRTPLELAATGSGAEATLERINQVLGKEFGENALAIDAERDGVRLAGFVGI 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+ NRGNA   + ++NGR V+DK +   +R AYA+ +   R+PV VL L +DP  VDVNV
Sbjct: 241 PSHNRGNALHQFAYVNGRPVRDKQLFGALRGAYADVMARDRHPVAVLFLTLDPAFVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HPAK+ +RFR+P ++R  I+ +I++A+ + GI  ++  +  M+ +F  +   +   P + 
Sbjct: 301 HPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGADAMLQAFRAEGF-QPPSPSFT 359

Query: 360 TSLTNTQEKLFLQENRLSTNDLLPSDDPTYSED--------------------------- 392
           +  ++           +S+     S    +                              
Sbjct: 360 SRPSSAGYASGSWHPAVSSPRTEWSPQTAHPAHRPLDLGAAPSFQESDQATLATVNVLAA 419

Query: 393 ----NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFN 448
                      E     LG A AQIH NYI+SQT D LVIVDQHAAHERL++E ++   +
Sbjct: 420 DARATRDEAPVELQQKPLGAARAQIHANYIVSQTEDSLVIVDQHAAHERLVYEALKNALH 479

Query: 449 STKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKN 508
           S  I+ Q LL PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N
Sbjct: 480 SRPISGQMLLIPEIVDLPEEDAERLATHAETLARFGLGIEQFGPGAIAVRETPAMLGEMN 539

Query: 509 IPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNP 568
           + QL+RD+ DEI +  T+  L+  + ++ ATMAC+GS+RSGR+++  EMN LLREME  P
Sbjct: 540 VQQLIRDLSDEIAEHDTSEGLKAMLNHVAATMACHGSVRSGRRLKPEEMNALLREMEATP 599

Query: 569 NSSQCNHGRPTFIKLKLSDIEKLFGR 594
            S  CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 600 GSGTCNHGRPTYIELKLTDIERLFGR 625


>gi|295691031|ref|YP_003594724.1| DNA mismatch repair protein MutL [Caulobacter segnis ATCC 21756]
 gi|295432934|gb|ADG12106.1| DNA mismatch repair protein MutL [Caulobacter segnis ATCC 21756]
          Length = 638

 Score =  551 bits (1421), Expect = e-154,   Method: Composition-based stats.
 Identities = 242/637 (37%), Positives = 377/637 (59%), Gaps = 43/637 (6%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L  + +N+IAAGE++ERP+ AIKEL++N++DA ++R+E    GGG +   + D+G
Sbjct: 1   MPIRRLPPETVNRIAAGEVVERPASAIKELVDNAIDAGATRIEVEAHGGGLTRILVADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD------FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQ 114
            G+++EE+P+A++RH TSK++ D         IHT GFRGEALPSIG+V+ L + SR   
Sbjct: 61  CGLSAEELPVAIERHATSKLAPDADGLWDLLRIHTMGFRGEALPSIGSVARLQISSRAKG 120

Query: 115 NNTGAQIAISGEKISSVRPV--AMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVI 172
                 I + G ++  V P       G  +EVRDLF+  PARL F+KSE+ E   IT+ I
Sbjct: 121 EKDAFSILVEGGQVGDVAPAAFPGPHGARIEVRDLFYATPARLKFMKSERAEALAITEEI 180

Query: 173 RRMAIAYPKVSFTFSTIKSNRYKMNF-QSTNGNFPERISQVIGEDFINNAVELNEKSNEI 231
           +R A+A   V F+         ++            R++ V+G +F  NA+E+++  + +
Sbjct: 181 KRQAMANESVGFSLDIDGRRVLRLPPEHPGPQGRLARLAAVLGREFQENALEIDQVRDGV 240

Query: 232 TLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEID 291
            L G+ G+PT+NRGNA   Y+F+NGR V+D+ +   +R AYA+ +   R+P   L + +D
Sbjct: 241 RLSGFAGLPTYNRGNAAHQYLFVNGRPVRDRLLQGALRAAYADFLARDRHPTAALYVTLD 300

Query: 292 PRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAP 351
             +VDVNVHPAK+ +RFR+P ++R  I+ +++ A+   G   S+ ++ + + S     +P
Sbjct: 301 TAEVDVNVHPAKAEVRFRDPALVRGLIVGALRHALAGAGHRASTTVAAQALDSIRAQQSP 360

Query: 352 KT-HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEES----------- 399
              + P  + +  +   +           ++   D P  +E +  VE S           
Sbjct: 361 FPGYQPGPSAAGFSAWREGGWAPPTQRPLNMQSMDLPGLNEVSARVEPSYGGELAEVVRE 420

Query: 400 ----------------------EATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHER 437
                                 +   Y LG A AQ+H+ YI++QT DG+VIVDQHAAHER
Sbjct: 421 AYASVAFEDRPITDHPSAAAPFDPVDYPLGAARAQVHETYIVAQTRDGMVIVDQHAAHER 480

Query: 438 LIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAI 497
           L++E+M+ +  +  +  QTLL PE++DL   E   ++   E+L  LG+  E FGP A+ +
Sbjct: 481 LVYERMKGEMAAGGVARQTLLLPEVVDLDPAEAERVIARAEELANLGLVIESFGPGAVLV 540

Query: 498 REIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEM 557
           RE PA+L K +   L+RDI D++ ++     L++R+E + +TMAC+GS+R+GR++   EM
Sbjct: 541 RETPALLGKTDAAGLIRDIADDLAENGAALALKERLEEVCSTMACHGSVRAGRRLNGAEM 600

Query: 558 NRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           N LLREME  P+S QCNHGRPT+++LKL+DIEKLFGR
Sbjct: 601 NALLREMEATPHSGQCNHGRPTYVELKLADIEKLFGR 637


>gi|300310168|ref|YP_003774260.1| DNA mismatch repair protein [Herbaspirillum seropedicae SmR1]
 gi|300072953|gb|ADJ62352.1| DNA mismatch repair protein [Herbaspirillum seropedicae SmR1]
          Length = 627

 Score =  551 bits (1420), Expect = e-154,   Method: Composition-based stats.
 Identities = 212/626 (33%), Positives = 330/626 (52%), Gaps = 39/626 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            I+ L +++I+QIAAGE+IERPS  +KEL+EN+LDA S+++   +  GG     ITDNG 
Sbjct: 6   PIQALPDQLISQIAAGEVIERPSAVVKELLENALDAGSTQITVRLEQGGVKRIAITDNGR 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  E++P+A+ RH TSKI+   D  N+ T GFRGEAL SI +V+ LT+ SR        
Sbjct: 66  GIPPEQLPLALARHATSKIASLTDLENVSTLGFRGEALASIASVAQLTVTSRTADAPHAW 125

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +I  S  +  +V P +   GT ++V+DL+F  PAR  FLKSEQ E     +V+RR+A+A 
Sbjct: 126 EITGS--QFGTVAPASGAQGTTIDVQDLYFNTPARRKFLKSEQTEYGHCAEVVRRIALAR 183

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P VSF+ S         N     G F +R + ++G++F N  + L+E +  + L G+ G+
Sbjct: 184 PDVSFSLSHNGKTVDHWNV----GEFAKRSAHILGDEFANARLPLDESAGPLRLHGFVGL 239

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT ++  A+  Y ++NGR V+DK +   +R AY + +   RYP   L L +DP  VDVNV
Sbjct: 240 PTASKARADGQYFYVNGRFVRDKLLTHAVRAAYQDVLHGDRYPAYALSLTLDPALVDVNV 299

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISS--------------- 344
           HP+K  +RFR+   +  F+  ++ +A+ +    +   L      S               
Sbjct: 300 HPSKIEVRFRDSRAVHQFVFHAVSRALAQTSAVSFGNLPGAAPQSDDSAGAPPPAANAPL 359

Query: 345 -----FHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEES 399
                  Q +                     +++N  +   +  S   +   D       
Sbjct: 360 PWIGEQQQQSFSAQFAEAPRPFSFGGNSGFGVRQNTEAYGSMFRSAPTSGEPDGSAPAAY 419

Query: 400 EAT-----------HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFN 448
            AT            + LG A AQ+H  Y+++Q   GLV+VD HAAHER+++E+++   +
Sbjct: 420 GATPAAAPAALPEGDFPLGFALAQLHGIYVLAQNQAGLVVVDMHAAHERILYEQLKTALD 479

Query: 449 STKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKN 508
             ++  Q LL P        E   + EH E L  LG       P  +A+R +PA+L   +
Sbjct: 480 GNEMFVQPLLIPVTFYADPVEVGTVEEHQETLSALGFDIAVMSPTTLAVRAVPALLKNAD 539

Query: 509 IPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNP 568
              L RD++ ++ +   +  L +R   +L T+AC+ ++R+ R +   EMN LLR+ME   
Sbjct: 540 AQTLARDVLRDVREYGGSRVLLERRNELLGTLACHTAVRANRSLTLPEMNALLRQMEATE 599

Query: 569 NSSQCNHGRPTFIKLKLSDIEKLFGR 594
            S QCNHGRPT+ ++ LSD++KLF R
Sbjct: 600 RSDQCNHGRPTWTQMGLSDLDKLFLR 625


>gi|253996214|ref|YP_003048278.1| DNA mismatch repair protein MutL [Methylotenera mobilis JLW8]
 gi|253982893|gb|ACT47751.1| DNA mismatch repair protein MutL [Methylotenera mobilis JLW8]
          Length = 610

 Score =  551 bits (1420), Expect = e-154,   Method: Composition-based stats.
 Identities = 206/610 (33%), Positives = 335/610 (54%), Gaps = 21/610 (3%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            IR L +++I+QIAAGE++ERP+ A+KEL+ENSLDA S+ ++  +  GG    ++TDNG 
Sbjct: 3   TIRLLPDQLISQIAAGEVVERPASALKELLENSLDAGSTDIQVSLLQGGIKQMRVTDNGA 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  E++ +A+ RH TSKIS  +D  ++ + GFRGEAL SI ++S   L+SR   +    
Sbjct: 63  GVAKEDLMLALTRHATSKISSLEDLESVASLGFRGEALASIASISRTQLLSRQSGSKHAW 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +I   G ++S++ P A++ GT++EV DL+F  PAR  FLK+E  E     ++  R+A++ 
Sbjct: 123 RIGSEGSEVSTIEPAALDAGTVIEVSDLYFNTPARRKFLKTEATEFGHCEEMFTRIALSR 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P VS           +       G    R S+V+G +F+  ++ ++E +  + L G    
Sbjct: 183 PDVSLMLQHNGRALSRF----AIGQPERRFSEVLGSEFVAESIPVDESAAGLRLWGMAAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTFNR + +  YV++NGR V+DK I   IR AY + +   R+P  VL LE+DP  VDVNV
Sbjct: 239 PTFNRNSRDTQYVYVNGRFVRDKVIAHAIRQAYQDVLHHDRHPAFVLFLELDPSLVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HPAK+ +RFR+   +  FI  ++ KA+      +++V + +   +        T L    
Sbjct: 299 HPAKTEVRFRDSQAVHRFIFHALHKALAIPTGVSNAVTANQAQYNPFSPQVSNTALANGG 358

Query: 360 TSLTNTQE--KLFLQENRLSTNDLLPSDDPTYSED---------NDPVEESEATHYQLGI 408
                 Q    L   E       L  ++    +           ++ ++      Y LG 
Sbjct: 359 MLYPTQQSQINLSAHEPAGFYQTLFGNNANQPATPATLTLDVLADNSLKAESINEYPLGF 418

Query: 409 ACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEG 468
           A  Q+H  Y+++Q  +GLV++D HAAHER+++EK++   +S  +  Q LL P   +  + 
Sbjct: 419 AVGQVHGVYVLAQNKEGLVVIDMHAAHERIMYEKLKHALDSQTVQMQPLLLPVSFNADKL 478

Query: 469 ECALIME----HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSS 524
           E A + E    +   L +LG       P  +A+R +P +L   +   L RD++ ++ +  
Sbjct: 479 EVATVHEALAGNQATLQQLGFDIAILSPTTLAVRAVPTMLQDADAVILARDVLRDLREYG 538

Query: 525 TTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLK 584
            +  L +R   +L TMAC+ ++R+ R +   EMN LLR+ME    S QCNHGRPT+ ++ 
Sbjct: 539 ASRVLTERRNELLGTMACHAAVRANRSLTIPEMNALLRDMEATERSGQCNHGRPTWFQVS 598

Query: 585 LSDIEKLFGR 594
           + D++K+F R
Sbjct: 599 MGDLDKMFMR 608


>gi|260464400|ref|ZP_05812591.1| DNA mismatch repair protein MutL [Mesorhizobium opportunistum
           WSM2075]
 gi|259029870|gb|EEW31155.1| DNA mismatch repair protein MutL [Mesorhizobium opportunistum
           WSM2075]
          Length = 641

 Score =  551 bits (1420), Expect = e-154,   Method: Composition-based stats.
 Identities = 276/624 (44%), Positives = 396/624 (63%), Gaps = 31/624 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+LSE +INQIAAGE+IERP+  +KEL+EN+LDA +S+VE V AGGG +  ++TD+G
Sbjct: 18  MPIRQLSETMINQIAAGEVIERPASVVKELVENALDAGASKVEVVTAGGGLNLIRVTDDG 77

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+   E+ +A+ RHCTSK+++D  +I + GFRGEALPSIG+VS L++ SR    ++ A+
Sbjct: 78  SGIPEHELSLAIARHCTSKLAEDIHDIRSLGFRGEALPSIGSVSRLSIRSRTALGDSAAE 137

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I I G +I  VRP A N GT VEVRDLFF  PARL F+K E+ E++ I+DV++R+AIA+P
Sbjct: 138 IGIEGGRILPVRPAAANRGTTVEVRDLFFATPARLKFMKGERAESSAISDVVKRIAIAFP 197

Query: 181 KVSFTFSTIKSNRYKMNFQ--STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            V FT +    +  ++     S  G+    ++QV+G +F +N++ ++     + L G+  
Sbjct: 198 AVRFTLAGSDRSTLELPATDESAEGSLRR-VAQVMGAEFPDNSIAIDAMREGVHLTGHVS 256

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           IP+F R NA Q Y ++NGR V+DK I   IR A+A+ +P  R+ V VL L +DP  VDVN
Sbjct: 257 IPSFTRANALQQYAYVNGRPVRDKLIAGAIRGAFADVLPRDRHAVTVLFLTLDPGTVDVN 316

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA------PK 352
           VHPAK+ +RFR+P ++R  I+ +I++A+   GI +++  +  M+++F    A      P 
Sbjct: 317 VHPAKADVRFRDPGLVRGLIVGAIRQALADAGIRSATTGAAGMMAAFRPSAASYGHGGPA 376

Query: 353 THLPKYATSLTNTQEKLF------------------LQENRLSTNDLLPSDDPTYSEDND 394
                Y  S   +    F                   +   L   D    D    +  + 
Sbjct: 377 NGHRSYEASYHASGSAGFDPARSSQRPLDMGFEGGGFEHRGLREPDQAAFDAGPLASADA 436

Query: 395 PVEESEATHYQLGIACA----QIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST 450
              +SEA    LG        Q+H+NYI++QT D LVIVDQHAAHERL++E ++   +S 
Sbjct: 437 RAGQSEAAETLLGAVLGAARAQVHENYIVAQTRDSLVIVDQHAAHERLVYEALKNALHSR 496

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
            + SQ LL PEIIDL E +   +  H E L R G+  ERFGP A+A+RE P++L + N+ 
Sbjct: 497 PVPSQMLLLPEIIDLPEEDAERLAMHSETLARFGLGIERFGPGAVAVRETPSMLGETNVG 556

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
           QL+RD+ DEI D+ T  TL++R++ I ATMAC+GS+RSGR ++  EMN LLR+ME  P S
Sbjct: 557 QLVRDLADEIADNDTVETLKERLDKIAATMACHGSVRSGRLLKPEEMNALLRQMEATPGS 616

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
             CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 617 GTCNHGRPTYIELKLADIERLFGR 640


>gi|294675823|ref|YP_003576438.1| DNA mismatch repair protein MutL [Rhodobacter capsulatus SB 1003]
 gi|294474643|gb|ADE84031.1| DNA mismatch repair protein MutL [Rhodobacter capsulatus SB 1003]
          Length = 617

 Score =  551 bits (1420), Expect = e-154,   Method: Composition-based stats.
 Identities = 273/604 (45%), Positives = 389/604 (64%), Gaps = 14/604 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +   N+IAAGE++ERP+ A+KEL+EN+LDA +SR+E   A GGK+  +I+D+G G
Sbjct: 15  IRQLDDAAANRIAAGEVVERPASAVKELVENALDAGASRIEIAYADGGKTLIRISDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT+E++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR       AQI
Sbjct: 75  MTAEDLPLALCRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLTITSRAEGFE-AAQI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +SG +I +V+P A+N GT+VE+RDLFF  PARL FL++++ E   I D ++R+A+A P 
Sbjct: 134 TVSGGRIGAVKPAALNRGTVVELRDLFFATPARLKFLRTDRTEAQAIADTVKRLAMAEPY 193

Query: 182 VSFTFSTIKSNRYKMNFQST------NGNFPERISQVIGEDFINNAVELNEKSNEITLQG 235
           VSFT   I  +  +  F++        G    R+ +++G  F +NAV L+     I L G
Sbjct: 194 VSFTLREIAGSETREIFRADAEQGELFGALSGRLGRILGRAFADNAVPLDADREGIRLTG 253

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y  +PT++RG A + ++F+NGR V+DK +L  +R AY + +   R+P  VL L  DP  V
Sbjct: 254 YAALPTYSRGAAVEQFLFVNGRPVRDKMLLGALRAAYIDVLSRDRHPAAVLFLTCDPESV 313

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL 355
           DVNVHPAK+ +RFR   + R  I+  I+ A+ + G  +SS ++   + +   + A +  +
Sbjct: 314 DVNVHPAKAEVRFREAGVPRGLIVTGIRHALAQSGHRSSSTVATATLGAMQPEPA-QPRI 372

Query: 356 PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEES-----EATHYQLGIAC 410
            +     +      F  +  L + D  P         +  VE +     E  H  LG A 
Sbjct: 373 YQMERPSSGAIRNAFAAQMPLQSFDEAPQPFTAPFAPSARVEPAPPGTAELIHRPLGAAR 432

Query: 411 AQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGEC 470
           AQ+H+NYII+QT  G+VIVDQHAAHERL++E+++       I +Q LL PEI++L   E 
Sbjct: 433 AQLHENYIIAQTERGMVIVDQHAAHERLVYERLKAQSAEKGIAAQALLIPEIVELSAAEA 492

Query: 471 ALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQ 530
           A +++  E+LHRLG+  E FG +AIA+RE PAIL + N   LLRDI+DE+ D   +  LQ
Sbjct: 493 ARLLDVAEELHRLGLAIEPFGGSAIAVRETPAILGEINAAALLRDILDELADQGDSLRLQ 552

Query: 531 DRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEK 590
            +I+ +L+ M+C+GSIRSGR+M+  EMN LLREME  P S QCNHGRPT+++LKLSDIE+
Sbjct: 553 SKIDAVLSRMSCHGSIRSGRQMRVEEMNALLREMEATPLSGQCNHGRPTYVELKLSDIER 612

Query: 591 LFGR 594
           LFGR
Sbjct: 613 LFGR 616


>gi|126727787|ref|ZP_01743617.1| DNA mismatch repair protein [Rhodobacterales bacterium HTCC2150]
 gi|126702914|gb|EBA02017.1| DNA mismatch repair protein [Rhodobacterales bacterium HTCC2150]
          Length = 617

 Score =  551 bits (1420), Expect = e-154,   Method: Composition-based stats.
 Identities = 252/603 (41%), Positives = 391/603 (64%), Gaps = 10/603 (1%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR+L E  +N+IAAGE++ERP+ A+KEL+EN++DA ++R++   A GGK+  ++ D+G 
Sbjct: 14  QIRQLDEAAVNRIAAGEVVERPASAVKELVENAIDAGATRIDVSYAAGGKNLIRVVDDGH 73

Query: 62  GMTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           G+T++E+P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  L+L+SR   +++  +
Sbjct: 74  GITADELPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLSLVSRAIGSDSAFE 133

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I+++G   S V+P A+  GTIV + DLF+  PARL F+++++ E   I+DVI+R+A+A P
Sbjct: 134 ISVNGSIQSPVKPAALTKGTIVTLADLFYATPARLKFMRTDRSEAQAISDVIKRLAMAEP 193

Query: 181 KVSFT---FSTIKSNRYKMNFQSTNGN----FPERISQVIGEDFINNAVELNEKSNEITL 233
            V FT    S     R  +   +  G+       R+ +++G DF  NA+ +  +    TL
Sbjct: 194 HVGFTLRDVSEGGQGRVVLRLDAEQGDFFDALHSRLKRLLGADFAANALRIEAEREGHTL 253

Query: 234 QGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPR 293
            GY  +PT++RG +   ++F+NGR V+D+ ++  +R AYA+ +   R+P VVL +  DP 
Sbjct: 254 TGYAALPTYSRGTSVAQFLFVNGRPVKDRLLIGALRGAYADFLSRDRHPAVVLNISCDPA 313

Query: 294 QVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPK- 352
           +VDVNVHPAKS +RFR+P + R  I+  ++ A+   G   S+ ++   + +F Q+     
Sbjct: 314 RVDVNVHPAKSEVRFRDPGLARGLIVSGLKHALAGAGHRASTTVADATLGAFTQEPVQGR 373

Query: 353 -THLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACA 411
              + + ++S       +   ++     +  P  + T +         E     LG A A
Sbjct: 374 VYQMDRPSSSAIGRSFAMQSLDSSFGFAEANPDFNATSARVEMAEAAPELLDRPLGAARA 433

Query: 412 QIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECA 471
           Q+H+NYI++QT DG+++VDQHAAHERL++EK++       + +Q LL PEII+L  G+  
Sbjct: 434 QVHENYIVAQTRDGMILVDQHAAHERLVYEKLKNQMAENGVAAQALLIPEIIELSVGDRD 493

Query: 472 LIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQD 531
           LI+E   DL  LG++ E FG  AIAIR  PA+L + N   ++ D++DE+ D   + +L++
Sbjct: 494 LILEMAGDLAALGLEMEPFGGTAIAIRATPAVLGEVNAAAMIHDVLDELSDQGESRSLRE 553

Query: 532 RIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKL 591
           RIE +L+ +AC+GSIRSGR+MQ+ EMN LLREME  P+S QCNHGRPT+++LKL+DIE+L
Sbjct: 554 RIEAVLSRIACHGSIRSGRRMQADEMNALLREMEATPHSGQCNHGRPTYVELKLADIERL 613

Query: 592 FGR 594
           FGR
Sbjct: 614 FGR 616


>gi|300024107|ref|YP_003756718.1| DNA mismatch repair protein MutL [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525928|gb|ADJ24397.1| DNA mismatch repair protein MutL [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 593

 Score =  551 bits (1419), Expect = e-154,   Method: Composition-based stats.
 Identities = 239/600 (39%), Positives = 376/600 (62%), Gaps = 14/600 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+LS + +N+IAAGE+IERP+  +KEL+EN++D+ ++ +E V+  GG S  ++TD+G
Sbjct: 1   MAIRQLSPETVNRIAAGEVIERPASVVKELVENAIDSGATHIEIVVTDGGLSLIRVTDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM ++++ +AV+RH TSK+  +D  +I + GFRGEALPSIG+++ L + SR   +  G 
Sbjct: 61  SGMNADDLALAVERHATSKLDEEDLFDIRSLGFRGEALPSIGSIAELEIRSRRRDSEQGF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            I +      S++P A N GTIVEVRDLF   PARL FLKSE+ ET  +TDV+RR+A+A+
Sbjct: 121 SIRVMRGAKESIKPAAANSGTIVEVRDLFSATPARLKFLKSERAETMAVTDVVRRLAMAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGN-FPERISQVIGEDFINNAVELNE----KSNEITLQ 234
           P++ FT  T +           + + + ER+  ++G +F+ +A+E++         + + 
Sbjct: 181 PEIGFTLQTGEKRPVVYPRGERSSSAWLERLGAIMGHEFMADALEISGGGSGALGPMRVF 240

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           G+ G+PT +R ++ Q ++F+NGR+V+DK ++  IR AY + IP GR P++ + L++ P  
Sbjct: 241 GFIGLPTLHRADSMQQFLFVNGRSVKDKLLIGAIRAAYGDLIPRGRSPLLAIFLDVAPPD 300

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAK+ +RFR+   +R+ +I ++++A+   G   S+      I +F         
Sbjct: 301 VDVNVHPAKAEVRFRDAGRVRSLMIGAMRQALEAAGHRASAQGGVLTIETF------SAG 354

Query: 355 LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIH 414
           +   A      Q   F +   ++  ++        + + +  E++      LG   AQ+H
Sbjct: 355 VLPSAPPALPPQTAAFAEPAPVAFAEIDTPSADMRAPEPERHEQT--IDKPLGAVRAQVH 412

Query: 415 QNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIM 474
           +NYI++QT DGLVIVDQHAAHERL++EK +    +  + +Q LL P I+ L   +  L+ 
Sbjct: 413 ENYIVAQTRDGLVIVDQHAAHERLVYEKFKVALTNGGVATQGLLIPAIVTLDPDDAELLC 472

Query: 475 EHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIE 534
              ++L  LG+  E FG  A+A+RE PA+L   +I  L++D+  E+    T   L+DR+E
Sbjct: 473 TRADELAELGLVLESFGEGAVAVRETPALLGDTDIDGLVKDLAAELRADGTARALKDRLE 532

Query: 535 NILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            + + MAC+GS+RSGR++   EMN LLR+ME  P S QCNHGRPT++ LKLSDIE+LFGR
Sbjct: 533 AVASRMACHGSVRSGRRLTVEEMNALLRQMEATPYSGQCNHGRPTYVALKLSDIERLFGR 592


>gi|222147678|ref|YP_002548635.1| DNA mismatch repair protein [Agrobacterium vitis S4]
 gi|254766154|sp|B9JSD6|MUTL_AGRVS RecName: Full=DNA mismatch repair protein mutL
 gi|221734666|gb|ACM35629.1| DNA mismatch repair protein MutL [Agrobacterium vitis S4]
          Length = 617

 Score =  551 bits (1419), Expect = e-154,   Method: Composition-based stats.
 Identities = 295/618 (47%), Positives = 410/618 (66%), Gaps = 26/618 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I++LSE +INQIAAGE+IERP+ A KELIEN++DA +SR+E   AGGGK+  +ITDNG
Sbjct: 1   MSIKQLSETLINQIAAGEVIERPASAAKELIENAIDAGASRIEIATAGGGKALLRITDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM  +++ +AV+RHCTSK+++   +I + GFRGEALPSIG+V+ LT+ SR   + +  Q
Sbjct: 61  CGMDGQDLALAVRRHCTSKLNESLMDIKSLGFRGEALPSIGSVARLTIASRRADSASAFQ 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA+ G K+  VRP   NPGT+VEVRDLFF  PARL FLK+E+ E   IT++++RMAIA+P
Sbjct: 121 IAVEGGKVGEVRPAPGNPGTVVEVRDLFFATPARLKFLKTERAEAAAITEMVKRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
           K+ F  S   S+R  +   +T  +   RI+QV+G DF +NA+ L+ +  ++ L G+ G+P
Sbjct: 181 KIRFVLS--GSDRSTLELPATGDDHLARIAQVLGPDFRDNAIALDAEREDVHLGGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+   Y F+NGR VQDK ILS IR AYAET+P GRYPV VL L +DP  VDVNVH
Sbjct: 239 TFNRGNSAHQYAFVNGRPVQDKLILSAIRGAYAETVPHGRYPVAVLALTVDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           PAKS +RFR+P ++R  I+ +I++++ ++G  +S+  +  M+ +F             A 
Sbjct: 299 PAKSDVRFRDPGLVRGLIVGAIRQSLTREGDRSSTAGAGAMLRAFRPGANGGFSEGAQAA 358

Query: 361 SLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDND-------------------PVEESEA 401
           +  +       +  + S   +  S      +  +                    + E  A
Sbjct: 359 ANNSYAPAYGARPPQPSAWSVDTSPHRPLDDGQNRFDGLALPAARADAHVSPSQISEPVA 418

Query: 402 THYQLGIA-----CAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQT 456
              + G        AQ+H NYI++QT DGLVIVDQHAAHERL+FE MR+  +  ++ SQ 
Sbjct: 419 MAMESGRFRLGAARAQVHANYIVAQTQDGLVIVDQHAAHERLVFEDMRKALSGRRLPSQG 478

Query: 457 LLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDI 516
           LL PEII L E +C  +M+H E+L RLG+  ERFGP AIA+RE PA+L + ++P L+R +
Sbjct: 479 LLIPEIIGLPEEDCDRLMDHAENLDRLGLAIERFGPGAIAVRETPAMLGEVDVPGLVRQL 538

Query: 517 IDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHG 576
            DEI +  T  +L  R+E++ ATMAC+GS+RSGR ++  EMN LLR+ME+ P S QCNHG
Sbjct: 539 ADEIAEWETAGSLFARLEHVAATMACHGSVRSGRLLRVEEMNALLRKMEETPGSGQCNHG 598

Query: 577 RPTFIKLKLSDIEKLFGR 594
           RPT+I+LKLSDIE+LFGR
Sbjct: 599 RPTYIELKLSDIERLFGR 616


>gi|146342898|ref|YP_001207946.1| DNA mismatch repair protein [Bradyrhizobium sp. ORS278]
 gi|166232077|sp|A4Z0Q5|MUTL_BRASO RecName: Full=DNA mismatch repair protein mutL
 gi|146195704|emb|CAL79731.1| DNA mismatch repair protein MutL [Bradyrhizobium sp. ORS278]
          Length = 613

 Score =  551 bits (1419), Expect = e-154,   Method: Composition-based stats.
 Identities = 234/612 (38%), Positives = 366/612 (59%), Gaps = 18/612 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E++IN+IAAGE++ERP+  +KEL+EN++DA +SR++    GGG+    ITD+G
Sbjct: 1   MPVRQLPEQVINRIAAGEVVERPASVVKELVENAIDAGASRIDIFTDGGGRRKIAITDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT+ ++ +AV+RH TSK+ D D   I T GFRGEALPSIG+V+ L++ +R        
Sbjct: 61  GGMTAADLALAVERHATSKLDDEDLLQIRTLGFRGEALPSIGSVARLSITTRHKSEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            I +     S + P A+N GT VEV DLF   PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 GITVDCGDKSQIVPAALNQGTRVEVADLFHATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           P ++FT +  +                  R+  ++G DF ++A+ +  + + + ++G+  
Sbjct: 181 PDIAFTVAGEERAPVTWAAALPGAPGQLTRLGDILGTDFRSHAIAVRSERDHVAVEGFAA 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P   R NA   Y+F+NGR V+DK IL  +R AYA+ +P  R+PVV L + +DPR+VD N
Sbjct: 241 APALTRANALGQYLFVNGRPVRDKLILGAVRAAYADYLPRDRHPVVALFVTLDPREVDAN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLP-- 356
           VHPAK+ +RFRN  ++R  II ++++ + ++G  T++      I++F     P       
Sbjct: 301 VHPAKTEVRFRNAGLVRALIIHALKEGLAREGRRTAANDGGATIAAFRPAFTPPRPSAGP 360

Query: 357 ------KYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYS--------EDNDPVEESEAT 402
                 +  ++     + +      +S+          +           ++     +  
Sbjct: 361 MNWDWQRSPSAPIPRHDDVDSMPPAVSSAAFAEPMQAAFDVGGPRADLRLHEQPAAPDML 420

Query: 403 HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEI 462
              LG A  QIH  YI+SQT DGLVIVDQHAAHER+++E+++    +  +  Q LL P+I
Sbjct: 421 DRPLGAARTQIHDTYIVSQTRDGLVIVDQHAAHERIVYERLKTSLAAHGVQRQILLIPDI 480

Query: 463 IDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIID 522
           ++L E     ++   ++L   G+  E FGP A+A+RE P++L K N   LLRD+ + + +
Sbjct: 481 VELDEATVEALLARTDELAAFGLAVESFGPGAVAVRETPSLLGKINAAGLLRDLAEHMEE 540

Query: 523 SSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIK 582
                 L+ R+ ++ ATMAC+GS+R+GR+++  EMN LLR ME+ PNS QCNHGRPT+++
Sbjct: 541 WGEALPLERRLMHVAATMACHGSVRAGRRLKPEEMNALLRVMEETPNSGQCNHGRPTYVE 600

Query: 583 LKLSDIEKLFGR 594
           LKL+D+EKLFGR
Sbjct: 601 LKLADVEKLFGR 612


>gi|254462767|ref|ZP_05076183.1| DNA mismatch repair protein MutL [Rhodobacterales bacterium
           HTCC2083]
 gi|206679356|gb|EDZ43843.1| DNA mismatch repair protein MutL [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 609

 Score =  550 bits (1418), Expect = e-154,   Method: Composition-based stats.
 Identities = 257/600 (42%), Positives = 390/600 (65%), Gaps = 14/600 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA + R+E   A GGK+  ++ D+G G
Sbjct: 15  IRQLDDAAINRIAAGEVVERPASAVKELVENAIDAGAHRIEVAYADGGKTLIRVVDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           +  + +P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT++SR   ++   +I
Sbjct: 75  IIPQALPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLTIISRAVGHD-AFEI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           A++G  +S+V+P A++ GT+VE+RDLFF  PARL F+++++ E+  ITDV++R+A+A P 
Sbjct: 134 AVNGGAMSAVKPAALSKGTVVELRDLFFATPARLKFMRTDRAESQAITDVVKRLAMAEPF 193

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT    +     R      + +G+  +    R++ +IG +F +N++ +  +   + L 
Sbjct: 194 VGFTLRDVTGGGEGRVTFRADAESGDLFDALYGRLAGIIGREFADNSLRIEAEREGLHLT 253

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           G+  +PT++RG+A   Y+F+NGR V+DK +   +R AY + +   R+P   L L+ DP+ 
Sbjct: 254 GFAALPTYSRGSAVTQYLFVNGRPVRDKLLYGALRGAYFDFLSRDRHPAAALFLDCDPQL 313

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR+P + R  I+ +++ A+ + G   S+ ++   + +   +      
Sbjct: 314 VDVNVHPAKSEVRFRDPGLARGLIVSALRHALAEAGHRASTTVADATLGAMRPEQTGPAR 373

Query: 355 LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIH 414
           + +      +   +  L+ +              +S     VEE  A  + LG A  Q+H
Sbjct: 374 VYQM-----DRPSQGALRASYQVQAPGFGETAGVFSRVEPLVEEPPAEQFPLGAARGQVH 428

Query: 415 QNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIM 474
           +NYII+QT DG+VIVDQHAAHERL++EK++       + +Q LL PEI++L + +CA +M
Sbjct: 429 ENYIIAQTADGMVIVDQHAAHERLVYEKLKDQMAENGVAAQALLIPEIVELSDNDCARLM 488

Query: 475 EHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIE 534
           E   DL RLG+  ERFG  AIA+RE PAIL + N   +L DI+DE+ D   +  LQ +IE
Sbjct: 489 EIATDLERLGLGIERFGGGAIAVRETPAILGEVNAKAMLLDILDELTDQGESIALQAKIE 548

Query: 535 NILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            IL+ +AC+GSIRSGR+M+  EMN LLREME  P+S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 549 AILSRVACHGSIRSGRRMRGEEMNALLREMEATPHSGQCNHGRPTYVELKLADIERLFGR 608


>gi|283856238|ref|YP_162089.2| DNA mismatch repair protein [Zymomonas mobilis subsp. mobilis ZM4]
 gi|283775233|gb|AAV88978.2| DNA mismatch repair protein MutL [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 613

 Score =  550 bits (1418), Expect = e-154,   Method: Composition-based stats.
 Identities = 216/615 (35%), Positives = 363/615 (59%), Gaps = 24/615 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +IN+IAAGE++ERP+ A+KEL+EN++DA+S+R+   +  GG    ++ DNG
Sbjct: 1   MSIRRLPEDVINRIAAGEVVERPASALKELVENAIDAQSTRILIRLLKGGLDGIEVIDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD--FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+ ++E+ +A++RH TSK+ D+     + T GFRGEALPSI +V+ LTL SR   +++G
Sbjct: 61  IGIPADEMRLALERHATSKLPDNDAIEAVTTLGFRGEALPSIASVARLTLESRTADSDSG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +I +            +  GT ++V  LF  IPAR  F++S + E     DV+RR+A+ 
Sbjct: 121 WKIIVDNGHFEKEGIAPLPKGTRIKVDSLFARIPARRKFMRSAKSEYMACHDVVRRLAMT 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P ++F+        + +N      +   R++ +I     +N+V +  + +++ L+G   
Sbjct: 181 RPDIAFSLEHDGRRIFSLN---GGESRQRRVAALIDRTLKDNSVAVEYQRDQMQLEGVAS 237

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+RG A+  Y+F+NGR V+D+ ++ ++R AY + +   R+PV+ L L +    VD+N
Sbjct: 238 LPTFHRGLADHQYLFVNGRPVKDRLLIGSVRAAYHDLLAKDRHPVLALFLTLPNSDVDIN 297

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDN---APKTHL 355
           VHPAK  +RFR+   +R+ I+ +++++++  G  ++     + +  + + +   AP   +
Sbjct: 298 VHPAKGEVRFRDSQAVRSLIVGALRESLDLSGFRSAQPADVQAMGKWQKSSELAAPSKAV 357

Query: 356 PKYATSLTNTQEKLFLQENRLST----------------NDLLPSDDPTYSEDNDPVEES 399
           P + +  + +   L  +   +                                N   + S
Sbjct: 358 PSHESRQSLSDSGLLFKSRTIEAPKATSIPTPQGTASDLWSAATKSPLPPMGRNSATDSS 417

Query: 400 EATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLT 459
           E + + LG+A  QI   YII+++ DGLVIVDQHAAHERL+ E+MR+   + ++TSQ LL 
Sbjct: 418 EQSDFPLGLARGQIAATYIIAESKDGLVIVDQHAAHERLVMERMRRALQNGQVTSQRLLM 477

Query: 460 PEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDE 519
           P+++++ E  C L  +  ++   +G++ ERFG  AI +R  PA+L    +  +++D+  E
Sbjct: 478 PDVVEMDEVSCDLFEQRQDEFAAMGLETERFGHEAILVRATPAMLGNCEVKAMIKDLAAE 537

Query: 520 IIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPT 579
           I     +  L+++ ++I+ATMAC+GS+R+GR +   EMN LLREME  P+S QCNHGRPT
Sbjct: 538 IAAYDQSLLLKEKFDHIVATMACHGSVRAGRLLSIAEMNALLREMEITPHSGQCNHGRPT 597

Query: 580 FIKLKLSDIEKLFGR 594
           ++KL   DIEKLFGR
Sbjct: 598 WVKLGHKDIEKLFGR 612


>gi|163867560|ref|YP_001608759.1| DNA mismatch repair protein [Bartonella tribocorum CIP 105476]
 gi|189030391|sp|A9IN82|MUTL_BART1 RecName: Full=DNA mismatch repair protein mutL
 gi|161017206|emb|CAK00764.1| DNA mismatch repair protein MutL [Bartonella tribocorum CIP 105476]
          Length = 617

 Score =  550 bits (1418), Expect = e-154,   Method: Composition-based stats.
 Identities = 268/616 (43%), Positives = 402/616 (65%), Gaps = 22/616 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  +KEL+EN++DA ++R+E + A GGK+F +++DNG
Sbjct: 1   MIIRHLSENIINQIAAGEVIERPANVVKELVENAIDAGATRIEIITANGGKNFIKVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++++ +AV RHCTSKI+DD  NI   GFRGEALPSIG+V+ L L+SR  +    A+
Sbjct: 61  CGIPADQLTLAVSRHCTSKITDDVHNICFLGFRGEALPSIGSVAKLKLISRTKEAENAAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I+++  KI   +P A N GTIVEVRDLFF  PARL F+K+++ ETN I+D+I+R+AIA+P
Sbjct: 121 ISVTAGKIVGPKPAAANLGTIVEVRDLFFVTPARLKFMKTDRAETNAISDMIKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGN-FPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ S +     +++    N     +RI+Q++G++F  N++ L+ +   + L G+  +
Sbjct: 181 HIRFSLSGLDRTSMELSATENNTQGQLQRITQIMGKEFAPNSIALDAERESVRLTGFACL 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNR N+   + ++NGR V+DKF+   IR AYA+ +   RYPV +L +++ P +VDVNV
Sbjct: 241 PSFNRNNSLHQFAYVNGRPVRDKFLWGAIRGAYADVMTRDRYPVAILFIDLPPAEVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ----------DN 349
           HPAK+ +RFR+P +IR  I+ +I++A+ + GI  +S  S+ M+++F            + 
Sbjct: 301 HPAKADVRFRDPGLIRGLIVGAIREALQQSGIRPTSTRSEAMLAAFQTQKPLTQQSLGNF 360

Query: 350 APKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTY-----------SEDNDPVEE 398
                   Y+    +      + +   STN     ++ T            +     +  
Sbjct: 361 KNAHQSSSYSPQSHHFATASMVHKPLDSTNSFGLKENATPIMEGLNTPSGDAYIPSTIPS 420

Query: 399 SEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLL 458
           SE   Y LG A AQIH+NYII+QT D L+IVDQHAAHERL++E ++    +  + SQ LL
Sbjct: 421 SEELSYPLGAARAQIHKNYIIAQTQDSLIIVDQHAAHERLVYEALKNALYAKPLPSQLLL 480

Query: 459 TPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIID 518
            PEI++L E +   ++ H + L + G+  E FGP AI +RE P++L K N+  L++D+ D
Sbjct: 481 IPEIVELSEEDATCLLTHKDALQKFGLGIEPFGPGAILVRETPSMLGKINVQALIKDLAD 540

Query: 519 EIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRP 578
           E  +  TT  L+  ++ + ATMAC+GSIRSGR ++  EMNRLLR+ME  PN+S CNHGRP
Sbjct: 541 EAAEYDTTNNLKAMLDYVAATMACHGSIRSGRLLRPEEMNRLLRQMEAIPNTSTCNHGRP 600

Query: 579 TFIKLKLSDIEKLFGR 594
           T+I+LKL+DIE+LFGR
Sbjct: 601 TYIELKLADIERLFGR 616


>gi|16124948|ref|NP_419512.1| DNA mismatch repair protein [Caulobacter crescentus CB15]
 gi|221233668|ref|YP_002516104.1| DNA mismatch repair protein [Caulobacter crescentus NA1000]
 gi|239977506|sp|B8H173|MUTL_CAUCN RecName: Full=DNA mismatch repair protein mutL
 gi|239977507|sp|P0CAV5|MUTL_CAUCR RecName: Full=DNA mismatch repair protein mutL
 gi|13421916|gb|AAK22680.1| DNA mismatch repair protein MutL [Caulobacter crescentus CB15]
 gi|220962840|gb|ACL94196.1| DNA mismatch repair protein mutL [Caulobacter crescentus NA1000]
          Length = 637

 Score =  550 bits (1418), Expect = e-154,   Method: Composition-based stats.
 Identities = 239/636 (37%), Positives = 372/636 (58%), Gaps = 42/636 (6%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L  + +N+IAAGE++ERP+ AIKEL++N++DA ++R+E    GGG +   + D+G
Sbjct: 1   MPIRRLPPETVNRIAAGEVVERPASAIKELVDNAIDAGATRIEVEAHGGGLTRILVADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD------FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQ 114
            G++ EE+P+A++RH TSK++ D         IHT GFRGEALPSIG+V+ L + SR   
Sbjct: 61  CGLSPEELPVAIERHATSKLAPDADGLWDLLRIHTMGFRGEALPSIGSVARLQISSRAKG 120

Query: 115 NNTGAQIAISGEKISSVRPV--AMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVI 172
                 I + G ++  V P       G  +EVRDLF+  PARL F+KSE+ E   IT+ I
Sbjct: 121 AKDAFSILVEGGQVGEVAPAAFPGPHGARIEVRDLFYATPARLKFMKSERAEALAITEEI 180

Query: 173 RRMAIAYPKVSFTFSTIKSNRYKMNF-QSTNGNFPERISQVIGEDFINNAVELNEKSNEI 231
           +R A+A   V F+         ++            R++ V+G +F  NA+E+++  + +
Sbjct: 181 KRQAMANESVGFSLDIDGRRVLRLPPEHPGPQGRLARLAAVLGREFQENALEIDQTRDGV 240

Query: 232 TLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEID 291
            L G+ G+PT+NRGNA   Y+F+NGR V+D+ +   +R AYA+ +   R+P   L + ++
Sbjct: 241 RLSGFAGLPTYNRGNAAHQYLFVNGRPVRDRLLQGALRAAYADFLARDRHPTAALYVTLE 300

Query: 292 PRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAP 351
             +VDVNVHPAK+ +RFR+P ++R  I+ +++ A+   G   S+ ++ + + S     +P
Sbjct: 301 TTEVDVNVHPAKAEVRFRDPALVRGLIVGALRHALAGAGHRASTTVAAQALDSIRAQQSP 360

Query: 352 KT-HLPKYATSLTNTQEKLFLQENRLSTNDLLPS-------------------------- 384
              + P+Y    +      + +                                      
Sbjct: 361 FPGYQPQYQPGPSPAGFSAWREGGWTPPTQRPMDLPGLNEVSARVEPSYGGDLAGVVREA 420

Query: 385 ------DDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERL 438
                 +D   ++        +   Y LG A AQ+H+ YI++QT DG+VIVDQHAAHERL
Sbjct: 421 YAAAAFEDRPPTDYPGATAPFDPVDYPLGAARAQVHETYIVAQTRDGMVIVDQHAAHERL 480

Query: 439 IFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIR 498
           ++E+M+ +  S  +T QTLL PE++DL   E   ++   E+L  LG+  E FGP A+ +R
Sbjct: 481 VYERMKGEMASGGVTRQTLLLPEVVDLDPAEAERVVARAEELAGLGLVLESFGPGAVLVR 540

Query: 499 EIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMN 558
           E PA+L K +   L+RDI D++ ++     L++R+E + +TMAC+GS+R+GR++   EMN
Sbjct: 541 ETPALLGKTDAAALVRDIADDLAENGQALALKERLEEVCSTMACHGSVRAGRRLNGAEMN 600

Query: 559 RLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            LLREME  P+S QCNHGRPT+++LKL+DIEKLFGR
Sbjct: 601 ALLREMEATPHSGQCNHGRPTYVELKLADIEKLFGR 636


>gi|313201103|ref|YP_004039761.1| DNA mismatch repair protein mutl [Methylovorus sp. MP688]
 gi|312440419|gb|ADQ84525.1| DNA mismatch repair protein MutL [Methylovorus sp. MP688]
          Length = 624

 Score =  550 bits (1418), Expect = e-154,   Method: Composition-based stats.
 Identities = 210/623 (33%), Positives = 334/623 (53%), Gaps = 35/623 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L +++I+QIAAGE++ERP+ A+KEL+ENSLDA SS +   +  GG    ++TD+G G
Sbjct: 4   IKLLPDQLISQIAAGEVVERPASALKELLENSLDAGSSDIAVTLGQGGVKLLRVTDDGNG 63

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  +++ +A+ RH TSKI+  DD  ++ + GFRGEAL SI ++S  ++ SR  + +   +
Sbjct: 64  IPHDDLTLALTRHATSKIASLDDLESVASLGFRGEALASIASISRTSITSRHAEASHAWR 123

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA  G  +    P A++ GTIVEV+D++F  PAR  FLK+EQ E     +  RR+A++ P
Sbjct: 124 IAADGGLLGDAAPAALDRGTIVEVQDIYFNTPARRKFLKTEQTEFGHCEEAFRRIALSRP 183

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V F          ++      G    R ++V+G DF   A EL+E +  + L G    P
Sbjct: 184 DVGFMLQHNGRALMRL----APGEAKRRFTEVLGPDFSAEAFELDESAGGLRLWGMAAKP 239

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TF+R   +  YV++NGR V+DK I   IR AY + +   R+P   L LE+DP  VDVNVH
Sbjct: 240 TFSRSARDTQYVYVNGRFVRDKLISHAIRQAYQDVLHHDRHPAFALFLELDPTLVDVNVH 299

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKK-----------GISTSSVLSKKMISSFHQDN 349
           P+K+ +RFR    +  FI  ++ KA+               ++  +      I +     
Sbjct: 300 PSKTEVRFREGQAVHRFIFHALHKALATPVGLPANGLVPPPVAAPATSYSSGIPAGQPYP 359

Query: 350 APKTHLPKYATSLTNTQEKLFLQENRLS------------TNDLLPSDDPTYSEDNDPVE 397
             +      A       + LF    R +            ++  L +        +    
Sbjct: 360 RQQGSFDLRANEAPGFYQTLFGGLPREAVDTASSFVPSAISSADLQATLSPSQASSSLSP 419

Query: 398 ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTL 457
           E  A  Y LG A AQ+H  Y+++Q   GL++VD HAAHER+++E+++   +   +  Q L
Sbjct: 420 EQAAQEYPLGFALAQLHGVYVLAQNAQGLIVVDMHAAHERIMYERLKNALDGDSVPMQPL 479

Query: 458 LTPEIIDLLEGECALIMEH------DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQ 511
           L P   +    E A + E        + LH+LG +  +  P+ +A+R IPA+L   +   
Sbjct: 480 LLPVSFNADRFEVATVQEQLSTPEGQQTLHQLGFEIVQLSPSTLAVRAIPAMLQDADAVA 539

Query: 512 LLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSS 571
           L RD++ ++ +   +  L +R   +LATMAC+ ++R+ R +   EMN LLR+ME    S 
Sbjct: 540 LARDVLRDLREYGGSRVLTERRNELLATMACHAAVRANRILSIQEMNALLRDMEATERSG 599

Query: 572 QCNHGRPTFIKLKLSDIEKLFGR 594
           QCNHGRPT+ +  ++D++K+F R
Sbjct: 600 QCNHGRPTWFQATMADLDKMFMR 622


>gi|241664014|ref|YP_002982374.1| DNA mismatch repair protein [Ralstonia pickettii 12D]
 gi|240866041|gb|ACS63702.1| DNA mismatch repair protein MutL [Ralstonia pickettii 12D]
          Length = 635

 Score =  550 bits (1417), Expect = e-154,   Method: Composition-based stats.
 Identities = 201/631 (31%), Positives = 331/631 (52%), Gaps = 45/631 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            IR L +++I+QIAAGE++ERP+  +KEL+EN+LDA +++++  +  GG     ITDNG 
Sbjct: 10  PIRPLPDQLISQIAAGEVVERPASVVKELLENALDAGATQLQIKLEEGGVRRIAITDNGV 69

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++E+P+A+ RH TSKI   ++  ++ T GFRGEAL SI +V+ LTL SR   +    
Sbjct: 70  GIPADELPVALMRHATSKIGSLEELESVATLGFRGEALASIASVAELTLTSRTANDAHAT 129

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI     +    +P +   GT V+V+ L+F  PAR  FLK+EQ E     +VIRR A+A 
Sbjct: 130 QI---IAQTGRAQPASGGVGTTVDVQHLYFNTPARRKFLKTEQTELGHCMEVIRRTALAR 186

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V+ +           N    +     R + V+G +F    +   E + E+ L G+ G+
Sbjct: 187 PDVAISVHHNGKPLEHWNATQADS----RSAAVLGTEFARARLPFEESAGELRLFGFAGL 242

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT +RG A+  + ++NGR V+D+ +   +R+AY + +   R+P  VL LE+ P  VDVNV
Sbjct: 243 PTASRGRADHQFFYVNGRFVRDRLLTHAVRSAYEDVLHGDRFPAYVLCLELPPEAVDVNV 302

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISS-----FHQDNAPKTH 354
           HP+K  +RFR+   +  F+  ++Q+A+++        L   +  +          +P  +
Sbjct: 303 HPSKIEVRFRDSRAVHQFVYHAVQRALSRHAGEQGDSLRTDIADAHDVAGVTTAPSPADN 362

Query: 355 LPKYATSLTNTQEKLFLQENRLST-----NDLLPSDDPTYSEDNDPVEESEATH------ 403
             ++   +   Q  L + + R         D  P      +   D    +          
Sbjct: 363 TTRWINQMAARQTSLGIAQPRAEYLSMMRGDSTPMPAMRPAWMTDVPSAATLFDGGTATA 422

Query: 404 --------------------YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKM 443
                               + LG A AQ+H  Y+++Q T G+V+VD HAAHER+++E++
Sbjct: 423 QAAAAVAEPVAAPPADNDDAHPLGFAVAQLHGIYVLAQNTRGMVLVDMHAAHERILYEQL 482

Query: 444 RQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAI 503
           +    + ++  Q LL P        E     E  + L  LG       P  +A+R +P +
Sbjct: 483 KTALEARRVEVQPLLIPVTFAASPVEIGTAEEFRDTLTLLGFDISAVSPTTLAVRSVPTL 542

Query: 504 LSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLRE 563
           L K +   L RD++ ++     +  L +R   +LAT+AC+ ++R+ R++   EMN LLR+
Sbjct: 543 LQKADAQALARDVLRDLHAYGGSRVLAERQNELLATLACHSAVRANRRLNLDEMNALLRQ 602

Query: 564 MEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ME    + QCNHGRPT+I+L ++D+++LF R
Sbjct: 603 MEATERADQCNHGRPTWIQLTVADLDRLFLR 633


>gi|254450749|ref|ZP_05064186.1| DNA mismatch repair protein MutL [Octadecabacter antarcticus 238]
 gi|198265155|gb|EDY89425.1| DNA mismatch repair protein MutL [Octadecabacter antarcticus 238]
          Length = 621

 Score =  550 bits (1417), Expect = e-154,   Method: Composition-based stats.
 Identities = 258/600 (43%), Positives = 394/600 (65%), Gaps = 16/600 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+  +KELIEN+LDA +SRVE  +A GGK+  ++TDNG G
Sbjct: 29  IRQLDDAAINRIAAGEVVERPASVVKELIENALDARASRVEVFVADGGKTLIRVTDNGVG 88

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT++++P+A+ RH TSKI   D  NIH+FGFRGEALPS+GAV  LT+ SR      G +I
Sbjct: 89  MTAQDLPLALSRHATSKIDGSDLLNIHSFGFRGEALPSLGAVGRLTIRSRTNGGE-GCEI 147

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           ++SG   ++VRP A+  GTIVE+RDLF+  PARL FL++++ E   I++V++R+A+A P 
Sbjct: 148 SVSGGAHTAVRPAALTAGTIVELRDLFYATPARLKFLRTDRAEMQAISEVVKRLAMAEPF 207

Query: 182 VSF--TFSTIKSNRYKMNFQSTNGNFPERISQ----VIGEDFINNAVELNEKSNEITLQG 235
           V+F  T  +   +R         G+  + +      V+G+DF  NA+ ++ + + + L G
Sbjct: 208 VTFVLTDVSGGKSRVTFRADGETGDMFDALHARLRGVLGKDFAENALAIDAQRDGVHLTG 267

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           +  +PT++RG+A Q ++++NGR V+DK ++  +R AY +T+   R+P   L ++++P +V
Sbjct: 268 FAALPTYSRGSAVQQFLYVNGRPVRDKVLIGALRGAYMDTLSRDRHPAACLFIDVEPTRV 327

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA-PKTH 354
           DVNVHPAKS +RFR+P I+R  I+ +++ A+ + G   SS ++ + + +   +   P+ +
Sbjct: 328 DVNVHPAKSEVRFRDPAIVRGLIVSALRAALAQAGHRASSTVANETLGAMQPEQTEPRVY 387

Query: 355 LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIH 414
                T              R S    +  D     E  +P +   A  + LG A AQ+H
Sbjct: 388 QMDRPTGGIGPAY-------RPSGFADMAQDMSGRVEMIEPNDGPRAEEHPLGAARAQVH 440

Query: 415 QNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIM 474
           +NYII+QT  G+VIVD HAAHERL++EK++       + +Q LL PEII++ + + A ++
Sbjct: 441 ENYIIAQTETGIVIVDGHAAHERLVYEKLKTQMAENGVAAQALLIPEIIEMSDDDAAQLL 500

Query: 475 EHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIE 534
              ++L R G+  E FG  AIA+RE PAIL + N   +LRDI+DE+ D  ++  +Q+++E
Sbjct: 501 AVADELSRFGLTIEPFGGRAIAVRETPAILGEVNAEAMLRDILDELSDQGSSTLVQEKLE 560

Query: 535 NILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            IL+ +AC+GSIR+GR M+  EMN LLREME+ P S QCNHGRPT+++LKLSDIE+LFGR
Sbjct: 561 AILSRIACHGSIRTGRSMRGEEMNALLREMERTPRSGQCNHGRPTYVELKLSDIERLFGR 620


>gi|149915456|ref|ZP_01903983.1| DNA mismatch repair protein [Roseobacter sp. AzwK-3b]
 gi|149810745|gb|EDM70586.1| DNA mismatch repair protein [Roseobacter sp. AzwK-3b]
          Length = 611

 Score =  550 bits (1417), Expect = e-154,   Method: Composition-based stats.
 Identities = 252/606 (41%), Positives = 385/606 (63%), Gaps = 17/606 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN+LDA + R++   A GGK+  ++TD+G G
Sbjct: 8   IRQLDDAAINRIAAGEVVERPASAVKELVENALDAGARRIDVAYADGGKTLIRVTDDGCG 67

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           +  + + +A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR   +   A+I
Sbjct: 68  IAPDSLALALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLTITSRARGHE-AAEI 126

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           A+SG ++  V+P A+N GTIV +RDLF   PARL F++S++ E   I D++RR+A+A P 
Sbjct: 127 AVSGGQMGKVKPAALNGGTIVTLRDLFHATPARLKFMRSDRAEAQAIGDIVRRLAMAEPF 186

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGNFPERIS----QVIGEDFINNAVELNEKSNEITLQ 234
           V FT    S     R      +  G+  + +     +++G DF +NA+ ++   + + + 
Sbjct: 187 VGFTLRDVSGGGEGRMVFRADAETGDMFDALHGRLGRILGSDFADNALRIDATRDGLRMT 246

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG+A   Y+F+NGR V+D+ ++  +R AY + +   R+P   L +E DP  
Sbjct: 247 GYAALPTYSRGSAVAQYLFVNGRPVRDRMMIGALRAAYMDVLSRDRHPAAALFVECDPML 306

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR+P + R  I+  ++ A+ + G   SS ++   + +   +  P   
Sbjct: 307 VDVNVHPAKSEVRFRDPGLARGLIVSGLRHALAEAGHRASSTVAGATLGAMRPE--PAGP 364

Query: 355 LPKYATSLTNTQEKLFLQENRLS-TNDLLPSDDPTYSEDNDPVEESEATHYQL-----GI 408
              Y     + Q ++   + +     ++  +        +DP +E+            G 
Sbjct: 365 ARVYQMDRPSAQARVAAYQAQAPGFAEMAGAFSARVEPLSDPADETATDDVPPEALPLGA 424

Query: 409 ACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEG 468
           A AQ+H+NYI++QTTDG+VIVD HAAHER+++EK+++    T + SQ LL PEI+++   
Sbjct: 425 ARAQLHENYILAQTTDGIVIVDAHAAHERIVYEKLKRQMAETGVASQALLIPEIVEMSAE 484

Query: 469 ECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYT 528
           + A ++E  EDL RLG+  E FG  A+A+RE PAIL   +   +L DI+DE+ D   + +
Sbjct: 485 DAASLLELAEDLARLGLVIEPFGGGAVAVRETPAILGACDARAMLLDILDELADQGDSGS 544

Query: 529 LQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDI 588
           +Q RIE IL+ +AC+GS+RSGR++++ EMN LLREME  P+S QCNHGRPT++ LKL+DI
Sbjct: 545 VQARIEAILSRVACHGSVRSGRRLRAEEMNALLREMEATPHSGQCNHGRPTYVDLKLADI 604

Query: 589 EKLFGR 594
           E+LFGR
Sbjct: 605 ERLFGR 610


>gi|254502767|ref|ZP_05114918.1| DNA mismatch repair protein MutL [Labrenzia alexandrii DFL-11]
 gi|222438838|gb|EEE45517.1| DNA mismatch repair protein MutL [Labrenzia alexandrii DFL-11]
          Length = 631

 Score =  550 bits (1416), Expect = e-154,   Method: Composition-based stats.
 Identities = 262/631 (41%), Positives = 396/631 (62%), Gaps = 38/631 (6%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M++R+L E++INQIAAGE+IERP+  IKEL+EN++DA +S+++ V A GGK+  ++ D+G
Sbjct: 1   MQVRQLGEQVINQIAAGEVIERPASVIKELVENAVDAGASQIDIVTAAGGKTLMRVADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM  +++ +A++RHCTSKISDD   +I T GFRGEALPSIG+V+ L + +R  + +   
Sbjct: 61  AGMRQDDLKLAIRRHCTSKISDDDLFDIRTLGFRGEALPSIGSVARLVIQTRHGEEDHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            IA+ G K   + P A + GT VEVRDLFF  PARL FLKS++ E   IT++++R+A+AY
Sbjct: 121 AIAVEGGKEQPIVPAARSKGTQVEVRDLFFATPARLKFLKSDRAEAAAITEIVKRIALAY 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P + F+ S              +     RI+Q++G DF++NA+E++     + L GY G+
Sbjct: 181 PHIGFSLSGADRQPQSWPAARGDEPHLARIAQILGPDFVDNAMEIDAAREGVRLTGYAGL 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT +RGNA   + F+NGR V+DK +LS +R AYA+ +   R+PVVVL +++DP  VDVNV
Sbjct: 241 PTHHRGNAQHQFFFVNGRPVKDKLLLSGLRGAYADVLARDRHPVVVLFIDLDPALVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HPAKS +RFR+  ++R  ++ +I+ A+ + G  +S+  +   + +  +  +P+   P  A
Sbjct: 301 HPAKSDVRFRDAQLVRGLLVGAIKHALVQAGHRSSTSNAAVALDALRKQ-SPQPGWPSGA 359

Query: 360 TSL--------------------TNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVE-- 397
           T+                              Q    + N +    +   SE  +     
Sbjct: 360 TAPAYGSAASVSASAHGFGATATAERWAPEAFQPLETAPNPVPGFAEDRVSEVQNGFSAL 419

Query: 398 --------------ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKM 443
                          SE T   LG A AQ+H+ YII+QT DG+VIVDQHAAHERL++E++
Sbjct: 420 ATPSADARAHDVPLASEKTELPLGAARAQVHETYIIAQTEDGVVIVDQHAAHERLVYERL 479

Query: 444 RQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAI 503
           ++      +  Q LL PE++DL E + A + +  EDL ++G+  E FGP AIA+RE PAI
Sbjct: 480 KEALAKKDVARQILLIPEVVDLPEEDAARLADRAEDLEKVGLSLEAFGPGAIAVRETPAI 539

Query: 504 LSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLRE 563
           L   +I  ++R + DE+ +  T  +L+++++++ ATMAC+GS+R+GR+M+  EM+ LLR+
Sbjct: 540 LGDMDIQGMVRTLADELAEWETADSLREKLDHVAATMACHGSVRAGRRMRPEEMDALLRD 599

Query: 564 MEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ME  P S QCNHGRPT+++LKLSDIEKLFGR
Sbjct: 600 MEATPLSGQCNHGRPTWVELKLSDIEKLFGR 630


>gi|73542454|ref|YP_296974.1| DNA mismatch repair protein [Ralstonia eutropha JMP134]
 gi|72119867|gb|AAZ62130.1| DNA mismatch repair protein MutL [Ralstonia eutropha JMP134]
          Length = 652

 Score =  550 bits (1416), Expect = e-154,   Method: Composition-based stats.
 Identities = 207/646 (32%), Positives = 335/646 (51%), Gaps = 62/646 (9%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            IR L +++I+QIAAGE++ERP+  +KEL+EN+LDA +S++   +  GG     ITDNG 
Sbjct: 14  PIRPLPDQLISQIAAGEVVERPASVVKELLENALDAGTSQLGIRLEEGGVRRIVITDNGC 73

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+   E+P+A+ RH TSKI+  D+   + T GFRGEAL SI +VS L+L SR   +    
Sbjct: 74  GIPPAELPVALMRHATSKIASLDELEAVLTLGFRGEALASIASVSQLSLTSRTASDAHAT 133

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q++     +   +P +   GT V+V+ L+F  PAR  FLKSEQ E     +++RR+A+A 
Sbjct: 134 QVSADTGAM---QPASGGVGTTVDVQHLYFNTPARRKFLKSEQTELGHCLEMVRRVALAR 190

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V+ +           N     G+   R +QV+G DF    + L+E++ ++ L G+ G+
Sbjct: 191 PDVAISVHHNGKPLEHWNA----GDVATRTAQVLGSDFARARLPLDEEAGDLHLYGFAGL 246

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT +RG  +Q Y F+NGR V+DK +   +R+AY + +   R+P  VL L++ P  VDVNV
Sbjct: 247 PTASRGRPDQQYFFVNGRFVRDKLLNHAVRSAYQDVLHGDRFPSYVLCLDLPPEMVDVNV 306

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLS--------------------- 338
           HP+K  +RFR    +  F+  ++Q+ + ++       L                      
Sbjct: 307 HPSKIEVRFRESRSVHQFVYHAVQRCLARQAGENGDSLHTGTDVEDVPAAGGAGELREPR 366

Query: 339 ------------------------------KKMISSFHQDNAPKTHLPKYATSLTNTQEK 368
                                         +  +    +   P+ ++P           +
Sbjct: 367 APYGGTASSGSQWINYSAARQTELGIAQPRQAYLGMVREATMPRPYVPSSQPPAWLADAQ 426

Query: 369 LFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVI 428
               +   S  D +           D  E +E   + LG A AQ+H  Y+++Q   GLV+
Sbjct: 427 AARADEPPSLLDGVAPARMALPIAEDATEGAE--DHPLGYAIAQLHGIYVLAQNARGLVL 484

Query: 429 VDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAE 488
           VD HAAHER+++E+++   ++  +  Q LL P  +     E     EH E L  LG    
Sbjct: 485 VDMHAAHERILYEQIKDALDARDLAVQPLLLPVTLPANPVEIGTAEEHRETLELLGFDIA 544

Query: 489 RFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRS 548
              P  +A+R +PA+L + +   L RD++ ++     +  L +R   +LAT+AC+ ++R+
Sbjct: 545 PVSPTTLAVRAVPALLQQADAEALARDVLRDLHSYGGSRVLAERRNELLATLACHSAVRA 604

Query: 549 GRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            RK+   EMN LLR+ME+   + QCNHGRPT+++L +S++++LF R
Sbjct: 605 NRKLTLEEMNALLRQMEQTERADQCNHGRPTWVQLSVSELDRLFLR 650


>gi|150395653|ref|YP_001326120.1| DNA mismatch repair protein [Sinorhizobium medicae WSM419]
 gi|166232108|sp|A6U6K5|MUTL_SINMW RecName: Full=DNA mismatch repair protein mutL
 gi|150027168|gb|ABR59285.1| DNA mismatch repair protein MutL [Sinorhizobium medicae WSM419]
          Length = 605

 Score =  550 bits (1416), Expect = e-154,   Method: Composition-based stats.
 Identities = 290/606 (47%), Positives = 408/606 (67%), Gaps = 14/606 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I++LSE +INQIAAGE+IERP+ A KELIEN+LDA ++R+E   AGGGK+  ++TDNG
Sbjct: 1   MAIKQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIATAGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            GM+  ++ +A++RHCTSK+    ++I T GFRGEALPSIG+V+ L++ +R  +   GA 
Sbjct: 61  LGMSPADLELAIRRHCTSKLDGSLADIRTLGFRGEALPSIGSVARLSITTRTAEAREGAT 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I I+G +   VRP A   GT+VEVR+LFF  PARL F+KSE+ ET  I++V+RRMAIA+P
Sbjct: 121 ITITGGRSDPVRPSAAVVGTVVEVRELFFATPARLKFMKSERAETAAISEVVRRMAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
           KV F  S   S+R  + F +T  +   R++QV+G DF +NA+E++ +     L G+ G+P
Sbjct: 181 KVRFVLS--GSDRSALEFPATGDDRLARMAQVLGRDFRDNAIEIDAEREGARLTGFAGVP 238

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGN+ Q Y F+NGR VQDK I+S IR AYAET+P GRYPV VL L IDP  VDVNVH
Sbjct: 239 TFNRGNSLQQYAFVNGRPVQDKLIMSAIRAAYAETVPQGRYPVAVLSLTIDPALVDVNVH 298

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA---------- 350
           PAKS +RFR+P +IR  II +I++A+ ++G   ++  ++ ++ +F  +            
Sbjct: 299 PAKSDVRFRDPGLIRGLIIGAIREALMREGDRAATTGAQGLMRAFRPEFHRGDQQRPQEP 358

Query: 351 PKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVE--ESEATHYQLGI 408
                  Y         + F +  + + +D         +   D ++  + +A  + LG 
Sbjct: 359 WTAATSPYRPFSPGGAARGFAETPQAAFSDFAQPSARNAAVPVDSIQAADGQAASFPLGA 418

Query: 409 ACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEG 468
           A AQ+H+NYI++QT DGLVIVDQHAAHERL+FE MR   ++  + +Q LL PEI+DL E 
Sbjct: 419 ARAQLHENYIVAQTDDGLVIVDQHAAHERLVFETMRTALHARPVPAQALLIPEIVDLPEE 478

Query: 469 ECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYT 528
           +C  ++ H  +  RLG+  ERFGP AIA+RE PA+L + +   L+R + DE+ +  T   
Sbjct: 479 DCDRLVAHAGEFTRLGLAIERFGPAAIAVRETPAMLGEMDAAGLVRQLADELAEWDTADG 538

Query: 529 LQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDI 588
           L  R+E + ATMAC+GS+RSGR++++ EMN LLR ME  P S QCNHGRPT+I+LKL+DI
Sbjct: 539 LAGRLEYLAATMACHGSVRSGRRLRTEEMNALLRRMEATPGSGQCNHGRPTYIELKLADI 598

Query: 589 EKLFGR 594
           E+LFGR
Sbjct: 599 ERLFGR 604


>gi|315122189|ref|YP_004062678.1| DNA mismatch repair protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495591|gb|ADR52190.1| DNA mismatch repair protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 600

 Score =  550 bits (1416), Expect = e-154,   Method: Composition-based stats.
 Identities = 470/597 (78%), Positives = 526/597 (88%), Gaps = 4/597 (0%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           MKIRKLSEKI+NQIAAGEIIERP+IAIKELIENSLDAES+ +ETVI+GGGKSFFQITDNG
Sbjct: 5   MKIRKLSEKIVNQIAAGEIIERPAIAIKELIENSLDAESTCIETVISGGGKSFFQITDNG 64

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           FGMTSEEI MAVQRHCTSKI D+FSNI TFGFRGEALPSIGAV+HLTLMSR PQNNTGAQ
Sbjct: 65  FGMTSEEIQMAVQRHCTSKIFDNFSNICTFGFRGEALPSIGAVAHLTLMSRSPQNNTGAQ 124

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQ+ETNLI +VIRRMAIAYP
Sbjct: 125 ITISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQIETNLIANVIRRMAIAYP 184

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V FTFST K+NRY M+F+ST+GNFP+RISQVIGEDFINNAVE+NE S  ITL+GY GIP
Sbjct: 185 AVRFTFSTTKNNRYTMDFKSTDGNFPDRISQVIGEDFINNAVEINETSPNITLRGYAGIP 244

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGNANQ YVF+NGR +QDK ILSTIR AY+ETIPL RYPV+VLLLEI+P QVDVNVH
Sbjct: 245 TFNRGNANQLYVFVNGRIIQDKLILSTIRIAYSETIPLRRYPVIVLLLEINPTQVDVNVH 304

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA- 359
           PAKS +RFR+P+++RNFIIQSIQK+INKK   TSS+LS KMISSFHQ+NA K     Y  
Sbjct: 305 PAKSDVRFRDPSMVRNFIIQSIQKSINKKRNFTSSILSNKMISSFHQENAEKFRPITYEH 364

Query: 360 -TSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYI 418
               +++QEKL LQEN LST +LL +++  + +DN  + ++  ++Y LG+ACAQIHQNYI
Sbjct: 365 KAIPSHSQEKLVLQENNLSTKELLTTNNKYFMDDNS-INDTTTSNYPLGMACAQIHQNYI 423

Query: 419 ISQTTDGLVIVDQHAAHERLIFEKMRQDFN-STKITSQTLLTPEIIDLLEGECALIMEHD 477
           ISQT D L+IVDQHAAHERLIFEKMRQDFN + KITSQTLL PEIIDLLEGECALI+EHD
Sbjct: 424 ISQTYDELIIVDQHAAHERLIFEKMRQDFNINDKITSQTLLIPEIIDLLEGECALILEHD 483

Query: 478 EDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENIL 537
           EDL RLG+  ERFG NAIAIREIPAILSK N+ QLLRDI+DEII+++T   L D+I+ IL
Sbjct: 484 EDLRRLGVTVERFGLNAIAIREIPAILSKNNVSQLLRDIVDEIIENNTKNNLTDKIDKIL 543

Query: 538 ATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ATMACYGSIRSGRKM   EMNRLLREME+N NSSQCNHGRPTFIKLKLSDIEKLFGR
Sbjct: 544 ATMACYGSIRSGRKMHLTEMNRLLREMEQNNNSSQCNHGRPTFIKLKLSDIEKLFGR 600


>gi|163734247|ref|ZP_02141687.1| DNA mismatch repair protein [Roseobacter litoralis Och 149]
 gi|161392255|gb|EDQ16584.1| DNA mismatch repair protein [Roseobacter litoralis Och 149]
          Length = 610

 Score =  550 bits (1416), Expect = e-154,   Method: Composition-based stats.
 Identities = 250/600 (41%), Positives = 377/600 (62%), Gaps = 13/600 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  +N+IAAGE++ERP+ AIKEL+EN+LDA + ++      GGK+  ++ D+G G
Sbjct: 15  IRQLDEGAVNRIAAGEVVERPASAIKELVENALDAGARKIAIDYGDGGKTLIRVQDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT+ ++P+A+ RH TSKI   D  NI TFGFRGEALPS+ AV  LT+++R   ++ G + 
Sbjct: 75  MTANDLPLALSRHATSKIDGSDLLNIQTFGFRGEALPSLAAVGRLTIVTRADGDD-GVEA 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            ++G     ++P A NPGT V +RDLF+  PARL FL+S++ E   I+DV++R+A+A P 
Sbjct: 134 TVAGGTEKPLKPAACNPGTTVTIRDLFYATPARLKFLRSDRAEAQAISDVVKRLAMAEPF 193

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGNF----PERISQVIGEDFINNAVELNEKSNEITLQ 234
           V F     S     R      +  G+       R+++V+G +F  N++ ++ +   + L 
Sbjct: 194 VQFVLRDVSGDGPGREVFRADAQQGDLFGALHGRLARVLGREFAENSLAIDAEREGLHLT 253

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           G+  +PT++RG+A   Y+F+NGR V+DK ++  +R AY++ +   R+P   L L+ DP+ 
Sbjct: 254 GFAALPTYSRGSAVAQYLFVNGRPVKDKLLVGALRGAYSDFLSRDRHPAAALFLDCDPKL 313

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR+P I R  I+ +++ A+ + G   S+ +S   + +   +      
Sbjct: 314 VDVNVHPAKSEVRFRDPGIARGLIVSALRHALAEAGHRASTTVSTATLGAMQPEPIGARV 373

Query: 355 LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIH 414
                 S   +   L       +  ++          D D     E   Y LG A  Q+H
Sbjct: 374 YQMDHASRPMSAPPL----QTPAFQEVAAPWGRVAETDPDGETADEPVDYPLGAARGQVH 429

Query: 415 QNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIM 474
           +NYII+QT  G+VIVDQHAAHERL++EK+++      + SQ LL PEI++L   +CA +M
Sbjct: 430 ENYIIAQTATGMVIVDQHAAHERLVYEKLKRQMAENGVASQALLIPEIVELSAADCASLM 489

Query: 475 EHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIE 534
              +DL +LG+  E FG +AIA+RE PAIL   +   L+ DI+DE+ D +T+  ++ RI+
Sbjct: 490 HVADDLAQLGLVVEPFGGDAIAVRETPAILGLVDARALILDILDELADQNTSDNIRQRID 549

Query: 535 NILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            IL+ +AC+GSIRSGR M++ EMN LLR+ME  P+S QCNHGRPT+++LKLSDIE+LFGR
Sbjct: 550 AILSRVACHGSIRSGRWMKTEEMNALLRDMEATPHSGQCNHGRPTYVELKLSDIERLFGR 609


>gi|239833562|ref|ZP_04681890.1| DNA mismatch repair protein MutL [Ochrobactrum intermedium LMG
           3301]
 gi|239821625|gb|EEQ93194.1| DNA mismatch repair protein MutL [Ochrobactrum intermedium LMG
           3301]
          Length = 626

 Score =  549 bits (1415), Expect = e-154,   Method: Composition-based stats.
 Identities = 275/625 (44%), Positives = 391/625 (62%), Gaps = 31/625 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V  GGGK+  ++TDNG
Sbjct: 1   MPIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTGGGGKTLLRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+  +E+P+AV RHCTSK+SDD  +I   GFRGEALPSIG+V+ L L SRP   ++G +
Sbjct: 61  SGIPVDELPLAVSRHCTSKLSDDVHDIRALGFRGEALPSIGSVAKLVLKSRPQDADSGFE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           +++SG  +   RP A+N GTI EVRDLF+  PARL F+K+++ E + ITDVI+R+AIA+P
Sbjct: 121 VSVSGGHLDGPRPSALNRGTIAEVRDLFYATPARLKFMKTDRAEASAITDVIKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ +       ++    S      ERI+QV+G++F  NA+ ++ + + + L G+ GI
Sbjct: 181 HIRFSLAGSDRTPLELAATGSGAEATLERINQVLGKEFGENALAIDAERDGVRLAGFVGI 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+ NRGNA   + ++NGR V+DK +   +R AYA+ +   R+PV VL L +DP  VDVNV
Sbjct: 241 PSHNRGNALHQFAYVNGRPVRDKQLFGALRGAYADVMARDRHPVAVLFLTLDPALVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPK------- 352
           HPAK+ +RFR+P ++R  I+ +I++A+ + GI  ++  +  M+ +F  +           
Sbjct: 301 HPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGADAMLQAFRAEGLQPSPSSFAS 360

Query: 353 --------THLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDND---------- 394
                   +   + A     T+             D   S     SE             
Sbjct: 361 RSSSTGYASGGWRPAPPAPRTEWSPQTAHPAHRPLDFATSPSFQESEQATLAAVNVLAAD 420

Query: 395 -----PVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNS 449
                    +E     LG A AQIH NYI+SQT D LVIVDQHAAHERL++E ++   +S
Sbjct: 421 ARATVHEAPAELQQKPLGAARAQIHANYIVSQTEDSLVIVDQHAAHERLVYEALKNALHS 480

Query: 450 TKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNI 509
             I  Q LL PEI+DL E +   +  H E L R G+  E+FGP AI +RE PA+L + N+
Sbjct: 481 RPIPGQMLLIPEIVDLPEEDAERLATHAETLARFGLGIEQFGPGAIVVRETPAMLGEMNV 540

Query: 510 PQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPN 569
            QL+RD+ DEI +  T+  L+  + ++ ATMAC+GS+RSGR+++  EMN LLREME  P 
Sbjct: 541 QQLIRDLSDEIAEHDTSDGLKAMLNHVAATMACHGSVRSGRRLKPEEMNALLREMESTPG 600

Query: 570 SSQCNHGRPTFIKLKLSDIEKLFGR 594
           S  CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 601 SGTCNHGRPTYIELKLTDIERLFGR 625


>gi|307292927|ref|ZP_07572773.1| DNA mismatch repair protein MutL [Sphingobium chlorophenolicum L-1]
 gi|306880993|gb|EFN12209.1| DNA mismatch repair protein MutL [Sphingobium chlorophenolicum L-1]
          Length = 590

 Score =  549 bits (1415), Expect = e-154,   Method: Composition-based stats.
 Identities = 223/595 (37%), Positives = 352/595 (59%), Gaps = 7/595 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E ++N+IAAGE++ERP+ A+KE++EN++DA S R+   IA GG    +++D+G
Sbjct: 1   MSIRRLPEHLVNRIAAGEVVERPASALKEIVENAVDAGSRRIAIRIANGGLDRIEVSDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM S EI +A++RH TSK+ DD   N+ T GFRGEALPSI +V+ L++ SRP  ++ G 
Sbjct: 61  CGMDSSEIALALERHATSKLPDDAIENVATLGFRGEALPSIASVARLSIDSRPAGSD-GW 119

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
              +    + +  P A+ PGT V V  LF  +PAR  FL+S + E     DV+RR+A+A+
Sbjct: 120 NRTVDNGVVVNEGPAALPPGTRVIVEQLFGKVPARRKFLRSAKAEYAACLDVVRRLAMAH 179

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+          +       +    ++ +      +N V +  +   + L G   +
Sbjct: 180 PAIAFSMEHDGRRVLGVQADEAREDR---VAALTDRALADNHVIVALEREGVRLSGVASL 236

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT+NRG  +  ++F+NGR V+D+ ++  +R AYA+ +   R+PVV L L++ P +VDVNV
Sbjct: 237 PTYNRGVGDHQFLFVNGRPVRDRLLVGAVRGAYADMLARDRHPVVALFLDVPPLEVDVNV 296

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HPAK+ +RFR+P +IR  I+  +++A++ +G           +S++  +  P +  P  A
Sbjct: 297 HPAKTEVRFRDPALIRGMIVSGLRRALDAEGFRAVQHADPAGLSAWRPE--PVSPTPIGA 354

Query: 360 TSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYII 419
             +           +         +  P    +       E T + LG+A  Q+ + YI+
Sbjct: 355 MPIFEAAGAPVPAYSVAERRPTFLTPPPQARAEPAAAPAPEGTSFPLGVARGQVARTYIV 414

Query: 420 SQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDED 479
           ++  DGLVIVDQHAAHERL  E+MR+      + +Q LL PE+++L E  C  +     +
Sbjct: 415 AEAEDGLVIVDQHAAHERLTLERMRRAMEGQGVAAQALLLPEVVELDEPACDRLEARIAE 474

Query: 480 LHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILAT 539
           L   G++ ERFGP A+ +R  PA+L + ++  L+ D+ D++    +  +L++R++ + AT
Sbjct: 475 LKDFGLELERFGPAAMLVRATPAMLGQGDVQGLVSDLADDLAAYDSALSLKERLDLVAAT 534

Query: 540 MACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           MAC+GS+R+GR +   EMN LLREME  P S QCNHGRPT++KL   DIEKLFGR
Sbjct: 535 MACHGSVRAGRILSVAEMNALLREMEITPRSGQCNHGRPTWVKLGHGDIEKLFGR 589


>gi|260753121|ref|YP_003226014.1| DNA mismatch repair protein [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|258552484|gb|ACV75430.1| DNA mismatch repair protein MutL [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 613

 Score =  549 bits (1415), Expect = e-154,   Method: Composition-based stats.
 Identities = 215/615 (34%), Positives = 363/615 (59%), Gaps = 24/615 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +IN+IAAGE++ERP+ A+KEL+EN++DA+S+R+   +  GG    ++ DNG
Sbjct: 1   MSIRRLPEDVINRIAAGEVVERPASALKELVENAIDAQSTRILIRLLKGGLDGIEVIDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD--FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+ ++E+ +A++RH TSK+ D+     + T GFRGEALPSI +V+ LTL SR   +++G
Sbjct: 61  IGIPADEMRLALERHATSKLPDNDAIEAVTTLGFRGEALPSIASVARLTLESRTADSDSG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +I +            +  GT ++V  LF  IPAR  F++S + E     D++RR+A+ 
Sbjct: 121 WKIIVDNGHFEKEGIAPLPKGTRIKVDSLFARIPARRKFMRSAKSEYMACHDIVRRLAMT 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P ++F+        + +N      +   R++ +I     +N+V +  + +++ L+G   
Sbjct: 181 RPDIAFSLEHDGRRIFSLN---GGESRQRRVAALIDRTLKDNSVAVEYQRDQMQLEGVAS 237

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+RG A+  Y+F+NGR V+D+ ++ ++R AY + +   R+PV+ L L +    VD+N
Sbjct: 238 LPTFHRGLADHQYLFVNGRPVKDRLLIGSVRAAYHDLLAKDRHPVLALFLTLPNSDVDIN 297

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDN---APKTHL 355
           VHPAK  +RFR+   +R+ I+ +++++++  G  ++     + +  + + +   AP   +
Sbjct: 298 VHPAKGEVRFRDSQAVRSLIVGALRESLDLSGFKSAQPADVQAMGKWQKSSELAAPSKAV 357

Query: 356 PKYATSLTNTQEKLFLQENRLST----------------NDLLPSDDPTYSEDNDPVEES 399
           P + +  + +   L  +   +                                N   + S
Sbjct: 358 PSHESRQSLSDSGLLFKSRTIEAPKSTSIPTPQGTASDLWSAATKSPLPPMGRNSATDSS 417

Query: 400 EATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLT 459
           E + + LG+A  QI   YII+++ DGLVIVDQHAAHERL+ E+MR+   + ++TSQ LL 
Sbjct: 418 EQSDFPLGLARGQIAATYIIAESKDGLVIVDQHAAHERLVMERMRRALQNGQVTSQRLLM 477

Query: 460 PEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDE 519
           P+++++ E  C L  +  ++   +G++ ERFG  AI +R  PA+L    +  +++D+  E
Sbjct: 478 PDVVEMDEVSCDLFEQRQDEFAAMGLETERFGHEAILVRATPAMLGNCEVKAMIKDLAAE 537

Query: 520 IIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPT 579
           I     +  L+++ ++I+ATMAC+GS+R+GR +   EMN LLREME  P+S QCNHGRPT
Sbjct: 538 IAAYDQSLLLKEKFDHIVATMACHGSVRAGRLLSIAEMNALLREMEITPHSGQCNHGRPT 597

Query: 580 FIKLKLSDIEKLFGR 594
           ++KL   DIEKLFGR
Sbjct: 598 WVKLGHKDIEKLFGR 612


>gi|86139358|ref|ZP_01057927.1| DNA mismatch repair protein [Roseobacter sp. MED193]
 gi|85823861|gb|EAQ44067.1| DNA mismatch repair protein [Roseobacter sp. MED193]
          Length = 645

 Score =  549 bits (1415), Expect = e-154,   Method: Composition-based stats.
 Identities = 257/631 (40%), Positives = 384/631 (60%), Gaps = 39/631 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA + R+   IA GGK+  ++TD+G 
Sbjct: 15  TIRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGAHRITIEIADGGKTLIRVTDDGC 74

Query: 62  GMTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           GMTS ++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR   ++  AQ
Sbjct: 75  GMTSRDLPLALSRHATSKIDGTDLLNIHTFGFRGEALPSLGAVGRLTITSRAAGHD-AAQ 133

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ++G K+  VRP A+  GTIVE+ DLF+  PARL F+++++ E+  I DV++R+A+A P
Sbjct: 134 IRVAGGKMEPVRPAALRAGTIVELADLFYATPARLKFMRTDRAESQAIGDVVKRLAMAEP 193

Query: 181 KVSFT---FSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITL 233
            V FT    S     R         G+  +    R++ V+G +F  NA++++     I L
Sbjct: 194 SVGFTLRDVSGGGEGRVTFRADPLTGDLFDALHGRLASVLGREFAENALKIDATREGIRL 253

Query: 234 QGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPR 293
            GY  +PT++RG A   ++F+N R V+DK +   +R AY + +   R+P   L ++ DP 
Sbjct: 254 FGYAALPTYSRGAAVAQFLFVNSRPVKDKMLTGALRGAYFDFLSRDRHPAAALFIDCDPT 313

Query: 294 QVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKT 353
            VDVNVHPAKS +RFR+P + R  I+ +++ A+ + G   S+ ++   + +   +     
Sbjct: 314 LVDVNVHPAKSEVRFRDPGLARGLIVSALRHALAEAGHRASTTVAGATLGAMRPEAPTAN 373

Query: 354 HLP---------------KYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE 398
                              YA       +++ +     +                DP+ +
Sbjct: 374 GAARVYQMDRPSLGARNLSYAAQAPGQPQEMSVPAPPAAAPGFAEFQHEYSGRLTDPLAD 433

Query: 399 SEAT---------------HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKM 443
           +EA                H  LG A  Q+H+NYII+QT DG+VIVDQHAAHERL++EK+
Sbjct: 434 TEAPGQMSDAPEPTAPGAEHLPLGAARGQVHENYIIAQTADGMVIVDQHAAHERLVYEKL 493

Query: 444 RQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAI 503
           +Q      + +Q LL PEI++L   +CA I+   E+L + G+  E FG NA+A+RE PAI
Sbjct: 494 KQQMAENGVAAQALLIPEIVELGSNDCARILAQAEELKKFGLGLEAFGGNAVAVRETPAI 553

Query: 504 LSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLRE 563
           L + N   +++DI+DE+ D   +  +Q R+E IL+ +AC+GS+RSGR+M+  EMN LLRE
Sbjct: 554 LGEVNAEAMVKDILDELDDQGESQLVQARLEAILSRVACHGSVRSGRRMRGEEMNALLRE 613

Query: 564 MEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ME  P+S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 614 MEATPHSGQCNHGRPTYVELKLADIERLFGR 644


>gi|302878544|ref|YP_003847108.1| DNA mismatch repair protein MutL [Gallionella capsiferriformans
           ES-2]
 gi|302581333|gb|ADL55344.1| DNA mismatch repair protein MutL [Gallionella capsiferriformans
           ES-2]
          Length = 629

 Score =  549 bits (1415), Expect = e-154,   Method: Composition-based stats.
 Identities = 212/627 (33%), Positives = 335/627 (53%), Gaps = 33/627 (5%)

Query: 1   MK--IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITD 58
           M   IR L E +INQIAAGE+IERP+ A+KEL+ENSLDA ++ +   +  GG    +I D
Sbjct: 1   MPSYIRVLPELLINQIAAGEVIERPAAALKELLENSLDAGATDITVQLDNGGIKLLRIRD 60

Query: 59  NGFGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNN 116
           NG G+  +E+ +A+ RH TSKI+  DD  ++ + GFRGEAL S+ AV+ LTL SR   + 
Sbjct: 61  NGRGIVRDELALALMRHATSKIASLDDLQSVESMGFRGEALASMAAVAQLTLSSRTAHDT 120

Query: 117 TGAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMA 176
            G  +     +IS   P +  PGT +E+R+L+F  PAR  FLKSE  E     +  +R+A
Sbjct: 121 HGWMVEAIDGRISEAAPASHPPGTTIELRELYFNTPARRKFLKSEATEFAHCEEAFKRIA 180

Query: 177 IAYPKVSFTFSTIKSNRYKMNFQSTNGNF---------------PERISQVIGEDFINNA 221
           ++ P V F+        +++N      +                 +R++ ++G +F N A
Sbjct: 181 LSRPDVGFSLQHNGRTVWQLNPGLRIEDRGLRGEDDGGWMQNAALKRVAALLGAEFGNAA 240

Query: 222 VELNEKSNEITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRY 281
           V ++  +  +TL G   +P ++RGN +  Y F+NGR V+DK     +R AY + +   R+
Sbjct: 241 VPVSGSAANLTLHGLAALPAYSRGNRDAQYFFVNGRFVRDKVASHALRQAYQDILHHQRH 300

Query: 282 PVVVLLLEIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKM 341
           P  VL LE+   QVDVNVHPAKS +RFR    I  FI  ++Q+A+    +S ++   + +
Sbjct: 301 PAFVLFLELPAEQVDVNVHPAKSEVRFREGQGIHQFIFHTLQQALAAPALSGAATQERAI 360

Query: 342 ISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESE- 400
            +             +   +    + +    +  + + +    +    S    P E S  
Sbjct: 361 QAPIPTQQRIPLAAAQLNATYQVWEAQTGSGKWGVKSGEAASGEWKVESGQTAPAESSSL 420

Query: 401 -------------ATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDF 447
                        +T + LG A AQ+   YI++Q   GL++VD HAAHER+++EK++   
Sbjct: 421 PAIQSPTTSHYPLSTDHPLGFALAQLSGVYILAQNEQGLIVVDMHAAHERIVYEKLKASM 480

Query: 448 NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKK 507
           +   I +Q LL P        + A +    + LH+LG   +   P  IAIR +P +L + 
Sbjct: 481 DHEAIATQPLLIPVCFQTDAHDVATVEAEQDALHKLGFDIKPLSPTQIAIRAMPVLLKQA 540

Query: 508 NIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKN 567
                 RDI++E+     +  L +R   +LA++AC+G++R+ R +   EMN LLREME+ 
Sbjct: 541 EAEAAARDILNELRKYGGSRMLTERRNELLASLACHGAVRANRILSVPEMNALLREMEQT 600

Query: 568 PNSSQCNHGRPTFIKLKLSDIEKLFGR 594
             S QCNHGRPT+  L +++++K+F R
Sbjct: 601 ERSGQCNHGRPTWFALTMNELDKMFMR 627


>gi|110678039|ref|YP_681046.1| DNA mismatch repair protein [Roseobacter denitrificans OCh 114]
 gi|109454155|gb|ABG30360.1| DNA mismatch repair protein, putative [Roseobacter denitrificans
           OCh 114]
          Length = 610

 Score =  549 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 251/601 (41%), Positives = 377/601 (62%), Gaps = 15/601 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  +N+IAAGE++ERP+ AIKEL+EN+LDA + ++      GGK+  ++ D+G G
Sbjct: 15  IRQLDEGAVNRIAAGEVVERPASAIKELVENALDASARKIAIDYGDGGKTLIRVQDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT+ ++P+A+ RH TSKI   D  NI TFGFRGEALPS+ AV  LT+++R   ++ G + 
Sbjct: 75  MTATDLPLALSRHATSKIDGSDLLNIQTFGFRGEALPSLAAVGRLTIVTRAGGDD-GVEA 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           ++SG     ++P A NPGT V +RDLF+  PARL FL+S++ E   I DV++R+A+A P 
Sbjct: 134 SVSGGDEKPLKPAACNPGTTVTIRDLFYATPARLKFLRSDRAEAQAIIDVVKRLAMAEPF 193

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGNF----PERISQVIGEDFINNAVELNEKSNEITLQ 234
           V F     S     R      +  G+       R+++V+G +F  NA+ ++ +   + L 
Sbjct: 194 VQFVLRDVSGDGPGREVFRADAQQGDLFGALHGRLARVLGREFAENALAIDAEREGLHLT 253

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           G+  +PT++RG+A   Y F+NGR V+DK ++  +R AY++ +   R+P   L L+ DP+ 
Sbjct: 254 GFAALPTYSRGSAVAQYFFVNGRPVKDKLLVGALRGAYSDFLSRDRHPAAALFLDCDPKL 313

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDN-APKT 353
           VDVNVHPAKS +RFR+P I R  I+ +++ A+ + G   S+ +S   + +   +    + 
Sbjct: 314 VDVNVHPAKSEVRFRDPGIARGLIVSALRHALAEAGHRASTTVSTATLGAMQPEPIGARV 373

Query: 354 HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQI 413
           +    A+   +            +  ++          D D     +   Y LG A  Q+
Sbjct: 374 YQMDQASRPVSAPPP-----QTPAFQEVAAPWGRVAETDPDEQTAGDPGDYPLGAARGQV 428

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
           H+NYII+QT  G+VIVDQHAAHERL++EK+++      + SQ LL PEI++L   +CA +
Sbjct: 429 HENYIIAQTATGMVIVDQHAAHERLVYEKLKRQMAENGVASQALLIPEIVELSAADCASL 488

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRI 533
           M+  +DL RLG   E FG +AIA+RE PAIL   +   L+ DI+DE+ D + +  ++ RI
Sbjct: 489 MQISDDLARLGFVVEPFGGDAIAVRETPAILGVVDARALILDILDELADQNASENIRMRI 548

Query: 534 ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFG 593
           + IL+ +AC+GSIRSGR M++ EMN LLREME  P+S QCNHGRPT+++LKLSDIE+LFG
Sbjct: 549 DAILSRVACHGSIRSGRWMKTEEMNALLREMEATPHSGQCNHGRPTYVELKLSDIERLFG 608

Query: 594 R 594
           R
Sbjct: 609 R 609


>gi|118590698|ref|ZP_01548099.1| DNA mismatch repair protein [Stappia aggregata IAM 12614]
 gi|118436674|gb|EAV43314.1| DNA mismatch repair protein [Stappia aggregata IAM 12614]
          Length = 630

 Score =  548 bits (1411), Expect = e-153,   Method: Composition-based stats.
 Identities = 262/633 (41%), Positives = 393/633 (62%), Gaps = 43/633 (6%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           MK+R+L E++INQIAAGE+IERP+  IKELIEN++DA + +VE V A GGK+  ++ D+G
Sbjct: 1   MKVRQLGEQVINQIAAGEVIERPASVIKELIENAVDAGAKQVEIVTAAGGKTLMRVADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM  E++ +A++RHCTSKISDD   +I T GFRGEALPSIG+V+ L + +R    +   
Sbjct: 61  EGMRREDLQLAIRRHCTSKISDDDLFDIRTLGFRGEALPSIGSVARLAIQTRHKDEDHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            IA+ G +   + P A   GT VEVRDLFF  PARL FLKS++ E   IT++++R+A+AY
Sbjct: 121 AIAVEGGREQPLVPAARTKGTQVEVRDLFFATPARLKFLKSDRAEAAAITEIVKRIALAY 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P++ F+                +     RI+Q++G+DF++NA+E++     + L G+ G+
Sbjct: 181 PEIGFSLGGADRQSQSWPAARGSEPHLARIAQILGQDFVDNAMEIDAAREGVRLTGFAGL 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT +RGNA   + F+NGR V+DK +LS +R AYA+ +   R+PVVVL +++DP  VDVNV
Sbjct: 241 PTHHRGNAQNQFFFVNGRPVKDKLLLSGLRGAYADVLARDRHPVVVLFIDLDPTLVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA------PKT 353
           HPAK+ +RFR+  ++R  ++ +I+ A+ + G  +S+  +   + +    +A      P  
Sbjct: 301 HPAKADVRFRDSQLVRGLLVGAIKHALVQSGHRSSTSNAAVALDAIRAQSAGFAQPGPTP 360

Query: 354 HLPK--------------------------------YATSLTNTQEKLFLQENRLSTNDL 381
             P                                  AT      +  F ++N  +    
Sbjct: 361 SAPAGSGGYGGGSYTRTSAAPHWAPDAFSPLQMESTPATGFAEAPQPAFERQNGFADFAR 420

Query: 382 LPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFE 441
             +D       ND   E+E T   LG A AQ+H+ YII+QT DG+VIVDQHAAHERL++E
Sbjct: 421 PSADARA----NDVPVETEKTRLPLGAARAQVHETYIIAQTEDGVVIVDQHAAHERLVYE 476

Query: 442 KMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIP 501
           ++++      +  Q LL PEI++L E +   + +  EDL ++G+  E FGP AIA+RE P
Sbjct: 477 RLKEALARKDVARQILLIPEIVELPEEDAIRLADRAEDLEKVGLSLEAFGPGAIAVRETP 536

Query: 502 AILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLL 561
           AIL   +I  ++R++ DE+ +  T   L+++++++ ATMAC+GS+R+GR+M+  EM+ LL
Sbjct: 537 AILGDMDIQGMVRNLADELAEWDTAEGLKEKLDHVAATMACHGSVRAGRRMRPEEMDALL 596

Query: 562 REMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           R+ME  P S QCNHGRPT+++LKL DIEKLFGR
Sbjct: 597 RDMEATPLSGQCNHGRPTWVELKLGDIEKLFGR 629


>gi|325266000|ref|ZP_08132686.1| DNA mismatch repair protein MutL [Kingella denitrificans ATCC
           33394]
 gi|324982638|gb|EGC18264.1| DNA mismatch repair protein MutL [Kingella denitrificans ATCC
           33394]
          Length = 623

 Score =  548 bits (1411), Expect = e-153,   Method: Composition-based stats.
 Identities = 214/624 (34%), Positives = 336/624 (53%), Gaps = 36/624 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENSLDA ++ +   +AGGG    ++TDNG 
Sbjct: 3   RIHALPDHLVNQIAAGEVVERPAAALKEIVENSLDAGATHISVELAGGGIKLIRVTDNGN 62

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++++P+A+ RH TSKI    D  ++ + GFRGE L SI +VS LTL SR        
Sbjct: 63  GIHADDLPLALSRHATSKIKQLHDLEHVRSMGFRGEGLASIASVSRLTLTSRTADLPHAH 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +I      +S+V   A   GT VEVR+LFF  PAR  FLKSE  E      ++ R+A+A 
Sbjct: 123 EIRAEDGVLSAVNAAAHPEGTTVEVRELFFNTPARRKFLKSENTEYAHCAAMLERLALAN 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P+ +F+ +      ++   QS      ER++ V+G +F + ++ ++     + + G+   
Sbjct: 183 PQAAFSLAHNGKTVFRYPVQS----LEERMAAVMGAEFQSASLPVDSGEGAVRVHGFVSK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G +   + F+N R V+DK +L  ++ AY + +     P   L LE+ P  VDVNV
Sbjct: 239 PTFAKGKSELQFCFVNRRFVRDKVVLHAVKQAYRDVLHHKITPAFALFLEMPPEMVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAI------------------NKKGISTSSVLSKKM 341
           HP K+ IRFR+   +   +  ++ KA+                   ++  +  S L  + 
Sbjct: 299 HPTKTEIRFRDSQAVHRLVFHTLDKALEGTRADMTGSVGNAGDILQQRFPNVQSSLHTET 358

Query: 342 ISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTND-----------LLPSDDPTYS 390
            +      AP    P Y+      Q  L L+ENR +               +     T  
Sbjct: 359 AAMPTSGEAPSAPAP-YSAYRAPQQRSLSLKENRAALQTYAELYRRDDDFPIEKAACTPK 417

Query: 391 EDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST 450
           +     E +E   Y LG A AQ+   YI++QT +GL++VD HAA ER+ +EKM+      
Sbjct: 418 QPAPEAEAAEPPEYPLGFALAQLLGIYILAQTAEGLILVDMHAAAERVNYEKMKAQRQQG 477

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
            + +Q LL P +      E A++ EH E L   G+     G   IA+R +PA+L K +  
Sbjct: 478 SLQTQMLLIPPVFAASHTERAVLAEHGETLREYGLLLSDEGNGQIAVRSVPAMLGKADAV 537

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
            L ++++ E+    ++ T++     I ATMAC+GS+R+GR++   EMN LLR+ME    S
Sbjct: 538 ALAQNVLRELGSVGSSQTVESMENRIFATMACHGSVRAGRQLTLPEMNALLRDMENTSRS 597

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
           +QCNHGRPT++ L L+D++ LF R
Sbjct: 598 NQCNHGRPTWVHLALADLDALFLR 621


>gi|49473918|ref|YP_031960.1| DNA mismatch repair protein [Bartonella quintana str. Toulouse]
 gi|81827643|sp|Q6G0J4|MUTL_BARQU RecName: Full=DNA mismatch repair protein mutL
 gi|49239421|emb|CAF25760.1| DNA mismatch repair protein mutL [Bartonella quintana str.
           Toulouse]
          Length = 612

 Score =  548 bits (1411), Expect = e-153,   Method: Composition-based stats.
 Identities = 269/611 (44%), Positives = 396/611 (64%), Gaps = 17/611 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  +KEL+EN++DA ++R+E V A GGKSF +++DNG
Sbjct: 1   MIIRHLSENIINQIAAGEVIERPANVVKELVENAIDAGATRIEIVTANGGKSFIKVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++++ +A+ RHCTSKI+DD  NI+  GFRGEALPSIG+V+ L L SR  +     +
Sbjct: 61  CGIPADQLTLAISRHCTSKITDDVHNIYFLGFRGEALPSIGSVAKLKLTSRTQEAENATE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ++  KI   +P A NPGTIVEVRDLFF  PARL F+K+++ ETN I+D+I+R+AIA+P
Sbjct: 121 IIVTAGKIIGPKPAAANPGTIVEVRDLFFVTPARLKFMKTDRAETNAISDMIKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQS-TNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ S +     ++   + +     +RI+Q++G++F  N++ LN K   I L G+  +
Sbjct: 181 HIRFSLSGLDRTSMELPATANSTQGQLQRITQIMGKEFAPNSIALNAKRESIRLTGFACL 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNR N+   + ++N R V+DKF+  TIR AYA+ +   RYPV +L +++ P  VDVNV
Sbjct: 241 PSFNRSNSLHQFAYVNRRPVRDKFLWGTIRGAYADVMARDRYPVSILFIDLPPADVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HP K+ +RFR+P +IR  I+ +I +A+++ G+  +S  S+ M+S+F       T    + 
Sbjct: 301 HPTKADVRFRDPGLIRGLIVGAIHEALHQIGVRPASTCSEAMLSAFQTSQPLGTFKSTHQ 360

Query: 360 TS------LTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPV----------EESEATH 403
           T       L +       +    +    L  +     E  D              SE  H
Sbjct: 361 TFSSQHHHLASAAASPLHKPLDATNFVNLREEAVPLMECLDMPSGDICTANTTPSSEELH 420

Query: 404 YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEII 463
           Y LG A AQIH+NYII+QT D L+IVDQHAAHERL++E ++    S  + SQ LL PEI+
Sbjct: 421 YPLGAARAQIHKNYIIAQTQDSLIIVDQHAAHERLVYEALKDALYSKPLPSQLLLIPEIV 480

Query: 464 DLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDS 523
           +L E +   ++ H + L + G+  E FGP AI +RE P++L + N+  L++D+ DE  + 
Sbjct: 481 ELSEEDATCLLTHKDALQKFGLGIESFGPGAIVVRETPSMLGEVNVQALIKDLADEAAEY 540

Query: 524 STTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKL 583
            TT  L+  I+ + ATMAC+GSIRSGR +++ EMN LLR++E  P++  CNHGRPT+I+L
Sbjct: 541 DTTNNLKAMIDCVAATMACHGSIRSGRLLRAEEMNALLRQIEATPHTGTCNHGRPTYIEL 600

Query: 584 KLSDIEKLFGR 594
           KL+DIE+LFGR
Sbjct: 601 KLADIERLFGR 611


>gi|148253233|ref|YP_001237818.1| DNA mismatch repair protein [Bradyrhizobium sp. BTAi1]
 gi|166231106|sp|A5ECL8|MUTL_BRASB RecName: Full=DNA mismatch repair protein mutL
 gi|146405406|gb|ABQ33912.1| DNA mismatch repair protein MutL [Bradyrhizobium sp. BTAi1]
          Length = 618

 Score =  548 bits (1411), Expect = e-153,   Method: Composition-based stats.
 Identities = 237/617 (38%), Positives = 368/617 (59%), Gaps = 23/617 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E+IIN+IAAGE++ERP+  +KEL+EN++DA +SR++    GGG+    ITD+G
Sbjct: 1   MPVRQLPEQIINRIAAGEVVERPASVVKELVENAIDAGASRIDIFTDGGGRRKIAITDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT+ ++ +AV+RH TSK+ D D   I T GFRGEALPSIG+V+ L++ +R        
Sbjct: 61  GGMTAADLALAVERHATSKLDDEDLLQIRTLGFRGEALPSIGSVARLSITTRHKSEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + +   + S V P A+N GT VEV DLF   PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 ALQVDCGEKSPVVPAALNQGTRVEVADLFHATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           P ++FT +  +                  R+  ++G DF ++A+ +      + ++G+  
Sbjct: 181 PDIAFTIAGEERAPVTWAAALPGAPGQLTRLGDILGADFRSHAIAVQSARESVAVEGFAA 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P   R NA   Y+F+NGR V+DK IL  +R AYA+ +P  R+PVV L + +DPR+VD N
Sbjct: 241 APALTRANALGQYLFVNGRPVRDKLILGAVRAAYADYLPRDRHPVVALFVTLDPREVDAN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLP-- 356
           VHPAK+ +RFRN  ++R  II ++++ + ++G  T++      I++F    AP    P  
Sbjct: 301 VHPAKTEVRFRNAGLVRALIIHALKEGLAREGRRTAANDGGATIAAFRPAFAPPRPNPGP 360

Query: 357 ---KYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSED----------------NDPVE 397
               +  S +     +       +           ++E                 ++   
Sbjct: 361 MNWDWQRSPSAPAAPVPRDHGADAMPAAAAFSPAAFAEPAQAAFDVGGPRADLRLHEQPA 420

Query: 398 ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTL 457
             +     LG A  Q+H  YI++QT DGLVIVDQHAAHER+++E+++   ++  +  Q L
Sbjct: 421 APDLLDRPLGAARTQLHDTYIVAQTRDGLVIVDQHAAHERIVYERLKASLSAHGVQRQIL 480

Query: 458 LTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDII 517
           L P+I++L E     ++   ++L   G+  E FGP A+A+RE P++L K N   LLRD+ 
Sbjct: 481 LIPDIVELDEAIVEALLARTDELASFGLAIESFGPGAVAVRETPSLLGKINAAGLLRDLA 540

Query: 518 DEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGR 577
           + + +      L+ R+ ++ ATMAC+GS+R+GR+++  EMN LLREME+ PNS QCNHGR
Sbjct: 541 EHMEEWGEALPLERRLMHVAATMACHGSVRAGRRLKPEEMNALLREMEETPNSGQCNHGR 600

Query: 578 PTFIKLKLSDIEKLFGR 594
           PT+++LKL+D+EKLFGR
Sbjct: 601 PTYVELKLADVEKLFGR 617


>gi|294011778|ref|YP_003545238.1| DNA mismatch repair protein MutL [Sphingobium japonicum UT26S]
 gi|292675108|dbj|BAI96626.1| DNA mismatch repair protein MutL [Sphingobium japonicum UT26S]
          Length = 590

 Score =  548 bits (1411), Expect = e-153,   Method: Composition-based stats.
 Identities = 223/595 (37%), Positives = 350/595 (58%), Gaps = 7/595 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E ++N+IAAGE++ERP+ A+KE++EN++DA S R+   I+ GG    +++D+G
Sbjct: 1   MSIRRLPEHLVNRIAAGEVVERPASALKEIVENAVDAGSRRIAIRISNGGLDRIEVSDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM S EI +A++RH TSK+ DD   N+ T GFRGEALPSI +V+ L++ SRP  ++ G 
Sbjct: 61  CGMDSSEIALALERHATSKLPDDAIENVATLGFRGEALPSIASVARLSIDSRPAGSD-GW 119

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
              +      S  P A+ PGT V V  LF  +PAR  FL+S + E     DV+RR+A+A+
Sbjct: 120 NRTVDNGVTVSEGPAALPPGTRVIVEQLFGKVPARRKFLRSAKAEYAACLDVVRRLAMAH 179

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+          +       +    ++ +      +N V +  +   + L G   +
Sbjct: 180 PAIAFSMEHDGRRVLGVQAGEAREDR---VAALTDRALADNHVIVALEREGVRLSGVASL 236

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT++RG  +  ++F+NGR V+D+ ++  +R AYA+ +   R+PVV L L++ P +VDVNV
Sbjct: 237 PTYHRGVGDHQFLFVNGRPVRDRLLVGAVRGAYADMLARDRHPVVALFLDVPPLEVDVNV 296

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HPAK+ +RFR+P +IR  I+  +++A+  +G           +S++  +  P +  P  A
Sbjct: 297 HPAKTEVRFRDPALIRGMIVSGLRRALEAEGFRAVQHADPAGLSAWRSE--PVSPTPIGA 354

Query: 360 TSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYII 419
             +           +         +  P    +       E T + LG+A  Q+ + YI+
Sbjct: 355 MPIFEAAGAPVPTHSMADRRPAFLTPPPQARAEPAAAPAPEGTSFPLGVARGQVARTYIV 414

Query: 420 SQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDED 479
           ++  DGLVIVDQHAAHERL  E+MR+      I +Q LL PE+++L E  C  +     +
Sbjct: 415 AEAEDGLVIVDQHAAHERLTLERMRRAMEGQGIAAQALLLPEVVELDEPACDRLEARIAE 474

Query: 480 LHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILAT 539
           L   G++ ERFGP A+ +R  PA+L + ++  L+ D+ D++    +  +L++R++ + AT
Sbjct: 475 LKDFGLELERFGPAAMLVRATPAMLGQGDVQGLVSDLADDLAAYDSALSLKERLDLVAAT 534

Query: 540 MACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           MAC+GS+R+GR +   EMN LLREME  P S QCNHGRPT++KL   DIEKLFGR
Sbjct: 535 MACHGSVRAGRILSVAEMNALLREMEITPRSGQCNHGRPTWVKLGHGDIEKLFGR 589


>gi|83951218|ref|ZP_00959951.1| DNA mismatch repair protein [Roseovarius nubinhibens ISM]
 gi|83839117|gb|EAP78413.1| DNA mismatch repair protein [Roseovarius nubinhibens ISM]
          Length = 636

 Score =  548 bits (1411), Expect = e-153,   Method: Composition-based stats.
 Identities = 259/622 (41%), Positives = 388/622 (62%), Gaps = 31/622 (4%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN+LD+ ++R+E   A GGKS  ++TDNG G
Sbjct: 15  IRQLDDAAINRIAAGEVVERPASAVKELVENALDSGATRIEISQAQGGKSLIRVTDNGCG 74

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT +++P+A+ RH TSKI   D  NIH+FGFRGEALPS+GAV  LT+ SR   ++  A+I
Sbjct: 75  MTPQDLPLALSRHATSKIDGSDLLNIHSFGFRGEALPSLGAVGRLTIQSRAAGHD-AAEI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            +SG  +S+ RP A++ GT+V +RDLF+  PARL F++S++ ET  I DV++R+A+A P 
Sbjct: 134 TVSGGDMSAPRPTALSAGTVVTLRDLFYATPARLKFMRSDRAETQAIADVVKRLAMAEPS 193

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGNF----PERISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT    +     R         G+       R+++V+G +F  NA++++     + + 
Sbjct: 194 VGFTLRDVTGGGEGRVTFRADPEQGDLFDALHRRLARVLGAEFAENAIKIDASREALRMT 253

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   Y+F+NGR V+DK +   +R AY + +   R+P  VL L  DP  
Sbjct: 254 GYAALPTYSRGAAVAQYLFVNGRPVRDKMLTGALRAAYHDLLSRDRHPAAVLFLTCDPTL 313

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR+P + R  I+  ++ A+ ++G   SS ++   + +F  +      
Sbjct: 314 VDVNVHPAKSEVRFRDPALARGLIVSGLRHALAEEGHRASSTVAGATLGAFRPEATAPGQ 373

Query: 355 LPK-YATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDN-------------------- 393
            P+ Y         +    + +        S  P +++                      
Sbjct: 374 APRVYQMDRPGPASRAMAYQAQAPLTGAPLSQSPGFADLQAGYSARVEPDELSAPLADHP 433

Query: 394 -DPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
               +        LG A AQIH+NYII+QT DGLVIVDQHAAHERL++EK++       +
Sbjct: 434 GHEAQADAPLSAPLGAARAQIHENYIIAQTEDGLVIVDQHAAHERLVYEKLKTQQAERGV 493

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
            +Q LL PEI++L +G+   +++  EDL  LG+  E FG +A+A+RE+PAIL   +   L
Sbjct: 494 AAQALLIPEIVELSDGDRGALLDAAEDLAALGLVIEEFGGSAVAVREVPAILGAVDARAL 553

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           L D++DE+ D  ++ T++ RI+ IL+ +AC+GSIRSGR+M++ EMN LLREME  P+S Q
Sbjct: 554 LLDVLDELSDQGSSMTIRGRIDAILSRVACHGSIRSGRRMRAEEMNALLREMEATPHSGQ 613

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT++KL+L+DIE+LFGR
Sbjct: 614 CNHGRPTYVKLQLADIERLFGR 635


>gi|241760909|ref|ZP_04758998.1| DNA mismatch repair protein MutL [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|241374528|gb|EER63989.1| DNA mismatch repair protein MutL [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 613

 Score =  548 bits (1411), Expect = e-153,   Method: Composition-based stats.
 Identities = 218/615 (35%), Positives = 359/615 (58%), Gaps = 24/615 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E +IN+IAAGE++ERP+ A+KEL+EN++DA+S+R+   +  GG    ++ DNG
Sbjct: 1   MSIRRLPEDVINRIAAGEVVERPASALKELVENAIDAQSTRILIRLLKGGLDGIEVIDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD--FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+ ++E+ +A++RH TSK+ D+     + T GFRGEALPSI +V+ LTL SR   +++G
Sbjct: 61  IGIPADEMRLALERHATSKLPDNDAIEAVTTLGFRGEALPSIASVARLTLESRTADSDSG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +I +            +  GT ++V  LF  IPAR  F++S + E     DV+RR+A+ 
Sbjct: 121 WKIIVDNGHFEKEGIAPLPKGTRIKVDSLFARIPARRKFMRSAKSEYMACHDVVRRLAMT 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P ++F+        + +N      +   R++ +I     +N+V +  + +++ L+G   
Sbjct: 181 RPDIAFSLEHDGRRIFSLN---GGESRQRRVAALIDRTLKDNSVTVEYQRDQMQLEGVAS 237

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+RG A+  Y+F+NGR V+D+ ++ ++R AY + +   R+PV+ L L +    VD+N
Sbjct: 238 LPTFHRGLADHQYLFVNGRPVKDRLLIGSVRAAYHDLLAKDRHPVLALFLTLPNSDVDIN 297

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHPAK  +RFR+   +R+ I+ +++++++  G  ++     + +  + + +         
Sbjct: 298 VHPAKGEVRFRDSQAVRSLIVGALRESLDLSGFRSAQPADVQAMGKWRKSSDLPISTNPA 357

Query: 359 A---------------TSLTNTQEKLFLQENRLSTNDLLPS----DDPTYSEDNDPVEES 399
           A                S      K    +    T D L S            N   + S
Sbjct: 358 AIHEEKSALSDSGLLFKSRPTEAPKAPSAQAHQRTADDLWSAATKSPIPPMGRNTSTDSS 417

Query: 400 EATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLT 459
           E + + LG+A  QI   YII+++ DGLVIVDQHAAHERL+ E+MR+   + ++ SQ LL 
Sbjct: 418 EQSDFPLGLARGQIAATYIIAESKDGLVIVDQHAAHERLVMERMRRALENGQVASQRLLM 477

Query: 460 PEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDE 519
           P+++++ E  C L  +  ++   +G++ ERFG  AI +R  PA+L    +  +++D+  E
Sbjct: 478 PDVVEMDEVSCDLFEQRQDEFAAMGLETERFGHEAILVRATPAMLGNCEVKAMIKDLAAE 537

Query: 520 IIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPT 579
           I     +  L+++ ++I+ATMAC+GS+R+GR +   EMN LLREME  P+S QCNHGRPT
Sbjct: 538 ITAYDQSLLLKEKFDHIVATMACHGSVRAGRLLSIAEMNALLREMEITPHSGQCNHGRPT 597

Query: 580 FIKLKLSDIEKLFGR 594
           ++KL   DIEKLFGR
Sbjct: 598 WVKLGHKDIEKLFGR 612


>gi|30249702|ref|NP_841772.1| mutL; DNA mismatch repair protein [Nitrosomonas europaea ATCC
           19718]
 gi|30180739|emb|CAD85653.1| mutL; DNA mismatch repair protein [Nitrosomonas europaea ATCC
           19718]
          Length = 604

 Score =  547 bits (1410), Expect = e-153,   Method: Composition-based stats.
 Identities = 217/604 (35%), Positives = 330/604 (54%), Gaps = 15/604 (2%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            I+ L + +I+QIAAGE+IERP+  +KEL+EN++DA ++ +   IA GG    ++TDNG 
Sbjct: 3   PIKLLPDGLISQIAAGEVIERPASVLKELLENAIDAGTTDISVNIAQGGLKLIRVTDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G++ EE+P+A+ RH TSKI+  +D   I + GFRGE L SI +VS+L L+S  P      
Sbjct: 63  GISGEELPLALTRHATSKIASQEDLYRITSLGFRGEGLASIASVSNLLLISHQPGGKHAW 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI   G ++    P +   GT VEVRDLFF +PAR  FLK+E  E     ++IRRMA+++
Sbjct: 123 QIRSEGIRVMQPEPSSHAAGTTVEVRDLFFNLPARRKFLKTEATEFAHCEEIIRRMALSH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
             ++FT     +    +     +     RI  V+GE+F  +A  ++E+S  I LQG   +
Sbjct: 183 AGIAFTLRHNGN----LRGHWQSAEAAVRIKTVLGEEFTRSAAWIDERSAGIGLQGMLAL 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P ++R   +  Y F+NGR V+DK I   +R AY + + L R+   VL L+IDP QVDVNV
Sbjct: 239 PAYSRAARDMQYFFVNGRFVRDKLITHALREAYRDVLHLDRHAAFVLYLDIDPEQVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAIN-----KKGISTSSVLSKKMISSFHQDNAPKTH 354
           HP K+ IRFR    I  FI   + KA++      +   +SS L    I    +   P   
Sbjct: 299 HPTKTEIRFREARAIHQFIYHGVSKALSLPRSGTELSQSSSQLMADDIVPPAEKRVPAAP 358

Query: 355 LPKYATSLTNTQE----KLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIAC 410
           +  Y        E         +    +     +    + +              LG A 
Sbjct: 359 MLNYPRQTGLPSEMIAQPFNFYQVLSGSESDSTATQNPFRQTGAGESNEHPALPPLGFAL 418

Query: 411 AQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGEC 470
            Q+H  YI++Q   GLVIVD HAAHER+++E+++   +   +++Q LL P        + 
Sbjct: 419 GQLHGVYILAQNWKGLVIVDMHAAHERIVYEQLKLQMDEQTLSAQRLLIPVTFHADSLDI 478

Query: 471 ALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQ 530
           A   E+   L +LG +        +A+R +PAIL   +  +L+ +++DEI +      L 
Sbjct: 479 ATAEENQSLLQQLGFEVTVLTATTLAVRAVPAILQDADTEKLVCNVLDEIRNGDPGQLLA 538

Query: 531 DRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEK 590
            R   +LATMAC+G++R+ R +  IEMN LLR+ME    S QCNHGRPT+ ++ L++++K
Sbjct: 539 ARRNELLATMACHGAVRANRPLTLIEMNELLRKMEVTERSDQCNHGRPTWFEISLAELDK 598

Query: 591 LFGR 594
           +F R
Sbjct: 599 MFMR 602


>gi|187929904|ref|YP_001900391.1| DNA mismatch repair protein [Ralstonia pickettii 12J]
 gi|187726794|gb|ACD27959.1| DNA mismatch repair protein MutL [Ralstonia pickettii 12J]
          Length = 647

 Score =  547 bits (1410), Expect = e-153,   Method: Composition-based stats.
 Identities = 202/631 (32%), Positives = 330/631 (52%), Gaps = 45/631 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            IR L +++I+QIAAGE++ERP+  +KEL+EN+LDA +++++  +  GG     ITDNG 
Sbjct: 22  PIRPLPDQLISQIAAGEVVERPASVVKELLENALDAGATQLQIKLEEGGVRRIAITDNGG 81

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++E+P+A+ RH TSKI   ++  ++ T GFRGEAL SI +V+ LTL SR   +    
Sbjct: 82  GIPADELPVALMRHATSKIGSLEELESVATLGFRGEALASIASVAELTLTSRTAHDAHAT 141

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI     +    +P +   GT V+V+ L+F  PAR  FLK+EQ E     +VIRR A+A 
Sbjct: 142 QI---IAQTGRAQPASGGVGTTVDVQHLYFNTPARRKFLKTEQTELGHCMEVIRRTALAR 198

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V+ +           N    +     R + V+G +F    +   E + E+ L G+ G+
Sbjct: 199 PDVAISVHHNGKPLEHWNATQADS----RSAAVLGTEFARARLPFEESAGELRLFGFAGL 254

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT +RG A+  + ++NGR V+D+ +   +R+AY + +   R+P  VL LE+ P  VDVNV
Sbjct: 255 PTASRGRADHQFFYVNGRFVRDRLLTHAVRSAYEDVLHGDRFPAYVLCLELPPEAVDVNV 314

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLP--- 356
           HP+K  +RFR+   +  F+  ++Q+A+++        L   +  +           P   
Sbjct: 315 HPSKIEVRFRDSRAVHQFVYHAVQRALSRHAGEQGDSLRTDIAEAPEGAGVATAPSPADN 374

Query: 357 --KYATSLTNTQEKLFLQENRLST-----NDLLPSDDPTYSEDNDPVEES---------- 399
             ++   +   Q  L + + R         D  P      +   D    +          
Sbjct: 375 TTRWINQMAARQTSLGIAQPRAEYLSMMRGDSAPMPPTRPAWMADVPSAATLFDGGAATA 434

Query: 400 ----------------EATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKM 443
                           E   + LG A AQ+H  Y+++Q T G+V+VD HAAHER+++E++
Sbjct: 435 QSPAAVAEPAAAQQADEDDAHPLGFAVAQLHGIYVLAQNTRGMVLVDMHAAHERILYEQL 494

Query: 444 RQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAI 503
           +    + ++  Q LL P        E     E  + L  LG       P  +A+R +P +
Sbjct: 495 KTALETKRVEVQPLLIPVTFAANPVEIGTAEEFRDTLTLLGFDISAVSPTTLAVRSVPTL 554

Query: 504 LSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLRE 563
           L K +   L RD++ ++     +  L +R   +LAT+AC+ ++R+ R++   EMN LLR+
Sbjct: 555 LQKADAQALARDVLRDLHAYGGSRVLAERQNELLATLACHSAVRANRRLNLDEMNALLRQ 614

Query: 564 MEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ME    + QCNHGRPT+I+L ++D+++LF R
Sbjct: 615 MEATERADQCNHGRPTWIQLTVADLDRLFLR 645


>gi|82702273|ref|YP_411839.1| DNA mismatch repair protein MutL [Nitrosospira multiformis ATCC
           25196]
 gi|82410338|gb|ABB74447.1| DNA mismatch repair protein MutL [Nitrosospira multiformis ATCC
           25196]
          Length = 616

 Score =  547 bits (1410), Expect = e-153,   Method: Composition-based stats.
 Identities = 213/615 (34%), Positives = 336/615 (54%), Gaps = 27/615 (4%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L + +I+QIAAGE++ERP+ A+KEL+ENSLDA ++ V   +  GG    ++ DNG G
Sbjct: 4   IQPLPDLLISQIAAGEVVERPASALKELLENSLDAGATEVTVQLFQGGVKLVRVADNGAG 63

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           ++ E++P+A+ RH TSKI   +D  N+ + GFRGEAL SI +VS L L+SR   +    +
Sbjct: 64  ISGEDLPLALARHATSKIRTLEDLQNVPSLGFRGEALASIASVSRLALVSRSAGDKHAWR 123

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I     + +   P A   GT VE+RDL+F  PAR  FLK+E  E      V +R+A++ P
Sbjct: 124 IEAEAGRFTPPEPAAFAQGTAVEMRDLYFNTPARRKFLKTEATEFAHCESVFKRIALSRP 183

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V FT     + R  +       +   RI+ V+G++F   +V +++++ ++ L G   +P
Sbjct: 184 SVGFTLQHNGTVRSHLRT----ADARLRIAAVLGDEFSQASVFVDDQAADLRLWGMAALP 239

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
            ++R + +  Y F+NGR V+DK +   +R AY + + L R+P  VL LEI+   VDVNVH
Sbjct: 240 AYSRSSGDAQYFFVNGRFVRDKLVAHALREAYRDILHLDRHPAFVLFLEINGGGVDVNVH 299

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGIST-SSVLSKKMISSF------HQDNAPKT 353
           P+K+ +RFR+P  +  FI  ++ KA+    ++  ++V     +  F          AP  
Sbjct: 300 PSKTEVRFRDPRALHQFIFHTVDKALAMPHLTGGAAVPVAGKLPEFTRKAAGEVSLAPPA 359

Query: 354 HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE--------------S 399
           +  + A    +   ++   + +     L  SD    +                       
Sbjct: 360 YSRQDAIPFASAAPQIKAAQPQAFYQVLFGSDSNAGTRQTGYQAGINGQSAFMKPEGTVR 419

Query: 400 EATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLT 459
           E     LG A AQ+   YI+SQ   GL+IVD HAAHER+++EK++   ++  ++ Q LL 
Sbjct: 420 EPEIPPLGFALAQLLGVYILSQNERGLLIVDMHAAHERILYEKLKSALDNHTLSMQPLLI 479

Query: 460 PEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDE 519
           P        + A   E+   LH +G +   F P  +A+R +PA L   ++  L RD+++E
Sbjct: 480 PAAFRADSQDIATAEENSAVLHDIGFEISPFSPVMLAVRAVPAALKDADVVTLARDVLNE 539

Query: 520 IIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPT 579
           I +   +  L  R   +LATMAC+G+IR+ R +   EMN LLREME    S QCNHGRPT
Sbjct: 540 IREFGGSQVLVSRRNELLATMACHGAIRANRSLSIPEMNALLREMEITERSGQCNHGRPT 599

Query: 580 FIKLKLSDIEKLFGR 594
           + ++  +D++K+F R
Sbjct: 600 WFEISRTDLDKMFMR 614


>gi|13476839|ref|NP_108408.1| DNA mismatch repair protein [Mesorhizobium loti MAFF303099]
 gi|20455124|sp|Q983L2|MUTL_RHILO RecName: Full=DNA mismatch repair protein mutL
 gi|14027600|dbj|BAB53869.1| DNA mismatch repair protein; MutL [Mesorhizobium loti MAFF303099]
          Length = 627

 Score =  547 bits (1410), Expect = e-153,   Method: Composition-based stats.
 Identities = 273/627 (43%), Positives = 397/627 (63%), Gaps = 34/627 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+LSE +INQIAAGE+IERP+  +KEL+EN+LDA +SRVE V AGGG +  ++TD+G
Sbjct: 1   MPIRQLSETMINQIAAGEVIERPASVVKELVENALDAGASRVEVVTAGGGLNLIRVTDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+   E+ +A+ RHCTSK+++D ++I + GFRGEALPSIG+VS L++ SR    ++ A+
Sbjct: 61  SGIPEPELALAIARHCTSKLAEDINDIRSLGFRGEALPSIGSVSRLSIRSRTALGDSAAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I I G ++  VRP A N GT VEVRDLFF  PARL F+K E+ E++  +DV++R+AIA+P
Sbjct: 121 IGIEGGRVLPVRPAAANRGTTVEVRDLFFATPARLKFMKGERAESSATSDVVKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNF--QSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            V FT +    +  ++     S  G+    ++QV+G +F +N++ ++     + L G+  
Sbjct: 181 AVRFTLAGSDRSTLELPATDDSPEGSLRR-VAQVMGAEFPDNSIAIDAMREGVHLTGHVS 239

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           IP+F+R NA Q Y ++NGR V+DK I   IR A+A+ +P  R+ V VL L +DP  VDVN
Sbjct: 240 IPSFSRANALQQYAYVNGRPVRDKLIAGAIRGAFADVLPRDRHAVTVLFLTLDPAIVDVN 299

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL--- 355
           VHPAK+ +RFR+P ++R  I+ +I++A+   GI +++  +  M+++F    A   H    
Sbjct: 300 VHPAKADVRFRDPGLVRGLIVGAIRQALADAGIRSATTGAAGMMAAFRPGAASYNHGGPA 359

Query: 356 -------------------PKYATSLT-----NTQEKLFLQENRLSTNDLLPSDDPTYSE 391
                              P  +            E+   +    S       D      
Sbjct: 360 NGHRSYEAAYRASGSAGFDPARSPQRPLDMQFGDFERAGARHGGFSEPGQAAFDTGPLVS 419

Query: 392 DNDPVEESEATHYQLGIACA----QIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDF 447
            +  V ++E T   LG        Q+H+NYI++QT D LVIVDQHAAHERL++E ++   
Sbjct: 420 ADARVGQNETTETLLGTVLGAARAQVHENYIVAQTRDSLVIVDQHAAHERLVYEALKNAL 479

Query: 448 NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKK 507
           +S  + SQ LL PEIIDL E +   +  H E L R G+  ERFGP A+A+RE P++L + 
Sbjct: 480 HSRPVPSQMLLLPEIIDLPEEDAERLAMHSETLARFGLGIERFGPGAVAVRETPSMLGET 539

Query: 508 NIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKN 567
           N+ QL+RD+ DEI D+ T  TL++R++ I ATMAC+GS+RSGR +++ EMN LLR+ME  
Sbjct: 540 NVQQLVRDLADEIADNDTVETLKERLDKIAATMACHGSVRSGRLLKAEEMNALLRQMEAT 599

Query: 568 PNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           P S  CNHGRPT+I+LKL+DIE+LFGR
Sbjct: 600 PGSGTCNHGRPTYIELKLADIERLFGR 626


>gi|240849931|ref|YP_002971320.1| DNA mismatch repair protein MutL [Bartonella grahamii as4aup]
 gi|240267054|gb|ACS50642.1| DNA mismatch repair protein MutL [Bartonella grahamii as4aup]
          Length = 617

 Score =  547 bits (1410), Expect = e-153,   Method: Composition-based stats.
 Identities = 267/617 (43%), Positives = 399/617 (64%), Gaps = 24/617 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  +KEL+EN++DA ++R+E + A GGK+F +++DNG
Sbjct: 1   MIIRHLSENIINQIAAGEVIERPANVVKELVENAIDAGATRIEIITANGGKNFIKVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +G+ ++++ +AV RHCTSKI+DD  NI   GFRGEALPSIG+V+ L L+SR     + A+
Sbjct: 61  YGIPADQLTLAVSRHCTSKITDDVHNICFLGFRGEALPSIGSVAKLKLISRTKDAESAAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I+++  KI   +P A N GTIVEVRDLFF  PARL F+K+++ ETN I+D+I+R+AIA+P
Sbjct: 121 ISVTAGKIVGPKPAAANLGTIVEVRDLFFVTPARLKFMKTDRAETNAISDMIKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ S +     +++   +      +RI+Q++G++F  N++ LN +   + L G+  +
Sbjct: 181 HIRFSLSGLDRTSMELSATENNIQGQLQRITQIMGKEFAPNSIALNAEREAVRLTGFACL 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNR N+   + ++NGR V+DKF+   IR AYA+ +   RYPV +L +++ P +VDVNV
Sbjct: 241 PSFNRNNSLHQFAYVNGRPVRDKFLWGAIRGAYADVMTRDRYPVAILFIDLPPAEVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HPAK+ +RFR+P +IR  I+ +I++A+ + GI  +S  S+  +++F Q   P    P   
Sbjct: 301 HPAKADVRFRDPGLIRGLIVGAIREALQQSGIRPTSTRSEATLAAF-QIQKPLVQQPLGN 359

Query: 360 TSLTNTQEKLFLQENRLSTNDLLPSDDPTYSED----------------------NDPVE 397
              T+       Q +  +   ++       S                         +   
Sbjct: 360 FKNTHQSSSYSPQPHHFAAASMVHKPLDITSSFGLKEDATPIMEGLNIPSGDTYIPNTTS 419

Query: 398 ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTL 457
            SE   Y LG A AQIH+NYII+QT D L+IVDQHAAHERL++E ++    S  + SQ L
Sbjct: 420 SSEELSYPLGAARAQIHKNYIIAQTQDSLIIVDQHAAHERLVYEALKNALYSKPLPSQLL 479

Query: 458 LTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDII 517
           L PEI++L E +   ++ H + L + G+  E FGP AI +RE P++L + N+  L++D+ 
Sbjct: 480 LIPEIVELSEEDATCLLTHKDALQKFGLGIEPFGPGAIVVRETPSMLGEINVQALIKDLA 539

Query: 518 DEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGR 577
           DE  +  TT  L+  ++ + ATMAC+GSIRSGR ++  EMN LLR+ME  PN+S CNHGR
Sbjct: 540 DEAAEYDTTNNLKAMLDYVAATMACHGSIRSGRLLRPEEMNTLLRQMEAIPNTSTCNHGR 599

Query: 578 PTFIKLKLSDIEKLFGR 594
           PT+I+LKL+DIE+LFGR
Sbjct: 600 PTYIELKLADIERLFGR 616


>gi|83859480|ref|ZP_00953001.1| DNA mismatch repair protein MutL [Oceanicaulis alexandrii HTCC2633]
 gi|83852927|gb|EAP90780.1| DNA mismatch repair protein MutL [Oceanicaulis alexandrii HTCC2633]
          Length = 638

 Score =  547 bits (1410), Expect = e-153,   Method: Composition-based stats.
 Identities = 246/637 (38%), Positives = 377/637 (59%), Gaps = 43/637 (6%)

Query: 1   MK-IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDN 59
           M  IR+LS + +N+IAAGE++ERP+ A+KEL+EN+LDA + R++  I GGG +   I D+
Sbjct: 1   MTLIRRLSPETVNRIAAGEVVERPASAVKELVENALDAGAQRIDIRIEGGGLTRIVIEDD 60

Query: 60  GFGMTSEEIPMAVQRHCTSKI------SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPP 113
           G GM +E +  A++RH TSK+       DD  NIH+ GFRGEALPSIG+V+ L + ++  
Sbjct: 61  GSGMDAEGLETAIERHATSKLPVGEDGQDDLLNIHSMGFRGEALPSIGSVARLNITTQDE 120

Query: 114 QNNTGAQIAISGEKISSVRPVA--MNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDV 171
           +     ++++ G   S  RP       GT VEV DLF+  PARL FLKSE+ E+  ++DV
Sbjct: 121 ELGGAWELSVEGGTKSGPRPAPSLGRRGTRVEVCDLFYATPARLKFLKSERAESTAVSDV 180

Query: 172 IRRMAIAYPKVSFTFSTIKSNRYKMNFQSTNGN---FPERISQVIGEDFINNAVELNEKS 228
           I+R+A+A P V F  S    +R     +ST         R+S ++G DF  NA+ ++++ 
Sbjct: 181 IKRLALARPDVGFFLSVDGRSRVSAPAESTEDRDEARRGRLSSILGADFGENALVIDQER 240

Query: 229 NEITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLL 288
             + L G   +PT+NRG+    ++F+NGR V+DK I+  +R AY + +   R+PVV L +
Sbjct: 241 EGVHLTGLASLPTYNRGSNQHQFLFVNGRPVKDKLIVGAVRGAYQDFLARDRHPVVALYV 300

Query: 289 EIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD 348
           ++    VDVNVHPAK+ +RFR+  ++R  I+ +++ A+   G   S+ ++   +     +
Sbjct: 301 DLPSSHVDVNVHPAKAEVRFRDSGLVRGLIVGALRHALAGAGHRASTTVAGYALGRARPE 360

Query: 349 NAPKTHLP-----KYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDP-------- 395
            AP   LP       ++   N     +  +              + +E +          
Sbjct: 361 GAPTHALPLTRGSSISSGWANRPSPAWESQLSEHHETSGYGYGESQTEASQYGRGDLAPG 420

Query: 396 ------------------VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHER 437
                               E+    + LG+A AQ+H  Y+I+QT DGLVIVDQHAAHER
Sbjct: 421 MSARTEPSYGGEPADGAPAAETHTPDFPLGVARAQVHATYVIAQTEDGLVIVDQHAAHER 480

Query: 438 LIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAI 497
           L++E+M++    T +  Q LL PEI++L E E   +++  E L  LG+  E FGP A+A+
Sbjct: 481 LVYERMKKQLADTGVARQALLVPEIVELDEAEARRVLDRAEQLAELGLVIEPFGPGALAV 540

Query: 498 REIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEM 557
           RE PA+L + ++  L+RD+ DEI +     +L++++E ++ TMAC+GS+RSGR++   EM
Sbjct: 541 RETPALLKRLDVQGLIRDLADEIAEYDEALSLKEKLEEVVGTMACHGSVRSGRRLTGDEM 600

Query: 558 NRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           N LLREME  P+S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 601 NALLREMEATPHSGQCNHGRPTYVELKLADIERLFGR 637


>gi|224826520|ref|ZP_03699621.1| DNA mismatch repair protein MutL [Lutiella nitroferrum 2002]
 gi|224601121|gb|EEG07303.1| DNA mismatch repair protein MutL [Lutiella nitroferrum 2002]
          Length = 629

 Score =  547 bits (1410), Expect = e-153,   Method: Composition-based stats.
 Identities = 218/629 (34%), Positives = 329/629 (52%), Gaps = 40/629 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENSLDA + R+   +A GG    ++TDNG 
Sbjct: 3   RIHALPDHLVNQIAAGEVVERPASALKEMLENSLDAGADRITVDLAQGGIKLIRVTDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+A+ RH TSKI+   D  ++ T GFRGE L SI +VS LTL+SRP +     
Sbjct: 63  GIVPDDLPLALDRHATSKIASLADLESVATLGFRGEGLASIASVSRLTLISRPHEEAHAY 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI      + SV P A  PGT VEV DL+F  PAR  FLKSE  E         R+A+A+
Sbjct: 123 QIIAIDGALHSVEPAAHAPGTSVEVVDLYFNTPARRKFLKSENTEYAHCAATFERIALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P+V F         +++  QS      ER+  ++G+DF+  A+ L   +  + L G+   
Sbjct: 183 PQVEFLLRHNGKVVWRLPAQS----LAERVGALLGKDFVEAALPLETAAGGLQLAGFVAS 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT+++ + +  Y ++NGR V+DK     +R AY + +   R+P   L L IDP  VDVNV
Sbjct: 239 PTYSKASRDAQYFYVNGRFVRDKTAQHALRQAYRDVLHHDRHPAYALFLTIDPAGVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HP K  +RFR    I  F+  S+ KA+       +  ++     +           P  A
Sbjct: 299 HPTKIEVRFRESQAIHQFLFHSVNKALAATTAGAAPAVALAEGVATPSSANLSGASPAPA 358

Query: 360 TSLTNTQ----------------------------------EKLFLQENRLSTNDLLPSD 385
                +Q                                    L  +E +  T    P  
Sbjct: 359 GLFATSQTGNGRTPVQSYRYEQQSIPLGVAREAIGVYDAMFSGLREEERQADTRPAGPLP 418

Query: 386 DPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQ 445
            P  +     + +S+     LG A AQ+H  YI+SQ  +GL++VD HAAHER+++E+++ 
Sbjct: 419 SPLPAATLATLPDSDDGIPPLGFALAQLHGVYILSQCQEGLIVVDMHAAHERIVYERLKN 478

Query: 446 DFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILS 505
              +  I  Q LL P        E A + EH E++ RLG++     P  IA+R +P  L 
Sbjct: 479 ALEADSIPMQPLLLPVSFAADRMEAATVHEHGEEMKRLGVELAPLSPTQIAVRGVPVWLK 538

Query: 506 KKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREME 565
             N  +L R ++ ++ +   T  L +R   +LATMAC+G++R+ R++   EMN LLR+ME
Sbjct: 539 DGNPVELARAVLKDVREFGLTRVLTERRNELLATMACHGAVRANRQLTLAEMNALLRDME 598

Query: 566 KNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
               S QCNHGRPT+ +L + D++ LF R
Sbjct: 599 ATERSGQCNHGRPTWSRLTMKDLDNLFMR 627


>gi|113869023|ref|YP_727512.1| DNA mismatch repair protein [Ralstonia eutropha H16]
 gi|113527799|emb|CAJ94144.1| DNA mismatch repair protein MutL [Ralstonia eutropha H16]
          Length = 660

 Score =  547 bits (1409), Expect = e-153,   Method: Composition-based stats.
 Identities = 205/648 (31%), Positives = 336/648 (51%), Gaps = 62/648 (9%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            IR L +++I+QIAAGE++ERP+  +KEL+EN+LDA ++++   +  GG     ITDNG 
Sbjct: 18  PIRPLPDQLISQIAAGEVVERPASVVKELLENALDAGATQLGIRLEEGGVRRIVITDNGC 77

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ + E+P+A+ RH TSKI+  D+  ++ T GFRGEAL SI +VS L L SR   +    
Sbjct: 78  GIPAAELPVALMRHATSKIASLDELESVLTLGFRGEALASIASVSQLALTSRTAADAHAT 137

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q++     +   +P +   GT V+V+ L+F  PAR  FLKSEQ E     +++RR+A+A 
Sbjct: 138 QVSADTGTV---QPASGGVGTTVDVQHLYFNTPARRKFLKSEQTELGHCLEMVRRVALAR 194

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V+ +           N     G+   R +QV+G DF    + L+E+++ + L G+ G+
Sbjct: 195 PDVTISVHHNGKPLEHWNA----GDVATRTAQVLGNDFARARLPLDEEADTLHLYGFAGL 250

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT +RG  +Q Y F+NGR V+DK +   +R+AY + +   R+P  VL L++ P  VDVNV
Sbjct: 251 PTASRGRPDQQYFFVNGRFVRDKLLNHAVRSAYQDVLHGDRFPSYVLCLDLPPEMVDVNV 310

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL---- 355
           HP+K  +RFR    +  F+  ++Q+ + ++       L           +   T      
Sbjct: 311 HPSKIEVRFRESRAVHQFVYHAVQRCLARQAGGNGDSLHTDADGEITLPSGGATPAGGAR 370

Query: 356 ----------PKYATSLTNTQEKLFLQENRLST----NDLLPSDDPTYSEDNDPVEESEA 401
                      ++       Q +L + + R +      D        Y        ++ A
Sbjct: 371 PGFGGGSGGGGQWINYSAARQTELGIAQPRQAYLGMVRDAAAPAARPYGAMPGTPAQAPA 430

Query: 402 T-----------------------------------HYQLGIACAQIHQNYIISQTTDGL 426
                                                + LG A AQ+H  Y+++Q   GL
Sbjct: 431 WLADAQAARADDPPGLLDRLPPAARAGFADPADAPDDHPLGYAIAQLHGIYVLAQNARGL 490

Query: 427 VIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIK 486
           V+VD HAAHER+++E+++   ++  +  Q LL P  +     E  +  EH E L  LG  
Sbjct: 491 VLVDMHAAHERILYEQIKAGLDARDLAVQPLLIPVTLPGSPVEIGVAEEHQETLTLLGFD 550

Query: 487 AERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSI 546
                P  +A+R +PA+L + +   L RD++ ++     +  L +R   +LAT+AC+ ++
Sbjct: 551 IAPVSPTTLAVRAVPALLQQADAEALARDVLRDLHAYGGSRVLAERRNELLATLACHSAV 610

Query: 547 RSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           R+ RK+   EMN LLR+ME+   + QCNHGRPT+++L ++++++LF R
Sbjct: 611 RANRKLTLEEMNALLRQMEQTERADQCNHGRPTWVQLTVTELDRLFLR 658


>gi|253998998|ref|YP_003051061.1| DNA mismatch repair protein MutL [Methylovorus sp. SIP3-4]
 gi|253985677|gb|ACT50534.1| DNA mismatch repair protein MutL [Methylovorus sp. SIP3-4]
          Length = 624

 Score =  546 bits (1407), Expect = e-153,   Method: Composition-based stats.
 Identities = 210/623 (33%), Positives = 332/623 (53%), Gaps = 35/623 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L +++I+QIAAGE++ERP+ A+KEL+ENSLDA SS +   +  GG    ++TD+G G
Sbjct: 4   IKLLPDQLISQIAAGEVVERPASALKELLENSLDAGSSDIAVTLGQGGVKLLRVTDDGNG 63

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +   ++ +A+ RH TSKI+  DD  ++ + GFRGEAL SI ++S  ++ SR  + +   +
Sbjct: 64  IPHGDLTLALTRHATSKIASLDDLESVASLGFRGEALASIASISRTSITSRHAEASHAWR 123

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA  G  +    P A++ GTIVEV+D++F  PAR  FLK+EQ E     +  RR+A++ P
Sbjct: 124 IAADGGLLGDAAPAALDRGTIVEVQDIYFNTPARRKFLKTEQTEFGHCEEAFRRIALSRP 183

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V F          ++      G    R ++V+G DF   A EL+E +  + L G    P
Sbjct: 184 DVGFMLQHNGRALMRL----APGEAKRRFTEVLGPDFSAEAFELDESAGGLRLWGMAAKP 239

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TF+R   +  YV++NGR V+DK I   IR AY + +   R+P   L LE+DP  VDVNVH
Sbjct: 240 TFSRSARDTQYVYVNGRFVRDKLISHAIRQAYQDVLHHDRHPAFALFLELDPTLVDVNVH 299

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSS-----------VLSKKMISSFHQDN 349
           P+K+ +RFR    +  FI  ++ KA+       ++                 I +     
Sbjct: 300 PSKTEVRFREGQAVHRFIFHALHKALATPVGLPANGLVPPPAAAPATSYSPGIPAGQPYP 359

Query: 350 APKTHLPKYATSLTNTQEKLFLQENRLS------------TNDLLPSDDPTYSEDNDPVE 397
             +      A       + LF    R +            ++  L +        +    
Sbjct: 360 RQQGSFDLRANEAPGFYQTLFGGLPREAVDTASSFVPSAISSADLQATLSPSQASSSLSP 419

Query: 398 ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTL 457
           E  A  Y LG A AQ+H  Y+++Q   GL++VD HAAHER+++E+++   +   +  Q L
Sbjct: 420 EQAAQEYPLGFALAQLHGVYVLAQNALGLIVVDMHAAHERIMYERLKNALDGDSVPMQPL 479

Query: 458 LTPEIIDLLEGECALIMEH------DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQ 511
           L P   +    E A + E        + LH+LG +  +  P+ +A+R IPA+L   +   
Sbjct: 480 LLPVSFNADRFEVATVQEQLSTPEGQQTLHQLGFEIVQLSPSTLAVRAIPAMLQDADAVA 539

Query: 512 LLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSS 571
           L RD++ ++ +   +  L +R   +LATMAC+ ++R+ R +   EMN LLR+ME    S 
Sbjct: 540 LARDVLRDLREYGGSRVLTERRNELLATMACHAAVRANRILSIQEMNALLRDMEATERSG 599

Query: 572 QCNHGRPTFIKLKLSDIEKLFGR 594
           QCNHGRPT+ +  ++D++K+F R
Sbjct: 600 QCNHGRPTWFQATMADLDKMFMR 622


>gi|17547282|ref|NP_520684.1| DNA mismatch repair protein [Ralstonia solanacearum GMI1000]
 gi|20455088|sp|Q8XWB1|MUTL_RALSO RecName: Full=DNA mismatch repair protein mutL
 gi|17429584|emb|CAD16270.1| probable dna mismatch repair protein mutl [Ralstonia solanacearum
           GMI1000]
          Length = 636

 Score =  546 bits (1407), Expect = e-153,   Method: Composition-based stats.
 Identities = 206/632 (32%), Positives = 336/632 (53%), Gaps = 46/632 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            IR L +++I+QIAAGE++ERP+  +KEL+EN+LDA +++++  +  GG     ITDNG 
Sbjct: 10  PIRPLPDQLISQIAAGEVVERPASVVKELLENALDAGATQLQIKLEEGGVRRIAITDNGG 69

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +E+P+A+ RH TSKI   ++  ++ T GFRGEAL SI +V+ LTL SR  Q+    
Sbjct: 70  GIPVDELPVALMRHATSKIGSLEELESVATLGFRGEALASIASVAELTLTSRTAQDAHAT 129

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI     ++   +P +   GT V+V+ L+F  PAR  FLK+EQ E     +VIRR A+A 
Sbjct: 130 QIIAQTGRV---QPASGGVGTTVDVQHLYFNTPARRKFLKTEQTELGHCLEVIRRTALAR 186

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V+ +           N          R + V+G +F    +   E + E+ L G+ G+
Sbjct: 187 PDVAISVHHNGKPLEHWNA----AQADMRTAAVLGTEFARARLPFEEAAGELRLFGFAGL 242

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT +RG A+  + ++NGR V+D+ +   +R+AY + +   R+P  VL LE+ P  VDVNV
Sbjct: 243 PTASRGRADHQFFYVNGRFVRDRLLTHAVRSAYEDVLHGDRFPAYVLCLELPPEAVDVNV 302

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA---PKTHLP 356
           HP+K  +RFR+   +  F+  ++Q+A+++        L   +  +  Q  A   P  +  
Sbjct: 303 HPSKIEVRFRDSRAVHQFVYHAVQRALSRHAGEQGDSLRTDIADAPEQPGATATPADNTT 362

Query: 357 KYATSLTNTQEKLFLQENRL--------------STNDLLPSDDPTYSEDND-------- 394
           ++   +   Q  L + + R               S+     +D P+ +   D        
Sbjct: 363 RWVNQMAARQTSLGIAQPRAEYLAMMRGGSAPQPSSRPAWMADVPSAATLFDGAASAPAD 422

Query: 395 ------------PVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEK 442
                       P  +     + LG A AQ+H  Y+++Q   G+V+VD HAAHER+++E+
Sbjct: 423 AAPAQASEPAAAPQADDSDDAHPLGFAVAQLHGIYVLAQNARGMVLVDMHAAHERILYEQ 482

Query: 443 MRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPA 502
           ++    + +I  Q LL P        E     E  + L  LG       P  +A+R +P 
Sbjct: 483 LKTALEARRIEVQPLLIPVTFAASPVEIGTAEEFGDTLDLLGFDISAVSPTTLAVRAVPT 542

Query: 503 ILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLR 562
           +L K +   L RD++ ++     +  L +R   +LAT+AC+ ++R+ R++   EMN LLR
Sbjct: 543 LLQKADAQALARDVLRDLQAYGGSRVLAERQNELLATLACHSAVRANRRLNLDEMNALLR 602

Query: 563 EMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +ME    + QCNHGRPT+I+L ++D+++LF R
Sbjct: 603 QMEATERADQCNHGRPTWIQLTVADLDRLFLR 634


>gi|114799039|ref|YP_759640.1| DNA mismatch repair protein [Hyphomonas neptunium ATCC 15444]
 gi|114739213|gb|ABI77338.1| putative DNA mismatch repair protein MutL [Hyphomonas neptunium
           ATCC 15444]
          Length = 634

 Score =  546 bits (1406), Expect = e-153,   Method: Composition-based stats.
 Identities = 228/624 (36%), Positives = 359/624 (57%), Gaps = 32/624 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            IRKL   ++N+IAAGE++ERP+ A+KEL+EN+LDA +  +   I  GG     I D+G 
Sbjct: 10  TIRKLPADVVNRIAAGEVVERPAAAVKELVENALDAGARSIAIAIEEGGLKRITIEDDGC 69

Query: 62  GMTSEEIPMAVQRHCTSKI------SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQN 115
           G++++++ +A++RH TSK+        D  NI+T GFRGEALPSI +VS + ++SR    
Sbjct: 70  GLSADDLLIALERHATSKLVPDTEGRVDLLNIYTMGFRGEALPSIASVSRMRIVSRASGE 129

Query: 116 NTGAQIAISGEKISSVRPV----AMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDV 171
           +  A+I     ++   RP         GT ++V DLF   PARL F++ E+ E   +TD 
Sbjct: 130 D-AAEIFSDAGRLDGPRPAAFTGRSETGTRIDVNDLFHATPARLKFMRGERAEAMAVTDA 188

Query: 172 IRRMAIAYPKVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNE 230
           ++R+A+A P+V+F+  +   + ++   +   +    +R+  ++G DF +NAV ++     
Sbjct: 189 VKRLAMANPEVAFSLESNGRSLFRYPAEGPGDAGRLKRLGAIMGRDFSDNAVAVDATREG 248

Query: 231 ITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEI 290
           + L G+ G+PT NRGNA   ++F+NGR V+D+ +   +R AY + +   R+P+  L +++
Sbjct: 249 VRLSGFAGLPTLNRGNAQMQFLFVNGRPVKDRMLTGVVRAAYQDFLARDRHPMAALFVDL 308

Query: 291 DPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA 350
           DP  VDVNVHPAK+ +RFR+   +R  +I +++ A+   G   S+ ++   +     + A
Sbjct: 309 DPEGVDVNVHPAKTEVRFRDAGGVRGLMISALRHALAAAGHRASTTVAGFALGKARAEPA 368

Query: 351 PKT----HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEAT---- 402
           P+       P+    +            R    D   +         D V +  A     
Sbjct: 369 PQAGFLWQAPQPGGYVQRPAMPPQGYAARQVEEDGASAPFAPRGYVPDYVPDQGAPGAKV 428

Query: 403 ------------HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST 450
                        Y LG A AQ+H+ YII+QT DG+VIVDQHAAHERL++E M++     
Sbjct: 429 ETGPMPAPGMLGEYPLGAARAQVHETYIIAQTADGIVIVDQHAAHERLVYEAMKRQMAEG 488

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
            +  Q LL P+I++L E E   +    E+L  LG++ E FGP AIA+R  PA+  + +  
Sbjct: 489 GVRRQALLIPDIVELSEDEAHRVCARAEELAALGLEIEPFGPGAIAVRATPALFGEMDAA 548

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
            L+RD+ D+  +     TL +R E ++  MAC  SIR+GR++ + EMN LLR+ME  P+S
Sbjct: 549 GLIRDLADDFAEYEAGLTLSERFEEVMGNMACRSSIRAGRRLNADEMNALLRQMEATPHS 608

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
            QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 609 GQCNHGRPTYVELKLADIERLFGR 632


>gi|255263413|ref|ZP_05342755.1| mismatch repair protein MutL [Thalassiobium sp. R2A62]
 gi|255105748|gb|EET48422.1| mismatch repair protein MutL [Thalassiobium sp. R2A62]
          Length = 605

 Score =  545 bits (1405), Expect = e-153,   Method: Composition-based stats.
 Identities = 245/601 (40%), Positives = 376/601 (62%), Gaps = 20/601 (3%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++D+ + R++   A GGKS  ++ D+G G
Sbjct: 15  IRQLDDAAINRIAAGEVVERPASAVKELVENAVDSGARRIDVSYADGGKSLIRVVDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           + + ++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  L++ SR   +     I
Sbjct: 75  IEAADLPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLSITSRATGD--AHVI 132

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            + G  +  VRP A++ GT VE+RDLF+  PARL F++S++ E   I DV++R+A+A P 
Sbjct: 133 KVEGGTMQPVRPAALSAGTTVELRDLFYATPARLKFMRSDRAEAQAIGDVVKRIAMAEPF 192

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           V+ T    +     R      +  G+  +    R+++V+G +F  N++ ++ +     L 
Sbjct: 193 VAITLRDVTGGGEGRVVFRADAEQGDLFDALHGRLARVLGREFAENSILVDTEREGFHLT 252

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG++   Y+F+NGR V+DK +   +R AY++ +   R+P   L ++ DP  
Sbjct: 253 GYAALPTYSRGSSVAQYLFVNGRPVRDKMLYGALRGAYSDFLSRDRHPAAALFIDCDPTL 312

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA-PKT 353
           VDVNVHPAKS +RFR P I+R  I+  ++ A+   G   S+ ++   + +F  +    + 
Sbjct: 313 VDVNVHPAKSEVRFREPGIVRGLIVSGLRHALADAGHRASTTVAGATLGAFTPEPTGARV 372

Query: 354 HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQI 413
           +     T+      ++  Q         +  +        D   +     + LG A  Q+
Sbjct: 373 YQMDRPTAGFAIAAQMAPQ---------VFEEAAAVFARVDETPQVVEQDHPLGAARGQV 423

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
           H+NYII+QT DG+VIVDQHAAHERL++E+++       + +Q LL PEI++L E +C  +
Sbjct: 424 HENYIIAQTKDGMVIVDQHAAHERLVYERLKNQMAENGVAAQALLIPEIVELSESDCTRL 483

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRI 533
           ME   DL +LG+  E FG  A+A+RE PAIL + N   +LRD++DE+ D   +  +Q +I
Sbjct: 484 MEVAGDLAKLGLTIEPFGGGAVAVRETPAILGEVNAEAMLRDVLDELDDVGDSQLVQAKI 543

Query: 534 ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFG 593
           E IL+ +AC+GSIRSGR M++ EMN LLREME  P+S QCNHGRPT+++LKL+DIE+LFG
Sbjct: 544 EAILSRVACHGSIRSGRWMRAEEMNALLREMEATPHSGQCNHGRPTYVELKLADIERLFG 603

Query: 594 R 594
           R
Sbjct: 604 R 604


>gi|163739395|ref|ZP_02146806.1| DNA mismatch repair protein MutL [Phaeobacter gallaeciensis BS107]
 gi|161387465|gb|EDQ11823.1| DNA mismatch repair protein MutL [Phaeobacter gallaeciensis BS107]
          Length = 650

 Score =  545 bits (1405), Expect = e-153,   Method: Composition-based stats.
 Identities = 256/635 (40%), Positives = 378/635 (59%), Gaps = 44/635 (6%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA ++R+   IA GGK+  ++TD+G G
Sbjct: 16  IRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGATRITIEIADGGKTLIRVTDDGCG 75

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M+  ++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  L++ SR       AQI
Sbjct: 76  MSPADLPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLSITSRAKDQE-AAQI 134

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            ++G +   V+P A+  GT+VE+RDLF+  PARL F++S++ ET  I DVI+R+A+A P 
Sbjct: 135 RVAGGRTEPVKPAALRVGTVVELRDLFYATPARLKFMRSDRAETQAIGDVIKRLAMAEPS 194

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT    S     R         G+  +    R++ V+G +F  NA++++   + + L 
Sbjct: 195 VGFTLRDVSGGGEGRVTFRADPLTGDLFDALHGRLATVLGREFAENALKIDATRDGVRLF 254

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   ++F+N R V+DK +   +R AY + +   R+P   L L+ DP  
Sbjct: 255 GYAALPTYSRGAAVAQFLFVNTRPVKDKMLTGALRAAYFDFLSRDRHPAAALFLDCDPTL 314

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR+P + R  I+ +++  + + G   SS ++   + +   +      
Sbjct: 315 VDVNVHPAKSEVRFRDPGVARGLIVSALRHGLAEAGHRASSTVAGATLGAMRPEPMASQP 374

Query: 355 LPKYATSL----------------TNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE 398
               A  +                     +  +  + +           +YS       E
Sbjct: 375 GADGAPRIYQMDRPSLGARSLSYAAQAPGQSGIAGSDMPPPSGFAELAQSYSGRVTETPE 434

Query: 399 SEATHYQLGIAC-------------------AQIHQNYIISQTTDGLVIVDQHAAHERLI 439
           S+      G                       Q+H+NYII+QT DG+VIVDQHAAHERL+
Sbjct: 435 SQNPAMAPGQPFERSETSAPGAEQLPLGAARGQVHENYIIAQTADGMVIVDQHAAHERLV 494

Query: 440 FEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIRE 499
           +EK+++    T + +Q LL PEI++L EG+CA I+   +DL+R G+  E FG  AIA+RE
Sbjct: 495 YEKLKRQMAETGVAAQALLIPEIVELSEGDCARILAVADDLNRFGLGIEAFGGGAIAVRE 554

Query: 500 IPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNR 559
            PAIL   N   ++RDI+DE+ D   +  +Q +IE IL+ +AC+GSIRSGR M+  EMN 
Sbjct: 555 TPAILGTVNAEAMVRDILDELDDQGESQLVQAKIEAILSRVACHGSIRSGRWMRGEEMNA 614

Query: 560 LLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LLREME  P+S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 615 LLREMEATPHSGQCNHGRPTYVELKLADIERLFGR 649


>gi|306840954|ref|ZP_07473695.1| DNA mismatch repair protein MutL [Brucella sp. BO2]
 gi|306289011|gb|EFM60276.1| DNA mismatch repair protein MutL [Brucella sp. BO2]
          Length = 618

 Score =  545 bits (1405), Expect = e-153,   Method: Composition-based stats.
 Identities = 268/616 (43%), Positives = 390/616 (63%), Gaps = 28/616 (4%)

Query: 7   SEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTSE 66
           SE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG G+ ++
Sbjct: 2   SETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNGSGIPAD 61

Query: 67  EIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAISGE 126
           E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL SRP   ++G ++ ++G 
Sbjct: 62  ELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSRPQDADSGFEVCVTGG 121

Query: 127 KISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVSFTF 186
            +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P + F+ 
Sbjct: 122 HLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFPHIRFSL 181

Query: 187 STIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNRG 245
           +      ++M    +      ERI QV+G +F  NA+ ++ + + + L G+ GIP+FNRG
Sbjct: 182 AGTDRTPFEMPATGTGAEATLERIGQVLGREFGENALAIDAERDGVRLAGFVGIPSFNRG 241

Query: 246 NANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSY 305
           NA   + ++NGR V+DK I   +R AY++ I   R+PV VL L +DP  VDVNVHPAK+ 
Sbjct: 242 NALHQFAYVNGRPVRDKQIFGALRGAYSDVIARDRHPVAVLFLTLDPALVDVNVHPAKAD 301

Query: 306 IRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD-NAPKTHLPKYATSLTN 364
           +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F  +    +   P+ A S + 
Sbjct: 302 VRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRPANSYSP 361

Query: 365 TQEKLFLQENRLSTNDLLPSDDP--------------------------TYSEDNDPVEE 398
              +      R   +                                    +  +     
Sbjct: 362 ASWRTAPPAPRSEWSPQTAHPAHRPLDLQAAPAFREDGQAILGDVAAPAADARASVAEAP 421

Query: 399 SEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLL 458
            E     LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++  I  Q LL
Sbjct: 422 VELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHARPIAGQMLL 481

Query: 459 TPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIID 518
            PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+ QL+RD+ D
Sbjct: 482 IPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLGEMNVQQLIRDLAD 541

Query: 519 EIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRP 578
           EI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P S  CNHGRP
Sbjct: 542 EIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPGSGTCNHGRP 601

Query: 579 TFIKLKLSDIEKLFGR 594
           T+I+LKL+DIE+LFGR
Sbjct: 602 TYIELKLTDIERLFGR 617


>gi|326553690|gb|ADZ88329.1| DNA mismatch repair protein [Brucella melitensis M5-90]
          Length = 618

 Score =  545 bits (1405), Expect = e-153,   Method: Composition-based stats.
 Identities = 268/616 (43%), Positives = 391/616 (63%), Gaps = 28/616 (4%)

Query: 7   SEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTSE 66
           SE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG G+ ++
Sbjct: 2   SETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNGSGIPAD 61

Query: 67  EIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAISGE 126
           E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL SRP   ++G ++ ++G 
Sbjct: 62  ELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSRPQDADSGFEVCVTGG 121

Query: 127 KISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVSFTF 186
            +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P + F+ 
Sbjct: 122 HLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFPHIRFSL 181

Query: 187 STIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNRG 245
           +      ++M    +      ERI QV+G +F  NA+ ++ + + + L G+ GIP+FNRG
Sbjct: 182 AGTDRTPFEMPATGTGAEATLERIGQVLGREFGENALAIDAERDGVRLAGFVGIPSFNRG 241

Query: 246 NANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSY 305
           NA   + ++NGR V+DK I   +R AY++ I   R+PV VL L +DP  VDVNVHPAK+ 
Sbjct: 242 NALHQFAYVNGRPVRDKQIFGALRGAYSDVIARDRHPVAVLFLTLDPALVDVNVHPAKAD 301

Query: 306 IRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD-NAPKTHLPKYATSLTN 364
           +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F  +    +   P+ A S + 
Sbjct: 302 VRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRPANSYSP 361

Query: 365 TQEKLFLQENRLSTNDLLPSDDP--------------------------TYSEDNDPVEE 398
              +      R   +                                  + +  +     
Sbjct: 362 ASWRTAPPAPRSEWSPQTAQTAHRPLDLQAAPALRENGQAVLGDVAVPASDARASVAEAP 421

Query: 399 SEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLL 458
            E     LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++  I  Q LL
Sbjct: 422 VELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHARPIAGQMLL 481

Query: 459 TPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIID 518
            PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+ QL+RD+ D
Sbjct: 482 IPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLGEMNVQQLIRDLAD 541

Query: 519 EIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRP 578
           EI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P S  CNHGRP
Sbjct: 542 EIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPGSGTCNHGRP 601

Query: 579 TFIKLKLSDIEKLFGR 594
           T+I+LKL+DIE+LFGR
Sbjct: 602 TYIELKLTDIERLFGR 617


>gi|325983238|ref|YP_004295640.1| DNA mismatch repair protein MutL [Nitrosomonas sp. AL212]
 gi|325532757|gb|ADZ27478.1| DNA mismatch repair protein MutL [Nitrosomonas sp. AL212]
          Length = 597

 Score =  545 bits (1405), Expect = e-153,   Method: Composition-based stats.
 Identities = 221/597 (37%), Positives = 330/597 (55%), Gaps = 8/597 (1%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            I+ L E +INQIAAGE++ERP+ A+KE++ENS+DA + ++   +  GG    ++ D+G 
Sbjct: 3   TIKPLPELLINQIAAGEVVERPAAALKEILENSVDAGAKKINVQLQQGGVKQIRVADDGI 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+T +E+ +A+ RH TSKIS  +D   I + GFRGEAL SI A+S LTL SR    +   
Sbjct: 63  GITKDELQLALTRHSTSKISTLEDLHQITSLGFRGEALASIAAISRLTLASREAAQSHAW 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G+ +S   P ++  GT ++V DL+F IPAR  FLKSE  E     +  +R+A++ 
Sbjct: 123 QILVEGKSVSQPMPASLAQGTTLDVNDLYFNIPARRKFLKSEATEFAHCDETFKRIALSQ 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
             + F        R  +      G+  +RI+ V+G++F   A  ++E+S E+ L G   +
Sbjct: 183 SGIEFVLQHNGKVRRHLRA----GDPAQRIASVLGDEFKQTAAWIDEQSAEMHLHGMVAL 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P + R + +  Y F+N R V DK I   +R AY + + L R+P  VL L+I P  VDVNV
Sbjct: 239 PAYARSSRDTQYFFVNHRFVNDKLISHALREAYRDVLHLERHPAFVLFLDIHPGSVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HP K+ +RFR P  +  FI  +I KA++     +SS     +   +              
Sbjct: 299 HPTKTEVRFREPRALHQFIFHAINKALSSGQKESSSGEPVSIARPYPIYPKTGPAQGGTV 358

Query: 360 TSLTNTQEKLFLQENR--LSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNY 417
           +   +    LF  E R   +    +    P    D      +   ++ LG A  Q+H  Y
Sbjct: 359 SQPASFYGTLFGTEARSIPTIPVNIAPAAPAIKPDKSIAIGNNQDNHPLGFALGQLHGIY 418

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHD 477
           I++Q   GL++VD HAAHER+++EK++Q  +  +I  Q LL P        E A I E+ 
Sbjct: 419 ILAQNARGLIVVDMHAAHERILYEKLKQALDQHEIPMQPLLIPVTFYAEHLEIAAIEENQ 478

Query: 478 EDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENIL 537
             L +LG +     P  +A+R +PA L   +I QL RDI+ EI +   +  L  +   IL
Sbjct: 479 TILDQLGFEIAVLSPTTVAVRAVPATLQHADIAQLARDILREIREYGASQILTAKRNEIL 538

Query: 538 ATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ATMAC+G+IR+ RK+   EMN LLREME    + QCNHGRPT+ +  L+D++KLF R
Sbjct: 539 ATMACHGAIRANRKLTLEEMNALLREMEMTERADQCNHGRPTWFETSLADLDKLFMR 595


>gi|254473678|ref|ZP_05087074.1| DNA mismatch repair protein [Pseudovibrio sp. JE062]
 gi|211957390|gb|EEA92594.1| DNA mismatch repair protein [Pseudovibrio sp. JE062]
          Length = 679

 Score =  545 bits (1405), Expect = e-153,   Method: Composition-based stats.
 Identities = 258/652 (39%), Positives = 394/652 (60%), Gaps = 58/652 (8%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+LS+  IN+IAAGE+IERP+  +KEL+EN++DA ++R+E V A GGKS  +ITDNG
Sbjct: 27  MAVRQLSDTTINRIAAGEVIERPASVVKELVENAVDAGATRIEIVTATGGKSLLRITDNG 86

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT E++ +AV+RHCTSK+ + D  +I T GFRGEALPSIGA+S L + +R        
Sbjct: 87  AGMTKEDLQLAVRRHCTSKLPENDLMDIRTMGFRGEALPSIGAISRLEITTRHASEPHAW 146

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +I + G + S V P A+N GT VEV+D+FF++PARL FLKS++ E   IT++I+R+A+A 
Sbjct: 147 KIEVEGGQNSEVEPAALNAGTRVEVKDIFFSVPARLKFLKSDRAEATAITEIIKRIALAN 206

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P + FT S     + ++   + +     RI Q++G +F  NA+E+      + L GY G+
Sbjct: 207 PTIRFTLSGSDRRQLELPACTGDDADLARIGQILGAEFTKNAMEIEALREGVHLYGYAGL 266

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF+R N+   + F+NGR V+DK +L +++ AY++ +   R+P+VVL +++DP QVDVNV
Sbjct: 267 PTFHRANSQHQFFFVNGRPVRDKLLLGSLKAAYSDVLSRDRHPIVVLNIDLDPHQVDVNV 326

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ------------ 347
           HPAK+ +RFR+  ++R  +I +++ A  + G   S+  ++  I++               
Sbjct: 327 HPAKADVRFRDGQLVRGLLIGALKNAFVQSGFRASTANTQSAINAIRPMGQGAGFNVHSG 386

Query: 348 -DNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE-------- 398
                +    + A S +  Q     +E+  S        +    E    + E        
Sbjct: 387 ASAHTQQGHREAAQSYSWRQSAYRPEESSASVWSAADIPEAGTQETQLGLMEATAPYTAS 446

Query: 399 ------------------------------------SEATHYQLGIACAQIHQNYIISQT 422
                                                +  ++ LG A AQIH+ YI+SQT
Sbjct: 447 PEPSMGQDSAAEQGHQAYNLVDAPSADSRAHVHELPEDRENFPLGAARAQIHETYIVSQT 506

Query: 423 TDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHR 482
            DGLVIVDQHAAHERL++E++++D     +  Q LL PEI+DL E + A + E   +L  
Sbjct: 507 KDGLVIVDQHAAHERLVYEQLKEDLAKRDVPRQMLLIPEIVDLPEDDVARLEERASELEE 566

Query: 483 LGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMAC 542
           +G+  ERFGP AIA+RE P++L + NI  L++D+ D+  +  ++  ++++++ + ATMAC
Sbjct: 567 VGLVLERFGPGAIAVRETPSMLKRLNIKALVQDLADDFAEYDSSTRIREKLDLVAATMAC 626

Query: 543 YGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +GSIR+GR+M+  EM+ LLR+ME  P S QCNHGRPT+I+LKL DIE+LFGR
Sbjct: 627 HGSIRAGRRMRPEEMDNLLRDMEATPKSGQCNHGRPTWIELKLHDIERLFGR 678


>gi|163743610|ref|ZP_02150986.1| DNA mismatch repair protein [Phaeobacter gallaeciensis 2.10]
 gi|161383081|gb|EDQ07474.1| DNA mismatch repair protein [Phaeobacter gallaeciensis 2.10]
          Length = 650

 Score =  545 bits (1405), Expect = e-153,   Method: Composition-based stats.
 Identities = 257/635 (40%), Positives = 379/635 (59%), Gaps = 44/635 (6%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA ++R+   IA GGK+  ++TD+G G
Sbjct: 16  IRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGATRITIEIADGGKTLIRVTDDGCG 75

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M+  ++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  L++ SR       AQI
Sbjct: 76  MSPADLPLALSRHATSKIDGSDLLNIHTFGFRGEALPSLGAVGRLSITSRAKDQE-AAQI 134

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            ++G +   V+P A+  GT+VE+RDLF+  PARL F++S++ ET  I DVI+R+A+A P 
Sbjct: 135 RVAGGRTEPVKPAALRVGTVVELRDLFYATPARLKFMRSDRAETQAIGDVIKRLAMAEPS 194

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT    S     R         G+  +    R++ V+G +F  NA++++   + + L 
Sbjct: 195 VGFTLRDVSGGGEGRVTFRADPLTGDLFDALHGRLATVLGREFAENALKIDATRDGVRLF 254

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   ++F+N R V+DK +   +R AY + +   R+P   L L+ DP  
Sbjct: 255 GYAALPTYSRGAAVAQFLFVNTRPVKDKMLTGALRAAYFDFLSRDRHPAAALFLDCDPTL 314

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDN----- 349
           VDVNVHPAKS +RFR+P + R  I+ +++  + + G   SS ++   + +   +      
Sbjct: 315 VDVNVHPAKSEVRFRDPGVARGLIVSALRHGLAEAGHRASSTVAGATLGAMRPEPMASQP 374

Query: 350 ----APKTHLPKYATSLTNTQEKLFLQENR-------LSTNDLLPSDDPTYSEDNDPVEE 398
               AP+ +     +    +         +       +            YS       E
Sbjct: 375 GADGAPRIYQMDRPSLGARSLSYAAQAPGQSCIAGGDMPPPSGFAELAQVYSGRVTEAPE 434

Query: 399 SEATHYQLGIAC-------------------AQIHQNYIISQTTDGLVIVDQHAAHERLI 439
           S+      G                       Q+H+NYII+QT DG+VIVDQHAAHERL+
Sbjct: 435 SQNPAMAPGQPLERSETSAPGAEQLPLGAARGQVHENYIIAQTADGMVIVDQHAAHERLV 494

Query: 440 FEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIRE 499
           +EK+++    T + +Q LL PEI++L EG+CA I+   +DL+R G+  E FG  AIA+RE
Sbjct: 495 YEKLKRQMAETGVAAQALLIPEIVELSEGDCARILAVADDLNRFGLGIEAFGGGAIAVRE 554

Query: 500 IPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNR 559
            PAIL   N   ++RDI+DE+ D   +  +Q +IE IL+ +AC+GSIRSGR M+  EMN 
Sbjct: 555 TPAILGTVNAEAMVRDILDELDDQGESQLVQAKIEAILSRVACHGSIRSGRWMRGEEMNA 614

Query: 560 LLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LLREME  P+S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 615 LLREMEATPHSGQCNHGRPTYVELKLADIERLFGR 649


>gi|83941709|ref|ZP_00954171.1| DNA mismatch repair protein [Sulfitobacter sp. EE-36]
 gi|83847529|gb|EAP85404.1| DNA mismatch repair protein [Sulfitobacter sp. EE-36]
          Length = 632

 Score =  545 bits (1404), Expect = e-153,   Method: Composition-based stats.
 Identities = 258/618 (41%), Positives = 380/618 (61%), Gaps = 27/618 (4%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA + ++    A GGK+  ++TD+G G
Sbjct: 15  IRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGARQITVEYADGGKTLIRVTDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           + ++++ +A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR    + GA+I
Sbjct: 75  IAADDLTLALSRHATSKIDGTDLLNIHTFGFRGEALPSLGAVGRLTICSRVAGQD-GAEI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           +++G     VRP A+N GT+V +RDLFF  PARL FL++++ E   I+D+I+R+A+A P 
Sbjct: 134 SVNGGVTGPVRPAALNGGTVVTLRDLFFATPARLKFLRTDRAEAQAISDIIKRLAMAEPF 193

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGN----FPERISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT    S     R     ++  G+       R++QV+G +F  NA+ ++ +   + L 
Sbjct: 194 VRFTLRDVSGDGPGREVFRAEAEQGDMFAALHGRLAQVLGREFAENALAIDAEREGLHLT 253

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG+A   Y+F+NGR V+DK ++  +R AY + +   R+P   L ++ DP+ 
Sbjct: 254 GYAALPTYSRGSAVTQYLFVNGRPVRDKLLVGALRGAYFDLLSRDRHPAAALFVDCDPKL 313

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR+P + R  I+ +++ A+   G   S+ ++   + +   +      
Sbjct: 314 VDVNVHPAKSEVRFRDPGLARGLIVSALRHALADAGHRASTTVANATLGAMRPEQPGARV 373

Query: 355 LPKYATSLTNTQEKLFLQENRLSTNDLLPSD------------------DPTYSEDNDPV 396
                 SL         Q       +                         T + D    
Sbjct: 374 YQMDRPSLGARSAAYQAQAPEPGFAETAGMWGRVETPPQYEAGGADVQTHDTRTHDAHTP 433

Query: 397 EESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQT 456
               A  + LG A  Q+H+NYII+QT  G+VIVDQHAAHERL++EK+++      + +Q 
Sbjct: 434 AAEPAPDFPLGTARGQVHENYIIAQTATGMVIVDQHAAHERLVYEKLKRQMAENGVAAQA 493

Query: 457 LLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDI 516
           LL PEI+DL   +CA ++E  EDL R G+  E FG +AIA+RE PAIL   +   ++ DI
Sbjct: 494 LLIPEIVDLSASDCARLLEVAEDLARFGLGIEAFGGSAIAVRETPAILGTVDAKAMVLDI 553

Query: 517 IDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHG 576
           +DE+ D + + TLQ RIE IL+ +AC+GSIRSGR M+  EMN LLREME  P+S QCNHG
Sbjct: 554 LDELADQNESNTLQARIEAILSRVACHGSIRSGRWMRGEEMNALLREMEATPHSGQCNHG 613

Query: 577 RPTFIKLKLSDIEKLFGR 594
           RPT+++LKLSDIE+LFGR
Sbjct: 614 RPTYVELKLSDIERLFGR 631


>gi|300690568|ref|YP_003751563.1| methyl-directed mismatch repair protein [Ralstonia solanacearum
           PSI07]
 gi|299077628|emb|CBJ50264.1| methyl-directed mismatch repair protein [Ralstonia solanacearum
           PSI07]
          Length = 637

 Score =  545 bits (1404), Expect = e-153,   Method: Composition-based stats.
 Identities = 199/633 (31%), Positives = 326/633 (51%), Gaps = 47/633 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            IR L +++I+QIAAGE++ERP+  +KEL+EN+LDA +++++  +  GG     ITDNG 
Sbjct: 10  PIRPLPDQLISQIAAGEVVERPASVVKELLENALDAGATQLQIKLEEGGVRRIAITDNGG 69

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++E+P+A+ RH TSKI   ++   + T GFRGEAL SI +V+ LTL SR  ++    
Sbjct: 70  GIPADELPVALMRHATSKIGSLEELEAVATLGFRGEALASIASVAELTLTSRTARDAHAT 129

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI     +    +P +   GT V+V+ L+F  PAR  FLK+EQ E     +VIRR A+A 
Sbjct: 130 QI---IAQTGRTQPASGGIGTTVDVQHLYFNTPARRKFLKTEQTELGHCLEVIRRTALAR 186

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V+ +           N    +       + V+G +F    +   E + E+ L G+ G+
Sbjct: 187 PDVAISVHHNGKPLEHWNAAQADART----AAVLGTEFARARLPFEEAAGELRLFGFAGL 242

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT +RG A+  + ++NGR V+D+ +   +R+AY + +   R+P  VL LE+ P  VDVNV
Sbjct: 243 PTASRGRADHQFFYVNGRFVRDRLLTHAVRSAYEDVLHGDRFPAYVLCLELPPEAVDVNV 302

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLP--- 356
           HP+K  +RFR+   +  F+  ++Q+A+ +        L   +  +  Q     T  P   
Sbjct: 303 HPSKIEVRFRDSRAVHQFVYHAVQRALARHAGEQGDSLRTDIADAPDQPGTAATPSPADN 362

Query: 357 --KYATSLTNTQEKLFLQENRLST---------------------------------NDL 381
             ++   +   Q  L + + R                                       
Sbjct: 363 TTRWINQMAARQTSLGIAQPRAEYLAMMRGGNAPLPSSRPAWMADVPSAATLFDGTAAPA 422

Query: 382 LPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFE 441
             +          P  +     + LG A AQ+H  Y+++Q   G+V+VD HAAHER+++E
Sbjct: 423 ADAPVQASIPAAAPPADGSDDEHPLGFAVAQLHGIYVLAQNARGMVLVDMHAAHERILYE 482

Query: 442 KMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIP 501
           +++    + ++  Q LL P        E     E  + L  LG       P  +A+R +P
Sbjct: 483 QLKTALEARRVEVQPLLIPVTFAASPVEIGTAEEFRDTLTLLGFDISAVSPTTLAVRAVP 542

Query: 502 AILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLL 561
            +L K +   L RD++ ++     +  L +R   +LAT+AC+ ++R+ R++   EMN LL
Sbjct: 543 TLLQKADAHALARDVLRDLQAYGGSRVLAERQNELLATLACHSAVRANRRLNLDEMNALL 602

Query: 562 REMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           R+ME    + QCNHGRPT+I+L ++D+++LF R
Sbjct: 603 RQMEATERADQCNHGRPTWIQLTVADLDRLFLR 635


>gi|152996647|ref|YP_001341482.1| DNA mismatch repair protein [Marinomonas sp. MWYL1]
 gi|150837571|gb|ABR71547.1| DNA mismatch repair protein MutL [Marinomonas sp. MWYL1]
          Length = 641

 Score =  545 bits (1404), Expect = e-153,   Method: Composition-based stats.
 Identities = 215/637 (33%), Positives = 354/637 (55%), Gaps = 44/637 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  +KEL+ENSLDA +S+++  +  GG    +I DNG 
Sbjct: 3   RINLLSPRLANQIAAGEVVERPASVVKELLENSLDAGASQLDIDVEQGGVRRIKIRDNGT 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++ +A+ RH TSKI   DD   + T GFRGEAL SI +VS + L S+        
Sbjct: 63  GIMKDDLSLALSRHATSKIITLDDLEAVRTLGFRGEALASISSVSRMHLTSQAESEVEAW 122

Query: 120 QIAISGEKI-SSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           ++   G+ + +++RP +   GT +EVRDLFF  PAR  FL++E+ E   + +V++R+A++
Sbjct: 123 RVEAEGKDMATAIRPASHPQGTTIEVRDLFFNTPARRKFLRTEKTEFAHLEEVVKRLALS 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
             +  F  S      Y +   +   +   R++ ++G+ FI N++ L+ ++  + L G+ G
Sbjct: 183 RYETGFRLSHNGKQVYDLRPVTDQLHAEHRLATLLGKKFIENSLTLDVEAAGLRLWGWIG 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL LE+DP  VDVN
Sbjct: 243 LPTFSRSQADLQYFFVNGRVVKDKLVAHAVRQAYRDVLYNGRHPTFVLYLELDPSTVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RFR+  ++ +F+   I KAI      + S  +    +S ++  +  +++ + 
Sbjct: 303 VHPTKHEVRFRDGRLVHDFLFSRIHKAIADVRPESESAPTGMNDTSSNEPVSYGSNITEQ 362

Query: 359 AT-SLTNTQEKLFLQENRLSTNDLLPSD--------DPTYSEDNDPVEESEATHYQLGIA 409
           +   L+N      +   R ++N L  S+                + V ++E    + G  
Sbjct: 363 SALPLSNRSGSTSMDWMRSTSNSLGSSEVRGQLDGMGRMAGYAQEYVSKTEEIDPETGEI 422

Query: 410 --------------------------------CAQIHQNYIISQTTDGLVIVDQHAAHER 437
                                            AQ+H  YI+S++  GL++VD HAAHER
Sbjct: 423 REIAPASTLGQSENPLVGREDDYQAVPPLGFAVAQLHGVYILSESEQGLILVDMHAAHER 482

Query: 438 LIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAI 497
           +++E+M+  F    I+SQ LL P  I + + E  L+ E  E     G + ER G  +  +
Sbjct: 483 IVYERMKAAFYQKNISSQPLLVPINIAVSQSEADLVEESGEVFEAFGFRVERTGLESAMV 542

Query: 498 REIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEM 557
           RE+P IL + ++  L+RD+I ++  +  +  ++ R   ++A+MAC+G++R+ RK+   EM
Sbjct: 543 REVPVILIRGDVEGLVRDVISDLSTNGVSDLMESRANELMASMACHGAVRANRKLTIAEM 602

Query: 558 NRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           N LLR+ME    S QCNHGRPT+  L +SD++KLF R
Sbjct: 603 NSLLRDMEMTERSGQCNHGRPTWAHLSMSDLDKLFLR 639


>gi|167648022|ref|YP_001685685.1| DNA mismatch repair protein [Caulobacter sp. K31]
 gi|189030394|sp|B0SWX9|MUTL_CAUSK RecName: Full=DNA mismatch repair protein mutL
 gi|167350452|gb|ABZ73187.1| DNA mismatch repair protein MutL [Caulobacter sp. K31]
          Length = 643

 Score =  545 bits (1403), Expect = e-152,   Method: Composition-based stats.
 Identities = 238/642 (37%), Positives = 376/642 (58%), Gaps = 48/642 (7%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L  + +N+IAAGE++ERP+ AIKEL++N++DA ++R+E    GGG +   + D+G
Sbjct: 1   MPIRRLPPETVNRIAAGEVVERPASAIKELVDNAIDAGATRIEVEAHGGGLTRILVADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD------DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQ 114
            G+++EE+P+A++RH TSK++       D   IHT GFRGEALPSIG+V+ L++ SR   
Sbjct: 61  CGLSAEELPVALERHATSKLAPDAQGLWDLLAIHTMGFRGEALPSIGSVARLSISSRAKG 120

Query: 115 NNTGAQIAISGEKISSVRPV--AMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVI 172
           ++    I + G  +  V P   A + G  +EVRDLF+  PARL F+KSE+ E   IT+ I
Sbjct: 121 SSDAWSILVEGGSVGDVAPAAFAGDHGARIEVRDLFYATPARLKFMKSERAEALAITEEI 180

Query: 173 RRMAIAYPKVSFTFSTIKSNRYKMNF-QSTNGNFPERISQVIGEDFINNAVELNEKSNEI 231
           +R A+A   V F+         ++            R+S V+G DF +NA+E+++  + +
Sbjct: 181 KRQAMANESVGFSLDIDGRRIIRLPPEHPGPQGRLARLSAVLGRDFQDNAIEIDQTRDGV 240

Query: 232 TLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEID 291
            L G+ G+PT+NRGNA   Y+F+NGR V+D+ +   +R AYA+ +   R+P   L + +D
Sbjct: 241 RLTGFAGLPTYNRGNAAHQYLFVNGRPVRDRLLQGALRAAYADFLARDRHPTAALYISLD 300

Query: 292 PRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD--- 348
             +VDVNVHPAK+ +RFR+P ++R  I+ +++ A+   G   S+  +   + +       
Sbjct: 301 TSEVDVNVHPAKAEVRFRDPALVRGLIVGALRHALAGAGHRASTTTAASALDAIRAQSMV 360

Query: 349 -------NAPKTHLPKYATSLTNTQE-----------------------------KLFLQ 372
                    P  +    + +  +  +                                ++
Sbjct: 361 PPGAYSGYQPNAYQGGPSPAGFSAWQAGGWTRPSPQVLPGLSDVSARVEPGGYGVAEAVR 420

Query: 373 ENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQH 432
           E      D  P+         DP    +   + LG A AQ+H+ YI++QT DG+VIVDQH
Sbjct: 421 EAAFGEYDAPPNVAYPGGFSEDPAPVFDPVDFPLGAARAQVHETYIVAQTRDGVVIVDQH 480

Query: 433 AAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGP 492
           AAHERL++E+M+ +  + ++  Q LL PE+++L   E   ++   E+L  LG+  E FGP
Sbjct: 481 AAHERLVYERMKGEMAAGRVARQALLLPEVVELDPAEAERVVARAEELAALGLVIESFGP 540

Query: 493 NAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKM 552
            A+ +RE PA+L K +   L+RDI D++ ++     L++R+E + +TMAC+GS+R+GR++
Sbjct: 541 GAVLVRETPALLGKTDAAGLVRDIADDLAENGQALALKERLEEVCSTMACHGSVRAGRRL 600

Query: 553 QSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
              EMN LLREME  P+S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 601 TGAEMNALLREMEATPHSGQCNHGRPTYVELKLADIERLFGR 642


>gi|119502790|ref|ZP_01624875.1| DNA mismatch repair protein [marine gamma proteobacterium HTCC2080]
 gi|119461136|gb|EAW42226.1| DNA mismatch repair protein [marine gamma proteobacterium HTCC2080]
          Length = 614

 Score =  544 bits (1402), Expect = e-152,   Method: Composition-based stats.
 Identities = 217/610 (35%), Positives = 336/610 (55%), Gaps = 19/610 (3%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I +L+ ++ NQIAAGE++ERP+  IKE IENSLDA +SR++  +  GG    ++ DNG 
Sbjct: 5   RIHRLATRLANQIAAGEVVERPASVIKEAIENSLDAGASRIDIELESGGVQLMRVRDNGQ 64

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+++E++ +A+ RH TSKI   DD   + T GFRGEAL SI +VS L+L S   +     
Sbjct: 65  GISAEDLILALARHATSKIDSIDDLEAVGTLGFRGEALASIASVSRLSLTSNASEQGAAG 124

Query: 120 QIAISGEKISSVR--PVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
            IA S  +  +V   P     GT +EVRDLF+  PAR  FL++E+ E   I +V +R A+
Sbjct: 125 MIAQSEGRDMTVSVSPAPHPRGTTLEVRDLFYNTPARRKFLRTEKTELGHIDEVFKRQAL 184

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           A   V+F+        + +N          RI+ V G  F+  +V L  ++  ++L G+ 
Sbjct: 185 ARSDVAFSLRHNGKTLHSLNCADDQAGRERRIATVCGAAFMEQSVALAREAGRLSLHGWV 244

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G+PTF+R  A+  Y F+NGR ++DK +   I+ AY + +  GR+P  VL LE+DP  VDV
Sbjct: 245 GLPTFSRSQADLQYFFVNGRVIRDKLVTHAIKQAYRDVLFHGRHPAYVLFLEVDPAVVDV 304

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPK 357
           NVHP K  +RFR    + +FI  ++ +A+    +      +        Q+    +  P+
Sbjct: 305 NVHPTKHEVRFREGREVHSFIFSTLHRALG--DLRPGDGGAADASGEDAQEGVGWSTTPQ 362

Query: 358 YATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSED-------------NDPVEESEATHY 404
            A     T      Q    +    L +    Y                  P  + E+   
Sbjct: 363 QAPMGLLTPPGGHWQPEAQAGTADLDALSRLYKSPTFNRGGHGTPIMEQSPRGDDESEVP 422

Query: 405 QLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIID 464
            LG A AQ+H  +I+++  +GLV+VD HAAHER+ +E+++Q  + + I +Q LL P+ I 
Sbjct: 423 PLGFALAQLHGVFILAENAEGLVLVDMHAAHERITYERLKQMRDDSGIRTQPLLVPQTIT 482

Query: 465 LLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSS 524
           L   E A  +E  E L  LG+  +  G   + IRE+P  L    I  L+RD++ +++   
Sbjct: 483 LSSREVAAAVEMSEALIALGLVLDATGDEQLVIREVPIALIGGGIEALVRDVLSDMLAFG 542

Query: 525 TTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLK 584
           T+  +    + +L+TMAC+GS+R+ R++   EMN LLR+ME    S QCNHGRPT+++L 
Sbjct: 543 TSDRIAAHEDELLSTMACHGSVRANRRLTVPEMNALLRDMEMTERSGQCNHGRPTWVQLG 602

Query: 585 LSDIEKLFGR 594
           + D++KLF R
Sbjct: 603 MQDLDKLFLR 612


>gi|84684369|ref|ZP_01012270.1| DNA mismatch repair protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84667348|gb|EAQ13817.1| DNA mismatch repair protein [Rhodobacterales bacterium HTCC2654]
          Length = 610

 Score =  544 bits (1402), Expect = e-152,   Method: Composition-based stats.
 Identities = 264/601 (43%), Positives = 383/601 (63%), Gaps = 13/601 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA S+R++   A GGK+  ++TD+G G
Sbjct: 13  IRQLDDAAINRIAAGEVVERPASAVKELVENTIDAGSTRIDVAYADGGKTLIRVTDDGCG 72

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           + +E++P+A+ RH TSKI   D  +IHTFGFRGEALPS+GAV  LT+ SR       A I
Sbjct: 73  IPAEDLPLAMSRHATSKIDGSDLLDIHTFGFRGEALPSLGAVGRLTITSRCDGA--AASI 130

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            ++G K   VRP A++ GT+VE+RDLFF  PARL FL++++ E   ITDV++R+A+A P 
Sbjct: 131 RVAGGKAEPVRPAALSRGTVVELRDLFFATPARLKFLRTDRAEAQAITDVVKRLAMAEPH 190

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGNFPERISQ----VIGEDFINNAVELNEKSNEITLQ 234
           + FT    S     R        NG+  + +      V+G DF  NAV L+       L 
Sbjct: 191 IGFTLRDVSGGGEGRVTFRAAPENGDLFDALHARLGGVLGRDFAENAVPLDALREGFRLT 250

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   ++F+NGR V+DK ++  +R AYA+ +   R+P   L +  DP+ 
Sbjct: 251 GYAALPTYSRGAAVAQFLFVNGRPVRDKLLIGALRGAYADFLSRDRHPAAALFVTCDPKL 310

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDN-APKT 353
           VDVNVHPAKS +RFR P ++R  I+ +I+ A+ + G   SS +++  + +   +    + 
Sbjct: 311 VDVNVHPAKSEVRFREPGLVRGLIVTTIRHALAEAGHRASSTVAQSTLGAMRPEPTHARV 370

Query: 354 HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQI 413
           +     + +     +        +       D     E       +E+    LG A AQ+
Sbjct: 371 YQMDRPSQVVLHTAREAQSPMGFAETPSARFDPVIEPEPTPETPPAESL--PLGAARAQV 428

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
           H+NYI++QT DG+VIVDQHAAHERL++EK+++      + SQ LL PEI+DL EG+ +L+
Sbjct: 429 HENYIVAQTEDGMVIVDQHAAHERLVYEKLKRQMAENGVASQALLIPEIVDLSEGDASLL 488

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRI 533
           +   +DL RLG+  E FG  AIA+RE PAIL + N   ++RDI+DE+ D   + TLQ RI
Sbjct: 489 LGLADDLARLGLVIEPFGGGAIAVRETPAILGQVNAEAMIRDILDELADLGQSQTLQARI 548

Query: 534 ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFG 593
           E +L+ +AC+GSIRSGR M+  EMN LLREME  P+S QCNHGRPT+++LKL+DIE+LFG
Sbjct: 549 EAVLSRVACHGSIRSGRWMRPEEMNALLREMEATPHSGQCNHGRPTYVELKLADIERLFG 608

Query: 594 R 594
           R
Sbjct: 609 R 609


>gi|209886353|ref|YP_002290210.1| DNA mismatch repair protein [Oligotropha carboxidovorans OM5]
 gi|229486325|sp|B6JIV1|MUTL_OLICO RecName: Full=DNA mismatch repair protein mutL
 gi|209874549|gb|ACI94345.1| DNA mismatch repair protein [Oligotropha carboxidovorans OM5]
          Length = 612

 Score =  544 bits (1402), Expect = e-152,   Method: Composition-based stats.
 Identities = 231/611 (37%), Positives = 366/611 (59%), Gaps = 17/611 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R+L E+I+N+IAAGE++ERP+ A+KEL+EN++DA  +R++    GGG+    ITD+G
Sbjct: 1   MPVRQLPEQIVNRIAAGEVVERPASAVKELVENAIDAGGTRIDIFTEGGGRRRIVITDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT  ++ +AV+RH TSK+ D D   I T GFRGEALPSI +V+ L + +R        
Sbjct: 61  SGMTQGDLALAVERHATSKLDDEDLLRIRTLGFRGEALPSISSVAKLAITTRHAAEPHAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + +     S++ P A+  GT VEV DLF+  PARL FLK+++ E   I +V+RR+A+A 
Sbjct: 121 AVEVDAGAKSAIAPAALQRGTRVEVSDLFYATPARLKFLKTDRTEAEAIREVVRRLAMAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           P ++FT +  +                  R+  ++G DF  +A+E+  +   ++++G+  
Sbjct: 181 PDIAFTLAGEERAPVTWAAALPGAPGRLTRLGDILGSDFRTHAIEVGSEREGVSVEGFAA 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P+  R NA   Y+F+NGR V+DK IL  +R AYA+ +P  R+P+V L + +DP++VD N
Sbjct: 241 APSLTRANALGQYLFVNGRPVRDKLILGAVRAAYADYLPRDRHPIVALFVTLDPQEVDAN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISS-----------FHQ 347
           VHPAK+ +RFRN  ++R  I+ +++  + ++G  T++  +   I++           F +
Sbjct: 301 VHPAKTEVRFRNAGLVRALIVHALKDGLAREGRRTAANTNGAAITTAFRTEGFSREGFAR 360

Query: 348 DNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLG 407
           ++ P+      ++       +   Q   +  ++   +     +   D           LG
Sbjct: 361 ESLPRGGYDWRSSPAAPWPPQAAAQAPAMGFDESAQAAFDAGAPSADTRGNEAPLGDALG 420

Query: 408 IACA----QIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEII 463
                   QIH+NYI++QT DGL++VDQHAAHER+++E+++       +  Q LL PEI+
Sbjct: 421 RPLGAARTQIHENYIVAQTNDGLILVDQHAAHERIVYERLKASLTKNGVARQMLLIPEIV 480

Query: 464 DLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDS 523
           ++ E     ++    +L + G+  E FGP A+A+RE PA+L K N   LLRD+ + + + 
Sbjct: 481 EMDEASVEKLLARASELEKYGLSIESFGPGAVAVRETPALLGKANAASLLRDLAEHMAEW 540

Query: 524 STTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKL 583
                L+ R+ ++ ATMAC+GS+RSGR ++  EMN LLREME  PNS QCNHGRPT+++L
Sbjct: 541 DEALPLERRLMHVAATMACHGSVRSGRILKVEEMNALLREMEATPNSGQCNHGRPTYVEL 600

Query: 584 KLSDIEKLFGR 594
           KL+DIEKLFGR
Sbjct: 601 KLADIEKLFGR 611


>gi|74317535|ref|YP_315275.1| DNA mismatch repair protein MutL [Thiobacillus denitrificans ATCC
           25259]
 gi|123759071|sp|Q3SIQ5|MUTL_THIDA RecName: Full=DNA mismatch repair protein mutL
 gi|74057030|gb|AAZ97470.1| DNA mismatch repair protein [Thiobacillus denitrificans ATCC 25259]
          Length = 598

 Score =  544 bits (1402), Expect = e-152,   Method: Composition-based stats.
 Identities = 193/607 (31%), Positives = 330/607 (54%), Gaps = 24/607 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LS+ +I+QIAAGE++ERP+ A+KE++ENSLDA ++ ++  +  GG    +++D+G
Sbjct: 1   MSIQVLSDVLISQIAAGEVVERPAAALKEILENSLDAGATAIDVELEQGGVKRIRVSDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  +E+ +A+ RH TSKI+   D   + + GFRGEAL SI +V+ + L SR   ++  
Sbjct: 61  VGIPRDELALALTRHATSKIATLADLEQVASLGFRGEALASIASVARVRLTSRHAGSDHA 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
             I + G  +    P A + GT +++ D+FF  PAR  FLK+E  E     + +RR+A+A
Sbjct: 121 WTIHVDGGPLQPSSPAARSGGTTIDIEDMFFNTPARRKFLKTEATEYAHCAETVRRLALA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +P+V+FT       + ++  ++       R+  V+GE F  +A+ ++  +  + L G+  
Sbjct: 181 WPQVAFTLVHNGRAQLRLKAEAAAA----RVRHVLGEVFEQHAIAVDAAAGALRLSGWVV 236

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P     + +  +VF+NGR V+DK I+  +R AY + +     P   L +E+ P  VDVN
Sbjct: 237 RPVAATASRDAQHVFVNGRYVRDKLIVHALREAYRDVLHHQLNPAYCLFVELPPEHVDVN 296

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGI-----------STSSVLSKKMISSFHQ 347
           VHPAK+ IRFR+   +  F+  ++++ +                  + +  ++   S   
Sbjct: 297 VHPAKTEIRFRDSRGVHQFLYHAVERLLAAPVAPAAPPSGPDARPPTFLQPRQAAMSLQV 356

Query: 348 DNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLG 407
           + A   + P  A +     E   + +   +           ++ D+  V         LG
Sbjct: 357 EEAMAFYAPFAAMAPGEGDEARHVPQASAAGLAGRAGPPRAFASDSSAVPP-------LG 409

Query: 408 IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLE 467
            A  Q+H  Y+++Q   GLV+VD HAAHER+++EK++   +   + +Q LL P  +    
Sbjct: 410 YALGQLHGVYVLAQNAHGLVLVDMHAAHERVVYEKLKTALDRRAVPAQALLIPVALTADP 469

Query: 468 GECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTY 527
            E A I  H + L  +G +     PN++A+R +P++L   +  +L R I+ EI +     
Sbjct: 470 REVAEIAPHLDQLREIGFELSITSPNSVAVRAVPSLLKNADPVELTRAILAEIAEFGVAR 529

Query: 528 TLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSD 587
            L +R   +LAT+AC+G++R+ R +   EMN LLREME    + QCNHGRPT+ +L+L +
Sbjct: 530 LLAERRNELLATLACHGAVRAHRTLSVPEMNALLREMEATERAGQCNHGRPTWFQLRLDE 589

Query: 588 IEKLFGR 594
           ++ +F R
Sbjct: 590 LDAMFMR 596


>gi|207721715|ref|YP_002252154.1| DNA mismatch repair protein MutL [Ralstonia solanacearum MolK2]
 gi|206586877|emb|CAQ17462.1| dna mismatch repair protein mutl [Ralstonia solanacearum MolK2]
          Length = 644

 Score =  544 bits (1401), Expect = e-152,   Method: Composition-based stats.
 Identities = 202/636 (31%), Positives = 327/636 (51%), Gaps = 50/636 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            IR L +++I+QIAAGE++ERP+  +KEL+EN+LDA +++++  +  GG     ITDNG 
Sbjct: 14  PIRPLPDQLISQIAAGEVVERPASVVKELLENALDAGATQLQIKLEEGGVRRIAITDNGG 73

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +E+P+A+ RH TSKI   ++  ++ T GFRGEAL SI +V+ LTL SR        
Sbjct: 74  GIPVDELPVALMRHATSKIGSLEELESVATLGFRGEALASIASVAELTLTSRTADAAHAT 133

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI     ++   +P +   GT V+V+ L+F  PAR  FLKSEQ E     +VIRR A+A 
Sbjct: 134 QILAQSGRL---QPASGGVGTTVDVQHLYFNTPARRKFLKSEQTELGHCLEVIRRTALAR 190

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V+ +           N          R + V+G +F    +   E + E+ L G+ G+
Sbjct: 191 PDVAISVHHNGKPLEHWNA----AQADTRTAAVLGTEFARARLPFEEAAGELRLFGFAGL 246

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT +RG A+  + ++NGR V+D+ +   +R+AY + +   R+P  VL LE+ P  VDVNV
Sbjct: 247 PTASRGRADHQFFYVNGRFVRDRLLTHAVRSAYEDVLHGDRFPAYVLCLELPPEAVDVNV 306

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HP+K  +RFR+   +  F+  ++Q+A+++        L   +  +      P T      
Sbjct: 307 HPSKIEVRFRDSRAVHQFVYHAVQRALSRHAGEQGDSLRTDIAEAADAPGQPGTTATPAP 366

Query: 360 TSLTNTQ--------------------------EKLFLQENRLSTNDLLPSDDPTYSEDN 393
              T                                 L  +R +    +PS    +    
Sbjct: 367 ADNTTRWINQMAARQTSLGIAQPRAEYLAMMRGSSTPLPSSRPAWMADVPSTATLFDGAT 426

Query: 394 DPVEESEATH---------------YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERL 438
              +E+                   + LG A AQ+H  Y+++Q   G+V+VD HAAHER+
Sbjct: 427 ATTDEAPVQAPVPVAAPQTDDADDAHPLGFAIAQLHGIYVLAQNARGMVLVDMHAAHERI 486

Query: 439 IFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIR 498
           ++E+++    + ++  Q LL P  +     E     E  + L  LG       P  +A+R
Sbjct: 487 LYEQLKTALEARRVEVQPLLIPVTLAASPVEIGTAEEFRDTLTLLGFDISAVSPTTLAVR 546

Query: 499 EIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMN 558
            +P +L K +   L RD++ ++     +  L +R   +LAT+AC+ ++R+ R++   EMN
Sbjct: 547 AVPTLLQKADAQALARDVLRDLQAYGGSRVLAERQNELLATLACHSAVRANRRLNLDEMN 606

Query: 559 RLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            LLR+ME    + QCNHGRPT+I+L ++D+++LF R
Sbjct: 607 ALLRQMEATERADQCNHGRPTWIQLTVADLDRLFLR 642


>gi|83855187|ref|ZP_00948717.1| DNA mismatch repair protein [Sulfitobacter sp. NAS-14.1]
 gi|83843030|gb|EAP82197.1| DNA mismatch repair protein [Sulfitobacter sp. NAS-14.1]
          Length = 635

 Score =  544 bits (1401), Expect = e-152,   Method: Composition-based stats.
 Identities = 259/621 (41%), Positives = 388/621 (62%), Gaps = 30/621 (4%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+ A+KEL+EN++DA + ++    A GGK+  ++TD+G G
Sbjct: 15  IRQLDDSAINRIAAGEVVERPASAVKELVENAIDAGARQITVEYADGGKTLIRVTDDGCG 74

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           + ++++ +A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR    + GA+I
Sbjct: 75  IAADDLTLALSRHATSKIDGTDLLNIHTFGFRGEALPSLGAVGRLTICSRVAGQD-GAEI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           +++G     VRP A+N GT+V +RDLFF  PARL FL++++ E   I+D+I+R+A+A P 
Sbjct: 134 SVNGGVAGPVRPAALNGGTVVTLRDLFFATPARLKFLRTDRAEAQAISDIIKRLAMAEPF 193

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGN----FPERISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT    S     R     ++  G+       R++QV+G +F  NA+ ++ +   + L 
Sbjct: 194 VRFTLRDVSGDGPGREVFRAEAEQGDMFAALHGRLAQVLGREFAENALAIDAEREGLHLT 253

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG+A   Y+F+NGR V+DK ++  +R AY + +   R+P   L ++ DP+ 
Sbjct: 254 GYAALPTYSRGSAVTQYLFVNGRPVRDKLLVGALRGAYFDLLSRDRHPAAALFVDCDPKL 313

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAP--- 351
           VDVNVHPAKS +RFR+P + R  I+ +++ A+   G   S+ ++   + +   +      
Sbjct: 314 VDVNVHPAKSEVRFRDPGLARGLIVSALRHALADAGHRASTTVANATLGAMRPEQPGARV 373

Query: 352 ----KTHLPKYATSLTNTQEKLFLQEN-------------RLSTNDLLPSDDPTYSEDND 394
               +  L   + +      +    E                   D+   D  T+   + 
Sbjct: 374 YQMDRPSLGARSAAYQAQAPEPGFAETAGMWGRVETPPQYEAGGADVQTHDTQTHDAHDA 433

Query: 395 PVEESE-ATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKIT 453
               +E A  + LG A AQ+H+NYII+QT  G+VIVDQHAAHERL++EK+++      + 
Sbjct: 434 HTPAAEPAPDFPLGTARAQVHENYIIAQTATGMVIVDQHAAHERLVYEKLKRQMAENGVA 493

Query: 454 SQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLL 513
           +Q LL PEI+DL   +CA ++E  +DL R G+  E FG +AIA+RE PAIL   +   ++
Sbjct: 494 AQALLIPEIVDLSASDCARLLEVADDLARFGLGIEPFGGSAIAVRETPAILGTVDAKAMV 553

Query: 514 RDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQC 573
            DI+DE+ D + + TLQ RIE IL+ +AC+GSIRSGR M+  EMN LLREME  P+S QC
Sbjct: 554 LDILDELADQNESNTLQARIEAILSRVACHGSIRSGRWMRGEEMNALLREMEATPHSGQC 613

Query: 574 NHGRPTFIKLKLSDIEKLFGR 594
           NHGRPT+++LKLSDIE+LFGR
Sbjct: 614 NHGRPTYVELKLSDIERLFGR 634


>gi|94496337|ref|ZP_01302914.1| DNA mismatch repair protein MutL [Sphingomonas sp. SKA58]
 gi|94424083|gb|EAT09107.1| DNA mismatch repair protein MutL [Sphingomonas sp. SKA58]
          Length = 594

 Score =  543 bits (1400), Expect = e-152,   Method: Composition-based stats.
 Identities = 223/599 (37%), Positives = 351/599 (58%), Gaps = 11/599 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E ++N+IAAGE++ERP+ A+KE++EN+LDA + R+   ++ GG    ++ D+G
Sbjct: 1   MSIRRLPEHLVNRIAAGEVVERPASALKEIVENALDAGAHRIAVRLSNGGLDRIEVIDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM S E+ +A++RH TSK+ DD   N+ T GFRGEALPSI +V+ L++ SRP   + G 
Sbjct: 61  CGMDSGEMALALERHATSKLPDDAIENVATLGFRGEALPSIASVARLSIDSRPRGAD-GW 119

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
              +   ++ +  P A+ PGT + V  LF  +PAR  FL+S + E     + IRR+A+A+
Sbjct: 120 NRTVDNGQLVAEGPAALPPGTRITVEQLFAKVPARRKFLRSPKAEYAACLNCIRRLAMAH 179

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V+F+          +          ER++ +      +N V ++ +   I L G   +
Sbjct: 180 PAVAFSVEHDGRRVLGVQ---EGEAREERVAALTDRQLADNHVIVSLEREGIRLSGVASL 236

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT NRG  +  Y+F+NGR V+D+ ++  +R AYA+ +   R+PVV L L++   +VDVNV
Sbjct: 237 PTCNRGVGDHQYLFVNGRPVKDRLLIGALRGAYADMLARDRHPVVALFLDVPAHEVDVNV 296

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HPAK+ +RFR+P +IR  I+  +++A++ +G           +S++  +  P +  P  A
Sbjct: 297 HPAKTEVRFRDPALIRGMIVSGLRRALDAEGFRAVQHADPAGLSAWRPE--PVSPTPIGA 354

Query: 360 TSLTNTQEKLFLQENRLST----NDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQ 415
             +     +         T         +  P    +       E   + LG+A  Q+ +
Sbjct: 355 MPIFEAAGQPVSYNPSFQTVADRRASFQAPPPQARAEPAAAPAPEGASFPLGVARGQVAR 414

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
            YI+++  DGLVIVDQHAAHERL  E+MR+      + SQ LL PE+++L E  C  +  
Sbjct: 415 TYIVAEAEDGLVIVDQHAAHERLTLERMRRAMEGQGVASQALLLPEVVELDEPACDRLEA 474

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
              +L   G++ ERFGP+A+ +R  PA+L + ++  L+ D+ D++    +  +L++R++ 
Sbjct: 475 RAGELREFGLELERFGPSAMLVRAAPAMLGQSDVQGLVTDLADDLAAYDSALSLKERLDL 534

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           + ATMAC+GS+R+GR +   EMN LLREME  P S QCNHGRPT++KL   DIEKLFGR
Sbjct: 535 VAATMACHGSVRAGRVLSVAEMNALLREMEVTPRSGQCNHGRPTWVKLGHGDIEKLFGR 593


>gi|299065825|emb|CBJ37004.1| methyl-directed mismatch repair protein [Ralstonia solanacearum
           CMR15]
          Length = 636

 Score =  543 bits (1400), Expect = e-152,   Method: Composition-based stats.
 Identities = 204/632 (32%), Positives = 331/632 (52%), Gaps = 46/632 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            IR L +++I+QIAAGE++ERP+  +KEL+EN+LDA +++++  +  GG     ITDNG 
Sbjct: 10  PIRPLPDQLISQIAAGEVVERPASVVKELLENALDAGATQLQIKLEEGGVRRIAITDNGG 69

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +E+P+A+ RH TSKI   ++  ++ T GFRGEAL SI +V+ LTL SR  Q+    
Sbjct: 70  GIPVDELPVALMRHATSKIGSLEELESVATLGFRGEALASIASVAELTLTSRTAQDAHAT 129

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI     ++   +P +   GT V+V+ L+F  PAR  FLK+EQ E     +VIRR A+A 
Sbjct: 130 QIIAQTGRV---QPASGGVGTTVDVQHLYFNTPARRKFLKTEQTELGHCLEVIRRTALAR 186

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V+ +           N          R + V+G +F    +   E + E+ L G+ G+
Sbjct: 187 PDVAISVHHNGKPLEHWNA----AQADMRTAAVLGTEFARARLPFEEAAGELRLFGFAGL 242

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT +RG A+  + ++NGR V+D+ +   +R+AY + +   R+P  VL LE+ P  VDVNV
Sbjct: 243 PTASRGRADHQFFYVNGRFVRDRLLTHAVRSAYEDVLHGDRFPAYVLCLELPPEAVDVNV 302

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA---PKTHLP 356
           HP+K  +RFR+   +  F+  ++Q+A+++        L   +  +  Q  A   P  +  
Sbjct: 303 HPSKIEVRFRDSRAVHQFVYHAVQRALSRHAGEQGDSLRTDIADAPEQPGATATPADNTT 362

Query: 357 KYATSLTNTQEKLFLQENRL---------STNDLLPSDDPTYSEDND------------- 394
           ++   +   Q  L + + R          ST              +              
Sbjct: 363 RWVNQMAARQTSLGIAQPRAEYLAMMRGGSTPQPPSRPAWMADVPSAATLFDGAADAPAD 422

Query: 395 ------------PVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEK 442
                       P  +     + LG A AQ+H  Y+++Q   G+V+VD HAAHER+++E+
Sbjct: 423 AAPAQASEPAAAPQADDSDDAHPLGFAVAQLHGIYVLAQNARGMVLVDMHAAHERILYEQ 482

Query: 443 MRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPA 502
           ++    + +I  Q LL P        E     E  + L  LG       P  +A+R +P 
Sbjct: 483 LKTALEAKRIEVQPLLIPVTFAASAVEIGTAEEFCDTLDLLGFDISAVSPTTLAVRAVPT 542

Query: 503 ILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLR 562
           +L K +   L RD++ ++     +  L +R   +LAT+AC+ ++R+ R++   EMN LLR
Sbjct: 543 LLQKADAQALARDVLRDLQAYGGSRVLAERQNELLATLACHSAVRANRRLNLDEMNGLLR 602

Query: 563 EMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +ME    + QCNHGRPT+I+L ++D+++LF R
Sbjct: 603 QMEATERADQCNHGRPTWIQLTVADLDRLFLR 634


>gi|300703174|ref|YP_003744776.1| methyl-directed mismatch repair protein [Ralstonia solanacearum
           CFBP2957]
 gi|299070837|emb|CBJ42138.1| methyl-directed mismatch repair protein [Ralstonia solanacearum
           CFBP2957]
          Length = 644

 Score =  543 bits (1400), Expect = e-152,   Method: Composition-based stats.
 Identities = 200/636 (31%), Positives = 328/636 (51%), Gaps = 50/636 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            IR L +++I+QIAAGE++ERP+  +KEL+EN+LDA +++++  +  GG     ITDNG 
Sbjct: 14  PIRPLPDQLISQIAAGEVVERPASVVKELLENALDAGATQLQIKLEEGGVRRIAITDNGG 73

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +E+P+A+ RH TSKI   ++  ++ T GFRGEAL SI +V+ LTL SR        
Sbjct: 74  GIPVDELPVALMRHATSKIGSLEELESVATLGFRGEALASIASVAELTLTSRTADAAHAT 133

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI     ++   +P +   GT V+V+ L+F  PAR  FLKSEQ E     +VIRR A+A 
Sbjct: 134 QILAQSGRL---QPASGGVGTTVDVQHLYFNTPARRKFLKSEQTELGHCLEVIRRTALAR 190

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V+ +           N          R + V+G +F    +   E + E+ L G+ G+
Sbjct: 191 PDVAISVHHNGKPLEHWNA----AQADTRTAAVLGTEFARARLPFEEAAGELRLFGFAGL 246

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT +RG A+  + ++NGR V+D+ +   +R+AY + +   R+P  VL LE+ P  VDVNV
Sbjct: 247 PTASRGRADHQFFYVNGRFVRDRLLTHAVRSAYEDVLHGDRFPAYVLCLELPPEAVDVNV 306

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKT------ 353
           HP+K  +RFR+   +  F+  ++Q+A+++        L   +  +      P T      
Sbjct: 307 HPSKIEVRFRDSRAVHQFVYHAVQRALSRHAGEQGDSLRTDIAEAADAPGQPGTAATPTP 366

Query: 354 --HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSE-------------------- 391
             +  ++   +   Q  L + + R     ++                             
Sbjct: 367 ADNTTRWINQMAARQTSLGIAQPRAEYLAMMRGSSTPLPSSRPAWMADVPSAATLFDGAA 426

Query: 392 -------------DNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERL 438
                           P  +     + LG A AQ+H  Y+++Q   G+V+VD HAAHER+
Sbjct: 427 DDADEAPVQAPVPVAAPQTDDADDAHPLGFAIAQLHGIYVLAQNARGMVLVDMHAAHERI 486

Query: 439 IFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIR 498
           ++E+++    + ++  Q LL P  +     E     E  + L  LG       P  +A+R
Sbjct: 487 LYEQLKTALEARRVEVQPLLIPVTLAASPVEIGTAEEFRDTLTLLGFDISAVSPTTLAVR 546

Query: 499 EIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMN 558
            +P +L K +   L RD++ ++     +  L +R   +LAT+AC+ ++R+ R++   EMN
Sbjct: 547 AVPTLLQKADAQALARDVLRDLQAYGGSRVLAERQNELLATLACHSAVRANRRLNLDEMN 606

Query: 559 RLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            LLR+ME    + QCNHGRPT+I+L ++D+++LF R
Sbjct: 607 ALLRQMEATERADQCNHGRPTWIQLTVADLDRLFLR 642


>gi|294853233|ref|ZP_06793905.1| DNA mismatch repair protein mutL [Brucella sp. NVSL 07-0026]
 gi|294818888|gb|EFG35888.1| DNA mismatch repair protein mutL [Brucella sp. NVSL 07-0026]
          Length = 618

 Score =  543 bits (1399), Expect = e-152,   Method: Composition-based stats.
 Identities = 267/616 (43%), Positives = 389/616 (63%), Gaps = 28/616 (4%)

Query: 7   SEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTSE 66
           SE IINQIAAGE+IERP+  IKEL+EN++DA ++R+E V AGGGK+  ++TDNG G+ ++
Sbjct: 2   SETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVVTAGGGKTLLRVTDNGSGIPAD 61

Query: 67  EIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAISGE 126
           E+ +AV RHCTSK++DD  +I   GFRGEALPSIG+VS LTL S P   ++G ++ ++G 
Sbjct: 62  ELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVSKLTLKSHPQDADSGFEVCVTGG 121

Query: 127 KISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVSFTF 186
            +   RP A+N GTIVEVRDLF+  PARL F+K+++ E   ITDV++R+ IA+P + F+ 
Sbjct: 122 HLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRAEATAITDVVKRIGIAFPHIRFSL 181

Query: 187 STIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNRG 245
           +      ++M    +      ERI QV+G +F  NA+ ++ + + + L G+ GIP+FNRG
Sbjct: 182 AGTDRTPFEMPATGTGAEATLERIGQVLGREFGENALAIDAERDGVRLAGFVGIPSFNRG 241

Query: 246 NANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSY 305
           NA   + ++NGR V+DK I   +R AY++ I   R+PV VL L +DP  VDVNVHPAK+ 
Sbjct: 242 NALHQFAYVNGRPVRDKQIFGALRGAYSDVIARDRHPVAVLFLTLDPALVDVNVHPAKAD 301

Query: 306 IRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD-NAPKTHLPKYATSLTN 364
           +RFR+P ++R  I+ +I++A+ + GI  ++  ++ M+ +F  +    +   P+ A S + 
Sbjct: 302 VRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAEAMLQAFRAEGFGAQQSAPRPANSYSP 361

Query: 365 TQEKLFLQENRLSTNDLLPSDDPTY--------------------------SEDNDPVEE 398
              +      R   +                                    +  +     
Sbjct: 362 ASWRTAPPAPRSEWSPQTAHPAHRPLDLQAAPALRENGQAVLGDVAVPAADARASVAEAP 421

Query: 399 SEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLL 458
            E     LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++   ++  I  Q LL
Sbjct: 422 VELMQKPLGAARAQIHENYIVAQTEDSLVIVDQHAAHERLVYEALKNALHARPIAGQMLL 481

Query: 459 TPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIID 518
            PEI+DL E +   +  H E L R G+  E+FGP AIA+RE PA+L + N+ QL+RD+ D
Sbjct: 482 IPEIVDLPEEDAQRLAGHAETLARFGLGVEQFGPGAIAVRETPAMLGEMNVQQLIRDLAD 541

Query: 519 EIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRP 578
           EI +  T   L+  + ++ ATMAC+GS+RSGR+++  EMN LLR+ME  P S  CNHGRP
Sbjct: 542 EIAEHDTADGLKAMLHHVAATMACHGSVRSGRRLKPEEMNALLRDMEATPGSGTCNHGRP 601

Query: 579 TFIKLKLSDIEKLFGR 594
           T+I+LKL+DIE+LFGR
Sbjct: 602 TYIELKLTDIERLFGR 617


>gi|307941694|ref|ZP_07657049.1| DNA mismatch repair protein MutL [Roseibium sp. TrichSKD4]
 gi|307775302|gb|EFO34508.1| DNA mismatch repair protein MutL [Roseibium sp. TrichSKD4]
          Length = 630

 Score =  543 bits (1399), Expect = e-152,   Method: Composition-based stats.
 Identities = 258/621 (41%), Positives = 385/621 (61%), Gaps = 28/621 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M++R+L E IIN+IAAGE+IERP+  IKEL+EN++DA +S V+ V A GGK+  +++D+G
Sbjct: 10  MQVRQLGEAIINRIAAGEVIERPASVIKELVENAIDAGASSVDIVTAAGGKTLMRVSDDG 69

Query: 61  FGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM   ++ +A++RHCTSKISDD   +I T GFRGEALPSIG+V+ L + +R  +     
Sbjct: 70  IGMRRSDLELAIRRHCTSKISDDDLFDIRTLGFRGEALPSIGSVARLAIQTRHSEEENAW 129

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            I + G K SS+ P A   GT +EVRDLFF  PARL FLKS++ E   IT+++RR+A+AY
Sbjct: 130 TIKVEGGKESSIIPAARTKGTQIEVRDLFFATPARLKFLKSDRAEAAAITEIVRRIALAY 189

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P + F+ S              +     RISQV+G++F++NA+E++     + L G+ G+
Sbjct: 190 PHIGFSLSGSDRQPANWPAARGDEPHLARISQVLGKEFVDNAMEIDAAREGVRLSGFAGL 249

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF+RGNA   + F+NGR V+DK +LS +R AYA+ +   R+ VVVL +++DP  VDVNV
Sbjct: 250 PTFHRGNAQHQFFFVNGRPVKDKLLLSGLRGAYADVLARDRHSVVVLFIDLDPAFVDVNV 309

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSS-------VLSKKMISSFHQDNAPK 352
           HPAK+ +RFR+  ++R  ++ SI++A+ + G  +S+        + +    +    +   
Sbjct: 310 HPAKADVRFRDGQLVRGLLVGSIKQALVQAGHRSSTSNAAAAMDVIRAQGFAPRAPSGSG 369

Query: 353 THLPKYATSLTNTQ-------------------EKLFLQENRLSTNDLLPSDDPTYSEDN 393
              P Y    +N                     E+      R +    L           
Sbjct: 370 NATPAYQPQRSNAAWSQDAFRPLEPTARGFSDGEQSVFDAPREAGLSGLSMPSADARAHE 429

Query: 394 DPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKIT 453
             + E E T   LG   AQ+H+ YII+QT DG+VIVDQHAAHERL++EK+++      + 
Sbjct: 430 KQI-EPEKTSLPLGAPRAQVHETYIIAQTDDGVVIVDQHAAHERLVYEKLKESLAKKDVA 488

Query: 454 SQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLL 513
            Q LL PEI+++ E +   + +H  +L  +G+  E FGP A+A+RE PAIL   NI  ++
Sbjct: 489 RQLLLIPEIVEMPEEDVGRLTDHATELEEVGLVLEAFGPGAVAVRETPAILGDMNIKGMV 548

Query: 514 RDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQC 573
            ++ DE+ +  T   L+++++++ ATMAC+GSIR+GR+M+  EM +LLR+ME  P S QC
Sbjct: 549 LNLADELAEWETASGLKEKLDHVAATMACHGSIRAGRRMRVEEMAQLLRDMEATPLSGQC 608

Query: 574 NHGRPTFIKLKLSDIEKLFGR 594
           NHGRPT+++LKL DIEKLFGR
Sbjct: 609 NHGRPTWVELKLDDIEKLFGR 629


>gi|325128499|gb|EGC51377.1| DNA mismatch repair protein MutL [Neisseria meningitidis N1568]
          Length = 658

 Score =  543 bits (1399), Expect = e-152,   Method: Composition-based stats.
 Identities = 212/658 (32%), Positives = 342/658 (51%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  + GGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELDGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSEATEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRADLTESVGNAGEVLHDITGVTPAPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLP 383
                   ++      K  +      + KT    Y ++    Q  L L+E+R + N    
Sbjct: 359 DSENLFNRASDYPTGNKPDTRNAFGASGKTAPMPYQSAYAPQQRSLSLRESRAAMNTYAE 418

Query: 384 SDDPT-----------YSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
               T            +   +   E+ A                    G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSRFEQARFGNMPSETPAPQTDTPLSDGIPSPSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNST-KITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++      K+ SQ LL P        ECA + ++
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGKLQSQRLLIPVTFAASHEECAALADY 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R +PA+L K ++  L +D+++E+    ++ T+++    I
Sbjct: 539 AETLAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLNELAQVGSSQTIEEHENRI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|218768445|ref|YP_002342957.1| DNA mismatch repair protein [Neisseria meningitidis Z2491]
 gi|20455150|sp|Q9JTS2|MUTL_NEIMA RecName: Full=DNA mismatch repair protein mutL
 gi|121052453|emb|CAM08789.1| DNA mismatch repair protein [Neisseria meningitidis Z2491]
          Length = 658

 Score =  543 bits (1399), Expect = e-152,   Method: Composition-based stats.
 Identities = 212/658 (32%), Positives = 341/658 (51%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  + GGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELDGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      +I R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMIERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  S  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGDDFQTASLEIDSGSGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDL-- 381
                   ++      K  +     ++ KT    Y ++    Q  L L+E+R + N    
Sbjct: 359 DSENLFNRASDYPTGNKPDTRNAFGSSGKTAPMPYQSAYAPQQRSLSLRESRAAMNTYAE 418

Query: 382 ---------LPSDDPTYSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
                    L       +   +   E+ A                    G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSQFEQARFGNMPSETPAPKTDTPLSDGIPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++       + SQ LL P        ECA + ++
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGRLQSQRLLIPITFAASHEECAALADY 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R +P +L K ++  L RD++ E+    ++ T+++   +I
Sbjct: 539 AETLAGFGLELSDMGGNTLAVRAVPTMLGKADVVSLARDVLGELAQVGSSQTIEEHENHI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSVRAGRQLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|89056538|ref|YP_511989.1| DNA mismatch repair protein [Jannaschia sp. CCS1]
 gi|88866087|gb|ABD56964.1| DNA mismatch repair protein MutL [Jannaschia sp. CCS1]
          Length = 610

 Score =  543 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 254/599 (42%), Positives = 379/599 (63%), Gaps = 12/599 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+EN++DA++ R+   +A GGK+  ++TD+G G
Sbjct: 16  IRQLDEAAINRIAAGEVVERPASAVKELVENAIDADARRIVIEVAHGGKTLIRVTDDGCG 75

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           M + ++P+A+ RH TSKI   D  NIH+FGFRGEALPS+G+V  L++ SR      G  I
Sbjct: 76  MEAADLPLALSRHATSKIDGTDLLNIHSFGFRGEALPSLGSVGRLSITSRASDA--GHMI 133

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            ++G    +V+P A+N GT+VE+RDLFF  PARL FL++++ E   ITDV++R+A+A P 
Sbjct: 134 RVTGGAHDAVKPAALNRGTLVELRDLFFATPARLKFLRTDRAEMQAITDVVKRLAMAEPA 193

Query: 182 VSFTFSTIKS-NRYKMNFQSTNGNFPERIS----QVIGEDFINNAVELNEKSNEITLQGY 236
           V FT   +    R         G+  + +      ++G DF +NA+ ++ +   + L GY
Sbjct: 194 VGFTLKDVSDGERVTFRVDPEQGDLFDALRGRLTAIMGRDFTDNALAIDAEREGLRLTGY 253

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
             +PT++RG+A   ++F+NGR V+DK ++  +R AY + +   R+P  VL +     +VD
Sbjct: 254 AALPTYSRGSAVAQFLFVNGRPVRDKLLIGALRAAYMDVLSRDRHPAAVLFIGCPSERVD 313

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLP 356
           VNVHPAKS +RFR P + R+ I+  ++ A+ + G   SS ++   +S+     +     P
Sbjct: 314 VNVHPAKSEVRFREPGVARSLIVTGLRHALAEAGHRASSTVADATLSAMQPAYSEPPSEP 373

Query: 357 KYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEAT-HYQLGIACAQIHQ 415
             A  +   Q     Q+   +    L    P +S  +  V+E+       LG A AQ+H+
Sbjct: 374 LAAPRIY--QMDRLGQQRGFAPVRGLEEAAPQWSAPSARVDEAVIDSDGPLGAARAQVHE 431

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           NYII+QT  G+V+VDQHAAHERL++E+++       +  Q LL PEI+ L      L+ +
Sbjct: 432 NYIIAQTPGGIVLVDQHAAHERLVYERLKTQMAERGVARQALLIPEILTLGADADRLL-D 490

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           H  +L R G+  E FGP  +A+RE PAIL + N   LLRDI+DE+ D   + TLQ R+E 
Sbjct: 491 HAAELERFGLVIEAFGPGTVAVRETPAILGEINAEALLRDILDELSDLGDSQTLQARVEA 550

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +L+ +AC+GSIRSGR+M++ EMN LLREME  P S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 551 VLSRVACHGSIRSGRQMRADEMNALLREMEATPLSGQCNHGRPTYVELKLADIERLFGR 609


>gi|297538675|ref|YP_003674444.1| DNA mismatch repair protein MutL [Methylotenera sp. 301]
 gi|297258022|gb|ADI29867.1| DNA mismatch repair protein MutL [Methylotenera sp. 301]
          Length = 622

 Score =  543 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 214/621 (34%), Positives = 327/621 (52%), Gaps = 33/621 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I  L +++I+QIAAGE++ERP+ A+KEL+ENSLDA S+ +   +  GG    ++ DNG G
Sbjct: 4   IHLLPDQLISQIAAGEVVERPASALKELLENSLDAGSTDISVSLVQGGVKQLRVADNGNG 63

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  E++ MA+ RH TSKI+  DD   + + GFRGEAL SI +VS   + SR        +
Sbjct: 64  IAQEDLAMALTRHATSKIASLDDLEAVASLGFRGEALASIASVSRTQISSRALDTKHAWR 123

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           IA +G +IS + P A++ GTI+EV DL+F  PAR  FLK+E  E         R+ ++ P
Sbjct: 124 IASNGSEISPIEPTALDAGTIIEVDDLYFNTPARRKFLKTEGTEFGHCEAAFNRVVLSRP 183

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V+F          +           +R  +V+G DF    + + E +  + + G    P
Sbjct: 184 DVAFMLQHNGRALSRY----AVSEPTKRFGEVLGADFAAETIAVEESAAGLRIWGVVAKP 239

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNR  ++  YV++NGR V+DK I   IR AY + +   R+P  VL LE+DP  VDVNVH
Sbjct: 240 TFNRNKSDTQYVYVNGRFVRDKLISHAIRQAYQDVLHHDRHPAFVLFLELDPNLVDVNVH 299

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKK-GISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           PAK+ +RFR+   I  FI  S+ KA+    G+S +S  ++   + F   NA         
Sbjct: 300 PAKTEVRFRDGQAIHRFIFHSLHKALASPTGVSNASTANQAAYNPFGGQNANSPSYSASP 359

Query: 360 TSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDN----------------------DPVE 397
                 Q  L   E       L  ++      +N                      +  E
Sbjct: 360 YPQYQAQINLSANEPNSFYQTLFSANSAQNYSNNALNNTALQTNRDGLAGGAVFTSNASE 419

Query: 398 ESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTL 457
               + + LG A AQIH  Y+++Q   GLV+VD HAAHER+++E+++   ++  +  Q L
Sbjct: 420 NYAESAFPLGFAVAQIHGVYVLAQNAQGLVVVDMHAAHERIMYEQLKNALDNQAVGMQPL 479

Query: 458 LTPEIIDLLEGECALIME----HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLL 513
           L P   +    E A + E    +D  L +LG       P  +A+R +P +L   +   L 
Sbjct: 480 LLPVSFNADRLEVATVQEALASNDGSLQQLGFDIAIISPTTLAVRAVPTMLQDADAVTLA 539

Query: 514 RDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQC 573
           RD++ ++ +   +  L +R   +L TMAC+ ++R+ R +   EMN LLR+ME    S QC
Sbjct: 540 RDVLRDLREYGASRALTERRNELLGTMACHAAVRANRSLTIPEMNALLRDMEATERSGQC 599

Query: 574 NHGRPTFIKLKLSDIEKLFGR 594
           NHGRPT+ ++ +SD++K+F R
Sbjct: 600 NHGRPTWFQVSMSDLDKMFMR 620


>gi|254438381|ref|ZP_05051875.1| DNA mismatch repair protein MutL [Octadecabacter antarcticus 307]
 gi|198253827|gb|EDY78141.1| DNA mismatch repair protein MutL [Octadecabacter antarcticus 307]
          Length = 613

 Score =  542 bits (1397), Expect = e-152,   Method: Composition-based stats.
 Identities = 264/600 (44%), Positives = 392/600 (65%), Gaps = 16/600 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L +  IN+IAAGE++ERP+  +KELIEN+LDA +SRVE  +A GGK+  ++TDNG G
Sbjct: 21  IRQLDDAAINRIAAGEVVERPASVVKELIENALDARASRVEVFVADGGKTLIRVTDNGVG 80

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT++++P+A+ RH TSKI   D  NIH+FGFRGEALPS+GAV  LT+ SR      G +I
Sbjct: 81  MTAQDLPLALSRHATSKIDGSDLLNIHSFGFRGEALPSLGAVGRLTIRSRTDGGE-GCEI 139

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
           ++SG   ++VRP A+  GTIVE+RDLF+  PARL FL++++ E   I+D ++R+A+A P 
Sbjct: 140 SVSGGAHTAVRPAALTVGTIVELRDLFYATPARLKFLRTDRAEMQAISDAVKRLAMAEPF 199

Query: 182 VSF--TFSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQG 235
           V+F  T  +  ++R         G+  +    R+  V+G+DF  NA+ ++     + L G
Sbjct: 200 VTFVLTDVSGGNSRVTFRANGETGDMFDALHARLRSVLGKDFAENALAIDALREGVHLTG 259

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y  +PT++RG+A Q ++++NGR V+DK ++  +R AY +T+   R+P   L +++DP +V
Sbjct: 260 YAALPTYSRGSAVQQFLYVNGRPVRDKVLIGALRGAYMDTLSRDRHPAACLFIDVDPTRV 319

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA-PKTH 354
           DVNVHPAKS +RFR+PTI+R  I+ +++ A+   G   SS ++   + +   +   P+ +
Sbjct: 320 DVNVHPAKSEVRFRDPTIVRGLIVSALRAALADAGHRASSTVASDTLGAMQPEQMEPRIY 379

Query: 355 LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIH 414
                T              R S    + +D     E  +  +   A    LG A AQ+H
Sbjct: 380 QMDRPTGGIGPAY-------RPSGFADIATDMSGRVEVVEANDGPSAQERPLGAARAQLH 432

Query: 415 QNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIM 474
           +NYII+QT  G+VIVD HAAHERL++EK++       + +Q LL PEII++  G+ A ++
Sbjct: 433 ENYIIAQTETGIVIVDGHAAHERLVYEKLKTQMAENGVAAQALLIPEIIEMSYGDAAQLL 492

Query: 475 EHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIE 534
              +DL R G+  E FG NAIA+RE PAIL + N   +LRDI+DE+ D  ++  +Q+++E
Sbjct: 493 AVADDLSRFGLTIEPFGGNAIAVRETPAILGEVNAEAMLRDILDELSDQGSSTLVQEKLE 552

Query: 535 NILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            IL+ +AC+GSIR+GR M+  EMN LLREME+ P S QCNHGRPT+++LKLSDIE+LFGR
Sbjct: 553 AILSRVACHGSIRTGRSMRGEEMNALLREMERTPRSGQCNHGRPTYVELKLSDIERLFGR 612


>gi|325204429|gb|ADY99882.1| DNA mismatch repair protein MutL [Neisseria meningitidis
           M01-240355]
          Length = 658

 Score =  542 bits (1396), Expect = e-152,   Method: Composition-based stats.
 Identities = 217/658 (32%), Positives = 339/658 (51%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  + GGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELDGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      +I R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMIERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++GEDF   ++ ++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGEDFQTASLGIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK--------------------------KGIST 333
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGITPAPMSSEN 358

Query: 334 SSVLSKKMISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTNDL-- 381
            S       S++   N P          KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DSENLFDSASNYPTGNKPDTRNTFGSSGKTAPMPYQAARAPQQRSLSLRESRAAMNTYAE 418

Query: 382 ---------LPSDDPTYSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
                    L       +   +   E+                      G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSQFEQARFGNMPSETPTPQTDTPLSDGIPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNST-KITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++      K+ SQ LL P        ECA + ++
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGKLQSQRLLIPVTFAASHEECAALADY 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R +PA+L K +I  L RD++ E+    ++ T+++    I
Sbjct: 539 AETLAGFGLELSDMGGNTLAVRAVPAMLGKSDIVSLARDVLGELAQVGSSQTIEEHENRI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|237745903|ref|ZP_04576383.1| DNA mismatch repair protein MutL [Oxalobacter formigenes HOxBLS]
 gi|229377254|gb|EEO27345.1| DNA mismatch repair protein MutL [Oxalobacter formigenes HOxBLS]
          Length = 627

 Score =  542 bits (1396), Expect = e-152,   Method: Composition-based stats.
 Identities = 202/616 (32%), Positives = 337/616 (54%), Gaps = 28/616 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            I+ LS+ +I+QIAAGE++ERPS  +KEL+EN++DA +++++  +  GG     ++DNG 
Sbjct: 15  TIQLLSDTLISQIAAGEVVERPSAVVKELLENAVDAGATQIDIRLENGGIKRIAVSDNGC 74

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++ +A+ RH TSKI+   D  N+ T GFRGEAL SI +V+ +TL SR  +     
Sbjct: 75  GIAPDQLQLALTRHATSKIASLNDLENVSTLGFRGEALASIASVAEVTLQSRTSEQPHAW 134

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI  +    +   P +   GT V+V +L+   PAR  FLKSEQ E     +++RR+A+A 
Sbjct: 135 QIRGNDPSKTL-TPCSGVKGTAVDVHELYANTPARRKFLKSEQTEYGHCAEIVRRIALAR 193

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P + FT         +    + +    + + +   +  +   +   E S+ ++L G+ G+
Sbjct: 194 PGIRFTLMHNGKVTAQYQADNLSQRCNQILGEAFSQSLLPVDLAAGEDSDRLSLTGFIGL 253

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT +R   +  Y ++NGR V+D+ +   +R AY + +   RYPV +L L+++P +VDVNV
Sbjct: 254 PTASRTRGDMQYFYVNGRFVRDRLLTHAVRAAYEDVLHGNRYPVYLLYLKLEPSRVDVNV 313

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGIS---------------------TSSVLS 338
           HPAK  +RFR+   I  FI  SI + + +                           S  S
Sbjct: 314 HPAKIEVRFRDSRAIHQFIYHSISRILARPMEPEPETTGEERPSSIRSPSPPRGPVSWRS 373

Query: 339 KKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE 398
               +++  +   +++   +  +L  T+EK  LQ   +   D+     P  +E       
Sbjct: 374 APPPAAYRIEQKTESYGALFRDTLRQTEEKRPLQ---IQNPDIPSGTAPALAETGSQKS- 429

Query: 399 SEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLL 458
            E   + LG A AQ+H  YI++Q   GLV+VD HAAHER+++EK++   +   + +Q+LL
Sbjct: 430 GEIDDFPLGFALAQLHDIYILAQNRKGLVLVDMHAAHERIVYEKLKTALDEKTLETQSLL 489

Query: 459 TPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIID 518
            P  + + E E    +E+ E L  LG       P  IAIR +P +L + +I   +R ++ 
Sbjct: 490 IPLTLKVGEVEAGTALENRETLLELGFDISALSPETIAIRTVPVLLKQADIATAIRHVLR 549

Query: 519 EIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRP 578
           ++ +  T+   +++   +LAT+AC+ ++R+ R +   EMN LLR+MEK   + QCNHGRP
Sbjct: 550 DLHEYGTSSVTREKRNELLATVACHNAVRANRTLTIPEMNALLRQMEKTERADQCNHGRP 609

Query: 579 TFIKLKLSDIEKLFGR 594
           T+ +L LS+++ LF R
Sbjct: 610 TWTQLALSELDALFMR 625


>gi|297184247|gb|ADI20365.1| DNA mismatch repair enzyme (predicted ATPase) [uncultured alpha
           proteobacterium EB080_L27A02]
          Length = 611

 Score =  542 bits (1396), Expect = e-152,   Method: Composition-based stats.
 Identities = 263/600 (43%), Positives = 388/600 (64%), Gaps = 12/600 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+LS+   N+IAAGE++ERPS AIKEL+ENS+DA +SR++   + GGK+  ++ DNG G
Sbjct: 15  IRQLSDAAANRIAAGEVVERPSSAIKELVENSIDAGASRIDISYSDGGKTLIRVKDNGHG 74

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           +   ++ +A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR    + GA I
Sbjct: 75  IAENQLMLALSRHATSKIDGTDLLNIHTFGFRGEALPSMGAVGRLTITSRIENVSMGATI 134

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            + G  I  VRP   + GTIVE+R+LF   PARL FL++++ E+  I+DVI+R+A++ P 
Sbjct: 135 TVDGGVIHQVRPAPSSIGTIVELRNLFHATPARLKFLRTDRAESGAISDVIKRLAMSEPF 194

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           + FT    ++    R         G+  +    R+S+++G DF  N+  ++ + + ITL 
Sbjct: 195 IGFTLRDITSGGKGRIIFRADPEAGDLFDAMYGRLSKILGIDFAKNSFRVDAERDGITLT 254

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG++   Y+F+NGR V+DK +LS +R AY++ +  GRYP+  L +E D  +
Sbjct: 255 GYASLPTYSRGSSVSQYIFVNGRPVKDKSLLSALRAAYSDFLHNGRYPLAALFVECDFER 314

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAK+ +RFR P I+R  +I +++ A+ ++G   SS ++   + +F +       
Sbjct: 315 VDVNVHPAKAEVRFREPGIVRGLVISALRHALAEEGHRASSTVADATLGAFKKSEISNIS 374

Query: 355 LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIH 414
                    + +    +Q N L         +   +        ++    +LG A AQ+H
Sbjct: 375 TNLRMNQSWSRE----MQNNNLDQVGFSELQNNFSARQASIETNNDQISNRLGAARAQVH 430

Query: 415 QNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIM 474
           +NYIISQT DG+VIVDQHAAHERL++EK++       ++SQTLL PEII+L E + A++M
Sbjct: 431 ENYIISQTADGIVIVDQHAAHERLVYEKLKNKMALNGVSSQTLLIPEIIELSEQDSAVLM 490

Query: 475 EHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIE 534
           +   DL R G+  E FG N+I +RE PAIL + N   L+ DI+DE+ D S +  ++++++
Sbjct: 491 DLSADLSRFGLSIENFGGNSIVVRETPAILGEVNAKSLILDILDELKDWSESNLIKEKLD 550

Query: 535 NILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            IL+ +AC+GSIRSGR M+  EMN LLREME  P+S QCNHGRPT++KLKL+DIEKLFGR
Sbjct: 551 AILSRVACHGSIRSGRIMKGEEMNALLREMEITPHSGQCNHGRPTYVKLKLNDIEKLFGR 610


>gi|114769575|ref|ZP_01447185.1| DNA mismatch repair protein [alpha proteobacterium HTCC2255]
 gi|114549280|gb|EAU52162.1| DNA mismatch repair protein [alpha proteobacterium HTCC2255]
 gi|297183941|gb|ADI20062.1| hypothetical protein [uncultured alpha proteobacterium
           EB080_L11F12]
          Length = 611

 Score =  541 bits (1395), Expect = e-152,   Method: Composition-based stats.
 Identities = 263/600 (43%), Positives = 388/600 (64%), Gaps = 12/600 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+LS+   N+IAAGE++ERPS AIKEL+ENS+DA +SR++   + GGK+  ++ DNG G
Sbjct: 15  IRQLSDAAANRIAAGEVVERPSSAIKELVENSIDAGASRIDISYSDGGKTLIRVKDNGHG 74

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           +   ++ +A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR    + GA I
Sbjct: 75  IAENQLMLALSRHATSKIDGTDLLNIHTFGFRGEALPSMGAVGRLTITSRIENVSMGATI 134

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            + G  I  VRP   + GTIVE+R+LF   PARL FL++++ E+  I+DVI+R+A++ P 
Sbjct: 135 TVDGGVIHQVRPAPSSIGTIVELRNLFHATPARLKFLRTDRAESGAISDVIKRLAMSEPF 194

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
           + FT    ++    R         G+  +    R+S+++G DF  N+  ++ + + +TL 
Sbjct: 195 IGFTLRDITSGGKGRIIFRADPEAGDLFDAMYGRLSKILGIDFAKNSFRVDAERDGMTLT 254

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG++   Y+F+NGR V+DK +LS +R AY++ +  GRYP+  L +E D  +
Sbjct: 255 GYASLPTYSRGSSVSQYIFVNGRPVKDKSLLSALRAAYSDFLHNGRYPLAALFVECDFER 314

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAK+ +RFR P I+R  +I +++ A+ ++G   SS ++   + +F +       
Sbjct: 315 VDVNVHPAKAEVRFREPGIVRGLVISALRHALAEEGHRASSTVADATLGAFKKSEISNIS 374

Query: 355 LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIH 414
                    + +    +Q N L         +   +        ++    +LG A AQ+H
Sbjct: 375 TNLRMNQSWSRE----MQNNNLDQVGFSELQNNFSARQASIETNNDQISNRLGAARAQVH 430

Query: 415 QNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIM 474
           +NYIISQT DG+VIVDQHAAHERL++EK++       ++SQTLL PEII+L E + A++M
Sbjct: 431 ENYIISQTADGIVIVDQHAAHERLVYEKLKNKMALNGVSSQTLLIPEIIELSEQDSAVLM 490

Query: 475 EHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIE 534
           +   DL R G+  E FG N+I +RE PAIL + N   L+ DI+DE+ D S +  ++++++
Sbjct: 491 DLSADLSRFGLSIENFGGNSIVVRETPAILGEVNAKSLILDILDELKDWSESNLIKEKLD 550

Query: 535 NILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            IL+ +AC+GSIRSGR M+  EMN LLREME  P+S QCNHGRPT++KLKLSDIEKLFGR
Sbjct: 551 AILSRVACHGSIRSGRIMKGEEMNALLREMEITPHSGQCNHGRPTYVKLKLSDIEKLFGR 610


>gi|225075177|ref|ZP_03718376.1| hypothetical protein NEIFLAOT_00177 [Neisseria flavescens
           NRL30031/H210]
 gi|224953352|gb|EEG34561.1| hypothetical protein NEIFLAOT_00177 [Neisseria flavescens
           NRL30031/H210]
          Length = 658

 Score =  541 bits (1394), Expect = e-151,   Method: Composition-based stats.
 Identities = 216/658 (32%), Positives = 343/658 (52%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPTQS----LHERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAIN--------------------------KKGIST 333
           HP K+ IRFR+   +   +  ++ KA+                           +     
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVVSTQMPSEN 358

Query: 334 SSVLSKKMISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTNDLLP 383
            S       S++   N P          KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DSENLFDSASNYPTGNKPDTRNAFGASGKTAPMPYQAARAPQQRSLSLRESRAAMNTYAE 418

Query: 384 SDDPT-----------YSEDNDPVEESEATH---------------YQLGIACAQIHQNY 417
               T            +   +   E+                     LG A AQ+   Y
Sbjct: 419 LYKKTDDIDLELNRLEQARFGNMPSETPTPKTDAPLSDGIPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++       + SQ LL P        ECA + +H
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQRLLIPVTFAASHEECAALADH 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R +PA+L K ++  L +D+++E+    ++ T+++    I
Sbjct: 539 AETLAGFGLELSDMGGNTLAVRAVPAMLGKSDVVSLAKDVLNELAQVGSSQTIEEHENRI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|83748955|ref|ZP_00945964.1| MutL [Ralstonia solanacearum UW551]
 gi|207744182|ref|YP_002260574.1| dna mismatch repair protein mutl [Ralstonia solanacearum IPO1609]
 gi|83724378|gb|EAP71547.1| MutL [Ralstonia solanacearum UW551]
 gi|206595587|emb|CAQ62514.1| dna mismatch repair protein mutl [Ralstonia solanacearum IPO1609]
          Length = 647

 Score =  541 bits (1394), Expect = e-151,   Method: Composition-based stats.
 Identities = 199/639 (31%), Positives = 326/639 (51%), Gaps = 53/639 (8%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            IR L +++I+QIAAGE++ERP+  +KEL+EN+LDA +++++  +  GG     ITDNG 
Sbjct: 14  PIRPLPDQLISQIAAGEVVERPASVVKELLENALDAGATQLQIKLEEGGVRRIAITDNGG 73

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +E+P+A+ RH TSKI   ++  ++ T GFRGEAL SI +V+ LTL SR        
Sbjct: 74  GIPVDELPVALMRHATSKIGSLEELESVATLGFRGEALASIASVAELTLTSRTADAAHAT 133

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI     ++   +P +   GT V+V+ L+F  PAR  FLKSEQ E     +VIRR A+A 
Sbjct: 134 QILAQSGRL---QPASGGVGTTVDVQHLYFNTPARRKFLKSEQTELGHCLEVIRRTALAR 190

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V+ +           N          R + V+G +F    +   E + E+ L G+ G+
Sbjct: 191 PDVAISVHHNGKPLEHWNA----AQADTRTAAVLGTEFARARLPFEEAAGELRLFGFAGL 246

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT +RG A+  + ++NGR V+D+ +   +R+AY + +   R+P  VL LE+ P  VDVNV
Sbjct: 247 PTASRGRADHQFFYVNGRFVRDRLLTHAVRSAYEDVLHGDRFPAYVLCLELPPEAVDVNV 306

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKM-----------ISSFHQD 348
           HP+K  +RFR+   +  F+  ++Q+A+ +        L   +                  
Sbjct: 307 HPSKIEVRFRDSRAVHQFVYHAVQRALARHAGEQGDSLRTDIADAADAPDAAGQPGTAAT 366

Query: 349 NAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSE----------------- 391
            AP  +  ++   +   Q  L + + R     ++                          
Sbjct: 367 PAPADNTTRWINQMAARQTSLGIAQPRSEYLAMMRGSSTPLPSSRPAWMADVPSAATLFD 426

Query: 392 ----------------DNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAH 435
                              P  +     + LG A AQ+H  Y+++Q   G+V+VD HAAH
Sbjct: 427 GAAANADEAPVQAPVPMATPQTDDADDAHPLGFAIAQLHGIYVLAQNARGMVLVDMHAAH 486

Query: 436 ERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAI 495
           ER+++E+++    + ++  Q LL P  +     E     E  + L  LG       P  +
Sbjct: 487 ERILYEQLKTALEARRVEVQPLLIPVTLAASPVEIGTAEEFRDTLTLLGFDISAVSPTTL 546

Query: 496 AIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSI 555
           A+R +P +L + +   L RD++ ++     +  L +R   +LAT+AC+ ++R+ R++   
Sbjct: 547 AVRAVPTLLQRADAQALARDMLRDLQAYGGSRVLAERQNELLATLACHSAVRANRRLNLD 606

Query: 556 EMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           EMN LLR+ME    + QCNHGRPT+I+L ++D+++LF R
Sbjct: 607 EMNALLRQMEATERADQCNHGRPTWIQLTVADLDRLFLR 645


>gi|326387365|ref|ZP_08208974.1| DNA mismatch repair protein MutL [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326208021|gb|EGD58829.1| DNA mismatch repair protein MutL [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 618

 Score =  541 bits (1393), Expect = e-151,   Method: Composition-based stats.
 Identities = 221/613 (36%), Positives = 348/613 (56%), Gaps = 24/613 (3%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E ++N+IAAGE++ERP+ A+KEL+EN++DA ++ V   ++ GG S  ++TD+G G
Sbjct: 8   IRRLPEHLVNRIAAGEVVERPASALKELVENAIDAGATHVSVRLSEGGLSLIEVTDDGCG 67

Query: 63  MTSEEIPMAVQRHCTSKISDDF-------SNIHTFGFRGEALPSIGAVSHLTLMSRPPQN 115
           M ++E+ +A++RH TSK+ +           + T GFRGEALPSI +V+ LT+ SR  + 
Sbjct: 68  MRADEMALALERHATSKLPESLIGEESALERVITLGFRGEALPSIASVARLTIESRSRET 127

Query: 116 NTGAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRM 175
               +  +    +    P A+ PGT V V DLF  +PAR  FL+S + E     DV+RR+
Sbjct: 128 GEAWKRVVDHGDLVGDGPAALPPGTRVRVEDLFGRVPARRKFLRSARSEWAAALDVVRRL 187

Query: 176 AIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQG 235
           A+A P + FT         ++           R++Q++  D I+N+V ++    +  L G
Sbjct: 188 AMARPDIGFTLEHDGRRALQVQ---PGERLDMRVAQLVSRDLISNSVAVDLVRGDYHLIG 244

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
             G+PT+NRG A+  Y+F+NGR V+D+ +L  +R AYA+ +   R+ V+ L L +   +V
Sbjct: 245 VAGLPTYNRGVADHQYLFVNGRPVRDRLLLGAVRGAYADMLARDRHAVLALFLTLPAEEV 304

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH------QDN 349
           DVNVHPAK+ +RFR+  ++R  I+  +++A+++    ++       + ++        + 
Sbjct: 305 DVNVHPAKTEVRFRDSALVRGMIVSGLRQALSEGDRRSAQAPDATAMQAWQVEPVAAPEP 364

Query: 350 APKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTY-------SEDNDPVEESEAT 402
                 P  +        +      RL    +                 +       E  
Sbjct: 365 VFSPVPPVQSNLFARPASRPAYVPQRLGEAGVAWRGYEAEVMALPEARAEPATAPVPEGE 424

Query: 403 HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLT-PE 461
            + LG+A  QI + YI+++  DGLVIVDQHAAHERL+ E++R             L  PE
Sbjct: 425 AHPLGVARGQIGKTYIVAEAADGLVIVDQHAAHERLVLERLRAAGAGEGDAPAQALLLPE 484

Query: 462 IIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEII 521
           +++L E +C  + E   +L R G+  ERFGP A+ IR +PA+L K +   L+RD+ D++ 
Sbjct: 485 VVELDEVDCDRLEEAAHELARFGLILERFGPGAVLIRSVPAMLGKGDPQALVRDVADDLA 544

Query: 522 DSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFI 581
            +  T  + +R++ +LATMAC+GS+R+GR +   EMN LLREME+ P S QCNHGRPT++
Sbjct: 545 RNGATLLVGERLDLVLATMACHGSVRAGRVLSVPEMNALLREMEETPRSGQCNHGRPTWV 604

Query: 582 KLKLSDIEKLFGR 594
           KL   DIEKLFGR
Sbjct: 605 KLAHGDIEKLFGR 617


>gi|90419989|ref|ZP_01227898.1| DNA mismatch repair protein MutL [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336030|gb|EAS49778.1| DNA mismatch repair protein MutL [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 621

 Score =  541 bits (1393), Expect = e-151,   Method: Composition-based stats.
 Identities = 261/621 (42%), Positives = 389/621 (62%), Gaps = 28/621 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I++LS+ +I+QIAAGE++ERP+  +KEL+EN+LDA + R+E   AGGGK+  +I+D+G
Sbjct: 1   MPIQQLSDALIDQIAAGEVVERPASVVKELVENALDAGARRIEIATAGGGKNLIRISDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ + EIP+AV+RHCTSK++     I T GFRGEALPSIG+V  L+L SR   ++   +
Sbjct: 61  CGIPAAEIPLAVRRHCTSKLAGGLDAIGTLGFRGEALPSIGSVGRLSLKSRAAGSDEAYE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I +   + S +RP A++ GT++EVRDLF  +PARL FLKS++ E++ IT+++RR+AIA+P
Sbjct: 121 ICVEAGRPSELRPTALSRGTVIEVRDLFHAVPARLKFLKSDRAESSAITEIVRRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V F  S              +   P  I+ V+  DF +NA+ ++    ++ L+G+ GIP
Sbjct: 181 GVRFELSGPDRTTTVFEAVPGDAPLPR-IADVLTPDFADNAIPVDAMREDVRLRGFAGIP 239

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           T+NRGN  Q + ++NGR V+DK + S +R AYA+ +   R+PV VL LE+DP  VDVNVH
Sbjct: 240 TYNRGNGQQQFFYVNGRPVRDKTLHSALRGAYADVLARDRHPVAVLFLELDPALVDVNVH 299

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSV----LSKKMISSFHQDNAPKTHLP 356
           PAK+ +RFR+P ++R  I+ S+++A N+ G+ +++     L  +   +   + AP T  P
Sbjct: 300 PAKADVRFRDPGLVRGLIVGSLRQAFNEAGLRSATTNSSGLMARFRGAAPAEPAPVTPAP 359

Query: 357 KYATSLTNTQEKLFLQENRLSTNDLLPSDDP-----------------------TYSEDN 393
           +              Q    +        D                           +  
Sbjct: 360 RRFDGFAPGGFAAPRQAAYAAEASPYRPLDMGAGATTLDRGPDAGSPAQAPVAIAAPDTE 419

Query: 394 DPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKIT 453
              + +  + + LG A AQ H+N+I+S+T DG+VIVDQHAAHERL++E ++   +   + 
Sbjct: 420 SAEDAANGSDHPLGAAKAQFHRNFIVSETEDGIVIVDQHAAHERLVYEALKTALHGRPLA 479

Query: 454 SQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLL 513
           SQ LL PEI+DL E +   + E  E   RLG+  ERFGP A+A+RE PAIL   +  +L+
Sbjct: 480 SQLLLIPEIVDLPEDDVDRLAEQAETFARLGLGIERFGPGAVAVRETPAILGSVDCQRLM 539

Query: 514 RDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQC 573
           RD+ DE+ ++ T   ++ RI+++ AT+AC+GS+RSGR M+  EMN LLR+ME  P S QC
Sbjct: 540 RDLADELAEAGTADAVRGRIDHVAATIACHGSVRSGRLMKPEEMNALLRDMEATPGSGQC 599

Query: 574 NHGRPTFIKLKLSDIEKLFGR 594
           NHGRPTFI+LKL+DIEK+FGR
Sbjct: 600 NHGRPTFIELKLADIEKMFGR 620


>gi|319403683|emb|CBI77268.1| DNA mismatch repair protein MutL [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 612

 Score =  540 bits (1392), Expect = e-151,   Method: Composition-based stats.
 Identities = 269/612 (43%), Positives = 393/612 (64%), Gaps = 19/612 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  +KELIEN++DA +SR+E VIA GGKS  +++DNG
Sbjct: 1   MIIRHLSETIINQIAAGEVIERPANVVKELIENAIDAGASRIEIVIANGGKSLIRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+  +++ +A+ RHCTSKI+DD  NI   GFRGEALPSIG+VS L L SR   +++ A+
Sbjct: 61  CGIPEDQLTLAISRHCTSKITDDVHNICFLGFRGEALPSIGSVSKLKLTSRTKNSDSAAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ++  KI   +P A NPGTIVEVRDLFF  PARL F+KS++ ET  ITD I+R+AIA+P
Sbjct: 121 IIVNAGKIEGPKPSAANPGTIVEVRDLFFVTPARLKFMKSDRSETITITDTIKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGN-FPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ + I     +      N     +RI+Q++G++F  N++ L+ K   + L G+ G+
Sbjct: 181 HIRFSLAGIDRAPMEFPAMEQNTQGQLQRITQIMGKEFAPNSLILDAKRESVHLTGFIGL 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNR N+   + ++NGR V+DK +   IR AYA+ I   R+ V +L + + P  VDVNV
Sbjct: 241 PSFNRSNSLHQFAYVNGRPVRDKLLWGAIRGAYADVIARDRHAVAILFIHLPPTDVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HPAK  +RFR+P++IR  II +I++A+++ GI  +S  S+ M+++F  +      + +  
Sbjct: 301 HPAKMDVRFRDPSLIRGLIIGAIREALHQTGIRPTSTGSEAMLAAFRTEPLETAKMHQPF 360

Query: 360 TSLTNTQ-----------------EKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEAT 402
           +     +                   +  QE+ +   + L +         + +  SE  
Sbjct: 361 SYDARPRHIDPNLTSIFHKPLDINSSIDFQEDTVPIMEHLSTPSGDTRATINALT-SEEL 419

Query: 403 HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEI 462
           HY LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++    S  + SQ LL PEI
Sbjct: 420 HYPLGAARAQIHKNYIVAQTQDSLVIVDQHAAHERLVYEALKNALYSKPLPSQLLLIPEI 479

Query: 463 IDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIID 522
           ++L E +   ++ H + L + G+  E FG  AIA+ E P++L + N+  L++D+ DE  +
Sbjct: 480 VELSEEDATCLLSHKDALKKFGLGIESFGIGAIAVHETPSMLGEINVQALIKDLADEAAE 539

Query: 523 SSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIK 582
             T   L+  ++ + ATMAC+ SIRSGR +   EMN LLR++E  PNS+ CNHGRPT+I+
Sbjct: 540 YDTIDNLKGMLDYVAATMACHSSIRSGRLLHPEEMNALLRQIEATPNSATCNHGRPTYIE 599

Query: 583 LKLSDIEKLFGR 594
           LKL+DIE+LFGR
Sbjct: 600 LKLADIERLFGR 611


>gi|261380220|ref|ZP_05984793.1| DNA mismatch repair protein MutL [Neisseria subflava NJ9703]
 gi|284797072|gb|EFC52419.1| DNA mismatch repair protein MutL [Neisseria subflava NJ9703]
          Length = 658

 Score =  540 bits (1392), Expect = e-151,   Method: Composition-based stats.
 Identities = 212/658 (32%), Positives = 341/658 (51%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATTIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDSKQVFKLPAQS----LHERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNTLTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRF +   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFHDSQQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLP 383
                   +++     K  +      + KT    Y  S    Q  L L+E+R + N    
Sbjct: 359 NSENLFDSASNYPTGNKPDTRNAFGPSGKTAPMPYQASRAPQQRSLSLRESRAAMNTYAE 418

Query: 384 SDDPTYSEDNDPVEESEATHYQL--------------------------GIACAQIHQNY 417
               T   D +  +  +A    +                          G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSQFEQACFGNMPSETPTPQTDTPLSDGLPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM+        + SQ LL P        ECA + +H
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKLQRQENGNLQSQRLLIPVTFAASHEECASLADH 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++   +I
Sbjct: 539 AETLAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLGELAQVGSSQTIEEHENHI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSVRAGRQLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|121635130|ref|YP_975375.1| DNA mismatch repair protein [Neisseria meningitidis FAM18]
 gi|166232098|sp|A1KUP6|MUTL_NEIMF RecName: Full=DNA mismatch repair protein mutL
 gi|120866836|emb|CAM10594.1| DNA mismatch repair protein [Neisseria meningitidis FAM18]
 gi|325132377|gb|EGC55070.1| DNA mismatch repair protein MutL [Neisseria meningitidis M6190]
 gi|325138442|gb|EGC61008.1| DNA mismatch repair protein MutL [Neisseria meningitidis ES14902]
 gi|325198576|gb|ADY94032.1| DNA mismatch repair protein MutL [Neisseria meningitidis G2136]
          Length = 658

 Score =  540 bits (1392), Expect = e-151,   Method: Composition-based stats.
 Identities = 217/658 (32%), Positives = 344/658 (52%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSEATEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGDDFQTASLEIDSDNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKG--------------ISTSSVLSKKMISSF 345
           HP K+ IRFR+   +   +  ++ KA+                     + V    M S  
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 346 HQDN----------------------APKTHLPKYATSLTNTQEKLFLQENRLSTNDLLP 383
           + +N                      + KT    Y ++    Q  L L+E+R + N    
Sbjct: 359 NSENLFDRASNYPTGNKSDTHNAFGSSGKTAPMPYQSAYAPQQRSLSLRESRAAMNTYAE 418

Query: 384 SDDPT-----------YSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
               T            +   +   E+ A                    G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSRFEQARFGNMPSETPAPQTDTPLSDGIPSPSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++       + SQ LL P        ECA + +H
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQRLLIPVTFAASHEECAALADH 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R  PA+L K ++  L RD+++E     ++ T+++   +I
Sbjct: 539 AEALAGFGLELSDMGGNTLAVRAAPAMLGKSDVVSLARDVLNEFAQVGSSQTIEEHENHI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|91775737|ref|YP_545493.1| DNA mismatch repair protein MutL [Methylobacillus flagellatus KT]
 gi|91709724|gb|ABE49652.1| DNA mismatch repair protein MutL [Methylobacillus flagellatus KT]
          Length = 613

 Score =  540 bits (1392), Expect = e-151,   Method: Composition-based stats.
 Identities = 201/615 (32%), Positives = 329/615 (53%), Gaps = 25/615 (4%)

Query: 1   MK-IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDN 59
           M  I+ L +++I+QIAAGE++ERP+ A+KE++ENSLDA S+ V   +  GG    ++TDN
Sbjct: 1   MPSIKLLPDQLISQIAAGEVVERPASALKEILENSLDAGSTDVAVALQAGGIKQIKVTDN 60

Query: 60  GFGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNT 117
           G G+  +E+ +A+ RH TSKI+  +D   + + GFRGEAL SI A+S   + S  P    
Sbjct: 61  GGGIARDELRLALTRHATSKIASLEDLECVASLGFRGEALASIAAISRTQITSYHPDERH 120

Query: 118 GAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
             +IA  G  ++ + P A++ GTIV+++DL+F  PAR  FLK+E  E     +  RR+A+
Sbjct: 121 AWRIASEGSFLTDIEPAALDAGTIVDIQDLYFNTPARRKFLKTENTEFGHCEEAFRRIAL 180

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           + P V+           ++   S +  F + +    G++F   A  L+E +  + + G  
Sbjct: 181 SCPDVNMLLQHNGRAVARLAAGSADKRFEDIL----GQEFAAEAFYLDEVAAGLRVWGMA 236

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
             PTF+R   +  YV++NGR V+DK I   IR AY + +   R+P  VL LE+DP  VDV
Sbjct: 237 AKPTFSRHARDTQYVYVNGRFVRDKLISHAIRQAYQDVLHHDRHPAFVLFLELDPALVDV 296

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPK 357
           NVHP+K+ +RFR+   +  FI  ++ K++        S++            A     P+
Sbjct: 297 NVHPSKTEVRFRDGQSVHRFIFHALHKSLATPVGLPGSLMPGLATGEKAAAPAQAPSYPR 356

Query: 358 YATSLTNTQEKL--------------FLQENRLSTNDLLPSDDPTYSEDNDPVEESEATH 403
           + +++     +                 Q    S +D++ +   + +       + E   
Sbjct: 357 FQSNIDLRASEASGGFYQALFGNLSQVPQRQAESADDVITAQSTSVATAMGEGGQVEVED 416

Query: 404 YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEII 463
           + LG A AQIH  YI++Q   GL++VD HAAHER+++EK++   +++++  Q LL P   
Sbjct: 417 FPLGFAVAQIHGVYILAQNKLGLIVVDMHAAHERIMYEKLKNALDASRVAMQPLLLPVSF 476

Query: 464 DLLEGECALIMEHDED----LHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDE 519
                E A + E        L +LG       P  +A+R IP +L   +   L RD++ +
Sbjct: 477 QADRLEVATVEEQQALAENGLAQLGFDIAVLSPTTLAVRAIPVMLKDADAVALARDVLAD 536

Query: 520 IIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPT 579
           +     +    +R   +L TMAC+ ++R+ R +   EMN LLR+ME    S QCNHGRPT
Sbjct: 537 LRQYGASRAFTERRNALLGTMACHAAVRANRTLTIPEMNALLRDMEATERSGQCNHGRPT 596

Query: 580 FIKLKLSDIEKLFGR 594
           + ++ + +++K+F R
Sbjct: 597 WFQMTMGELDKMFMR 611


>gi|149184476|ref|ZP_01862794.1| DNA mismatch repair enzyme [Erythrobacter sp. SD-21]
 gi|148831796|gb|EDL50229.1| DNA mismatch repair enzyme [Erythrobacter sp. SD-21]
          Length = 600

 Score =  540 bits (1391), Expect = e-151,   Method: Composition-based stats.
 Identities = 219/602 (36%), Positives = 352/602 (58%), Gaps = 11/602 (1%)

Query: 1   MK-IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDN 59
           M  IR+L + ++N+IAAGE++ERPS A+KEL+EN++DA +SR+   +  GG +  ++TD+
Sbjct: 1   MPEIRRLPDTLVNRIAAGEVVERPSSALKELVENAIDAGASRIAVKLVEGGLTSLEVTDD 60

Query: 60  GFGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
           G GM  +E+ +A++RH TSK+ D+    + T GFRGEALPSI +V+  TL SRP     G
Sbjct: 61  GCGMNPDEMALALERHATSKLPDEAIEQVATLGFRGEALPSIASVARFTLESRPRGAEQG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +  +   ++ +  P A+ PGT V V +LF  IPAR  FL++ + E     DV++R+A+A
Sbjct: 121 WKRVVDHGELVAEGPAALPPGTRVRVENLFAKIPARRKFLRTPRSEYAACLDVVKRLAMA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P V+ T          +           R++QV+  +   N V ++     + L G  G
Sbjct: 181 RPDVAITLDHGDRRILGLQ---GGEGLANRVAQVVARELKENGVAIDLDRGTMRLTGIAG 237

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PT+NRG A+  Y+F+NGR V+D+ +   +R AY++ +   R+ V+ L L + P  VDVN
Sbjct: 238 LPTYNRGIADHQYLFVNGRPVKDRLLTGAVRGAYSDMLARDRHAVLALFLVLPPEMVDVN 297

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHPAK+ +RFR+   +R FI+  ++ A+      ++       +S + Q+   +   P  
Sbjct: 298 VHPAKTEVRFRDSQAVRGFIVSGLRNALATGDKRSAQTPDASAMSRWQQEPVREEPAPAL 357

Query: 359 AT-----SLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQI 413
            +       +  Q ++          +     +P    +      +    Y LG+A  Q+
Sbjct: 358 RSIFEGRDWSTPQTRVSEAGAAWRGYEAEVMAEPRGRAEEAAPAPAAEQDYPLGVARGQV 417

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKIT-SQTLLTPEIIDLLEGECAL 472
              YI+++  DGLV+VDQHAAHERL+ E+++       +  SQ LL PE+++L E  C  
Sbjct: 418 ANTYIVAEAKDGLVLVDQHAAHERLVLERLKAAGAEEAVARSQALLIPEVVELEETSCDR 477

Query: 473 IMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDR 532
           + E  + L + G+  ERFGP+A+ +R +P  +++ +  +LLRDI D++  +     L ++
Sbjct: 478 LEEAADTLAKHGLAIERFGPSAMLVRSLPHAIARTDPEKLLRDIDDDLALNGEALHLGEK 537

Query: 533 IENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLF 592
           ++ +LATMAC+GS+R+GR ++  EMN LLREME+ P S QCNHGRPT++KL + D+EKLF
Sbjct: 538 LDLVLATMACHGSVRAGRTLRVDEMNALLREMERTPRSGQCNHGRPTWVKLSMEDVEKLF 597

Query: 593 GR 594
           GR
Sbjct: 598 GR 599


>gi|189030396|sp|A9KE32|MUTL_COXBN RecName: Full=DNA mismatch repair protein mutL
          Length = 574

 Score =  540 bits (1391), Expect = e-151,   Method: Composition-based stats.
 Identities = 213/596 (35%), Positives = 327/596 (54%), Gaps = 26/596 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L+++  NQIAAGE++ERP+  +KELIENS+DA +S +   I  GG    +I D+G
Sbjct: 1   MYIRRLNDQTANQIAAGEVVERPASVVKELIENSIDAHASCIRVDILQGGAKQIRIQDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  E++ +A++RH TSKI+  DD  +I T GFRGEAL SI AVS LTL SR      G
Sbjct: 61  DGIHPEDLVLALERHATSKIAKIDDLQDITTLGFRGEALASISAVSRLTLTSRQKNAEMG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +I+    KI +  P A   GT ++V+DLF+  PAR  FL+S   E   I  +I R+A++
Sbjct: 121 YRISNISHKIMTPVPAAHPQGTTIDVQDLFYNTPARRKFLRSPATEFQHIRRIIERLALS 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +    F     +         +T      RI  ++G+ F+ +A+ +    + +TL+GY  
Sbjct: 181 HFTTEFLLHHNEKEIIHFKSATTISGQENRIKSILGDVFMQSALAIEFSQSGLTLKGYIA 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
              + R   +  Y+++NGR V+DK I   +R AY + +  GR+P  VL LEIDP  VD+N
Sbjct: 241 EAAYTRSQPDLQYIYVNGRFVRDKLIAQALRQAYHDVLFHGRHPAYVLYLEIDPAFVDIN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RFR+P  +R+F+I +++ A+ +     +  L +         N   T L + 
Sbjct: 301 VHPTKHEVRFRDPQWVRDFLIHAVKTALAQAKPGIAHPLPQSTAEYNPITNFAPTPLIEG 360

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYI 418
             +L+  QE+       +                           + LG A AQ+   YI
Sbjct: 361 QGNLSLIQEQPAPYTQTI------------------------VHKHPLGHALAQLQGIYI 396

Query: 419 ISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDE 478
           +SQ   GLVIVD HAAHER+++EKM++      +  Q+LL P  + L   E      +  
Sbjct: 397 LSQNEKGLVIVDMHAAHERILYEKMKKQLAEVGLAMQSLLVPINLSLNPQEITAWQTNKA 456

Query: 479 DLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILA 538
              RLG + E FGP+ I +R  P++L  KN+  L+RD++ ++I  +TT  + +RI   LA
Sbjct: 457 LFARLGFEIESFGPDKIVVRRHPSLLKPKNLENLIRDVLADLITHNTTSRVGERINAALA 516

Query: 539 TMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           T+AC+ ++R+   +   EM  LLREMEK  +   CNHGRPT+ +  +++++  F R
Sbjct: 517 TLACHAALRAPHYLTIEEMEALLREMEKTEHGGLCNHGRPTWKQFDIAELDTFFLR 572


>gi|126729914|ref|ZP_01745726.1| DNA mismatch repair protein [Sagittula stellata E-37]
 gi|126709294|gb|EBA08348.1| DNA mismatch repair protein [Sagittula stellata E-37]
          Length = 629

 Score =  540 bits (1390), Expect = e-151,   Method: Composition-based stats.
 Identities = 254/622 (40%), Positives = 385/622 (61%), Gaps = 29/622 (4%)

Query: 1   MK--IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITD 58
           M+  IR+L +  +N+IAAGE++ERP+ A+KEL+EN++DA + RV   IA GGK+  ++TD
Sbjct: 8   MRPVIRQLDDAAVNRIAAGEVVERPASAVKELVENAIDAGARRVGIEIADGGKTLIRVTD 67

Query: 59  NGFGMTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNT 117
           +G GMT  E+P+A+ RH TSKI   D  +IH+FGFRGEALPS+GAV  L+L SR     +
Sbjct: 68  DGCGMTGAELPLALSRHATSKIDGTDLLDIHSFGFRGEALPSLGAVGRLSLQSRVRG-ES 126

Query: 118 GAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           G ++++ G  +S+V+P A+N GT+V +RDLF+  PARL FL++++ ET  I+D ++R+A+
Sbjct: 127 GVELSVEGGVMSAVKPCALNGGTVVTLRDLFYATPARLKFLRTDRAETQAISDTVKRLAM 186

Query: 178 AYPKVSFTFS--TIKSNRYKMNFQSTNGNFPERIS----QVIGEDFINNAVELNEKSNEI 231
           A P V FT    +   +R     +   G+  + +     +++G +F +NA+ +  +    
Sbjct: 187 AEPAVGFTLRDVSGGGDRVTFRVEPETGDLFDALRGRLTRIMGAEFTDNALAVEAEREGF 246

Query: 232 TLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEID 291
            L GY  +PT++RG A   Y+F+NGR V+DK ++  +R AY + +   R+P V L ++ D
Sbjct: 247 RLTGYAALPTYSRGTAVAQYLFVNGRPVRDKMLIGALRGAYHDFLSRERHPAVALFVDCD 306

Query: 292 PRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAP 351
           P +VDVNVHPAKS +RFR+P ++R  I+ +++ A+ + G   SS ++   + +   +  P
Sbjct: 307 PHKVDVNVHPAKSEVRFRDPGVVRGLIVSTLRHALAEAGHRASSTVAAATLGAMRPEAGP 366

Query: 352 KTHLPKY-ATSLTNTQEKLFLQENRLSTNDLL------------------PSDDPTYSED 392
                                Q +R S                        S     +  
Sbjct: 367 AYAPNAPLGAGPEPVSGPRVYQMDRPSLGARAAAYRAQAPAPGFADLGESYSGRVVETAP 426

Query: 393 NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI 452
                  + T   LG A  Q+H+NYII+QT DG+VIVDQHAAHERL++EK+++      +
Sbjct: 427 VAEAPAEDVTRRPLGAARGQVHENYIIAQTEDGVVIVDQHAAHERLVYEKLKRQMAENGV 486

Query: 453 TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQL 512
            +Q LL P+++DL   + A ++   +DL R+G+  E FG  AIA+RE PAIL + +   L
Sbjct: 487 PAQALLIPDVVDLSADDAARLLAVADDLSRMGLTVEPFGAGAIAVRETPAILGEVDSQGL 546

Query: 513 LRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQ 572
           +RDI+DE+ D   T  +Q++IE IL+ +AC+GSIRSGR M++ EMN LLREME  P+S Q
Sbjct: 547 IRDILDELDDMGETSLVQEKIEAILSRVACHGSIRSGRVMRAEEMNALLREMEATPHSGQ 606

Query: 573 CNHGRPTFIKLKLSDIEKLFGR 594
           CNHGRPT+++LKLSDIE+LFGR
Sbjct: 607 CNHGRPTYVELKLSDIERLFGR 628


>gi|212212503|ref|YP_002303439.1| DNA mismatch repair protein [Coxiella burnetii CbuG_Q212]
 gi|226723030|sp|B6J016|MUTL_COXB2 RecName: Full=DNA mismatch repair protein mutL
 gi|212010913|gb|ACJ18294.1| MutL [Coxiella burnetii CbuG_Q212]
          Length = 575

 Score =  540 bits (1390), Expect = e-151,   Method: Composition-based stats.
 Identities = 212/596 (35%), Positives = 328/596 (55%), Gaps = 26/596 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L+++  NQIAAGE++ERP+  +KELIENS+DA +S +   I  GG    +I D+G
Sbjct: 2   MYIRRLNDQTANQIAAGEVVERPASVVKELIENSIDAHASCIRVDILQGGAKQIRIQDDG 61

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  E++ +A++RH TSKI+  DD  ++ T GFRGEAL SI AVS LTL SR      G
Sbjct: 62  DGIHPEDLVLALERHATSKIAKIDDLQDVTTLGFRGEALASISAVSRLTLTSRQKNAEMG 121

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +I+    KI +  P A   GT ++V+DLF+  PAR  FL+S   E   I  +I R+A++
Sbjct: 122 YRISNISHKIMTPVPAAHPQGTTIDVQDLFYNTPARRKFLRSPATEFQHIRRIIERLALS 181

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +    F     +         +T      RI  ++G+ F+ +A+ +    + +TL+GY  
Sbjct: 182 HFTTEFLLHHNEKEIIHFKSATTISGQENRIKSILGDVFMQSALAIEFSQSGLTLKGYIA 241

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
              + R   +  Y+++NGR V+DK I   +R AY + +  GR+P  VL LEIDP  VD+N
Sbjct: 242 EAAYTRSQPDLQYIYVNGRFVRDKLIAQALRQAYHDVLFHGRHPAYVLYLEIDPAFVDIN 301

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RFR+P  +R+F+I +++ A+ +     +  L +         N   T L + 
Sbjct: 302 VHPTKHEVRFRDPQWVRDFLIHAVKTALAQTKPGIAHPLPQSTAEYNPITNFAPTPLIEG 361

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYI 418
             +L+  QE+       +                           + LG A AQ+   YI
Sbjct: 362 QGNLSLIQEQPAPYTQTI------------------------VHKHPLGHALAQLQGIYI 397

Query: 419 ISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDE 478
           +SQ   GLVIVD HAAHER+++EKM++      +  Q+LL P  + L   E      +  
Sbjct: 398 LSQNEKGLVIVDMHAAHERILYEKMKKQLAEVGLVMQSLLVPINLSLNPQEITAWQTNKA 457

Query: 479 DLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILA 538
              RLG + E FGP+ I +R  P++L  KN+  L+RD++ ++I  +TT  + +RI  +LA
Sbjct: 458 LFARLGFEIESFGPDKIVVRRHPSLLKPKNLENLIRDVLADLITHNTTSRVGERINAVLA 517

Query: 539 TMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           T+AC+ ++R+   +   EM  LLREMEK  +   CNHGRPT+ +  +++++  F R
Sbjct: 518 TLACHAALRAPHYLTIEEMEALLREMEKTEHGGLCNHGRPTWKQFDIAELDTFFLR 573


>gi|261364762|ref|ZP_05977645.1| DNA mismatch repair protein MutL [Neisseria mucosa ATCC 25996]
 gi|288567069|gb|EFC88629.1| DNA mismatch repair protein MutL [Neisseria mucosa ATCC 25996]
          Length = 664

 Score =  540 bits (1390), Expect = e-151,   Method: Composition-based stats.
 Identities = 218/664 (32%), Positives = 352/664 (53%), Gaps = 75/664 (11%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ +E  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIEVELAGGGIRLIRVSDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   +    
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQDGSAHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++GEDF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGEDFQAVSLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK-------------------KGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                      GI  ++  S+ 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRADLTESVGNAGEVLHEITGIRPAATSSEN 358

Query: 341 MISSFHQDNA----------PKTHLPKYATSLTN--------------TQEKLFLQENRL 376
             + F Q+            P TH+ +   S ++               Q  L L+E+R 
Sbjct: 359 EHNQFLQNPTASSETIFAAVPNTHVSEPRNSFSSGKIAPMPYQAARAPQQRSLSLRESRA 418

Query: 377 STNDLLPSDDPTYSEDND-------------------------PVEESEATHYQLGIACA 411
           + N        T +++ D                           ++ +     LG A A
Sbjct: 419 ALNTYAELFKNTAADEADIELAQFEQARFGSTSATSSETPAHTFSDDPKPELPPLGFAIA 478

Query: 412 QIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGEC 470
           Q+   YI++Q  D L+++D HAA ER+ +EKM++       + SQ LL P        EC
Sbjct: 479 QLLGIYILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQRLLIPVTFAASHEEC 538

Query: 471 ALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQ 530
           A + +H + L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T++
Sbjct: 539 ATLADHADTLAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLGELAQVGSSQTIE 598

Query: 531 DRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEK 590
           +   +ILATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ 
Sbjct: 599 EHENHILATMSCHGSVRAGRQLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDA 658

Query: 591 LFGR 594
           LF R
Sbjct: 659 LFLR 662


>gi|329889971|ref|ZP_08268314.1| DNA mismatch repair protein MutL family protein [Brevundimonas
           diminuta ATCC 11568]
 gi|328845272|gb|EGF94836.1| DNA mismatch repair protein MutL family protein [Brevundimonas
           diminuta ATCC 11568]
          Length = 640

 Score =  540 bits (1390), Expect = e-151,   Method: Composition-based stats.
 Identities = 233/639 (36%), Positives = 369/639 (57%), Gaps = 45/639 (7%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L  + +N+IAAGE++ERP+ AIKEL+EN++DA++  +E    GGG +   I D+G
Sbjct: 1   MTIRRLPPETVNRIAAGEVVERPASAIKELVENAIDADARSIEIQADGGGLTRILIADDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD------FSNIHTFGFRGEALPSIGAVSHLTLMSR--- 111
            G+  +E+P+A++RH TSK+  D         I T GFRGEALPSIG+V+ L + +R   
Sbjct: 61  KGIPRDELPVAIERHATSKLEPDDAGDVDLLRIFTLGFRGEALPSIGSVARLNITTRARA 120

Query: 112 ----PPQNNTGAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNL 167
               P  +     +    ++  S        G  VEVRDLF+  PARL F+KSE+ E   
Sbjct: 121 ETGQPQNDAWAISVEGGAQRPLSPAAFPGPHGARVEVRDLFYATPARLKFMKSERAEAMA 180

Query: 168 ITDVIRRMAIAYPKVSFTFSTIKSNRYKMNF-QSTNGNFPERISQVIGEDFINNAVELNE 226
           I++ I+R A+A+  V+FT +       ++      +    +R+  ++G DF  NA+ +++
Sbjct: 181 ISEEIKRQAMAHEAVAFTLTLDGKTTLRLPAEHPGDEGRLKRLGALLGRDFEANALLIDQ 240

Query: 227 KSNEITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVL 286
           + + + L GY G+PT++RGNA   ++F+NGR V+D+ +   +R AYA+ +   R+P   L
Sbjct: 241 ERDGVRLSGYAGLPTYSRGNAAHQFLFVNGRPVRDRLLQGALRGAYADFLARDRHPAAAL 300

Query: 287 LLEIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH 346
            ++IDP  VDVNVHPAK+ +RFR+P ++R  I+ +++ A++  G   S+ ++   +S F 
Sbjct: 301 FIDIDPLYVDVNVHPAKAEVRFRDPALVRGLIVGALRHALHAAGHRASTTVAADALSGFR 360

Query: 347 QDNAPKTHLPKYATSLTNTQEKLF----LQENRLSTNDLLPSDDPTYSEDNDPVEES--- 399
                  + P    + +N            +   +  +L   ++ +   ++    E+   
Sbjct: 361 PHTGDALYNPVAPQTFSNAAPGWSGWQGWSQPAAAAQNLPGLNERSARVEHTWSGEAAVP 420

Query: 400 ------------------------EATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAH 435
                                   +   Y LG A AQ+H NYI++QT DGLVIVDQHAAH
Sbjct: 421 SFRTLSEIQAEHAGQIAPGASAPVDLIDYPLGAARAQLHANYIVAQTRDGLVIVDQHAAH 480

Query: 436 ERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAI 495
           ERL++E+M+       +T Q LLTPE+++L   E   +    E+L  +G+  E FG  A+
Sbjct: 481 ERLVYERMKAQMADGAVTRQALLTPEVVELDPAEAERVAAKAEELAEMGLIVEAFGAGAV 540

Query: 496 AIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSI 555
            +RE PA+L   ++  L+RDI D++ +     +L++R+  +  TMAC+GS+RSGR + + 
Sbjct: 541 LVRETPALLGDTDVQGLIRDIADDLSEHGAALSLKERMAEVCGTMACHGSVRSGRVLSAP 600

Query: 556 EMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           EMN LLR+ME  P+S QCNHGRPT+++LKL D+EKLFGR
Sbjct: 601 EMNALLRQMEATPHSGQCNHGRPTYVELKLHDLEKLFGR 639


>gi|209363988|ref|YP_001424550.2| DNA mismatch repair protein [Coxiella burnetii Dugway 5J108-111]
 gi|207081921|gb|ABS76590.2| DNA mismatch repair protein [Coxiella burnetii Dugway 5J108-111]
          Length = 575

 Score =  540 bits (1390), Expect = e-151,   Method: Composition-based stats.
 Identities = 213/596 (35%), Positives = 327/596 (54%), Gaps = 26/596 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L+++  NQIAAGE++ERP+  +KELIENS+DA +S +   I  GG    +I D+G
Sbjct: 2   MYIRRLNDQTANQIAAGEVVERPASVVKELIENSIDAHASCIRVDILQGGAKQIRIQDDG 61

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  E++ +A++RH TSKI+  DD  +I T GFRGEAL SI AVS LTL SR      G
Sbjct: 62  DGIHPEDLVLALERHATSKIAKIDDLQDITTLGFRGEALASISAVSRLTLTSRQKNAEMG 121

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +I+    KI +  P A   GT ++V+DLF+  PAR  FL+S   E   I  +I R+A++
Sbjct: 122 YRISNISHKIMTPVPAAHPQGTTIDVQDLFYNTPARRKFLRSPATEFQHIRRIIERLALS 181

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +    F     +         +T      RI  ++G+ F+ +A+ +    + +TL+GY  
Sbjct: 182 HFTTEFLLHHNEKEIIHFKSATTISGQENRIKSILGDVFMQSALAIEFSQSGLTLKGYIA 241

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
              + R   +  Y+++NGR V+DK I   +R AY + +  GR+P  VL LEIDP  VD+N
Sbjct: 242 EAAYTRSQPDLQYIYVNGRFVRDKLIAQALRQAYHDVLFHGRHPAYVLYLEIDPAFVDIN 301

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RFR+P  +R+F+I +++ A+ +     +  L +         N   T L + 
Sbjct: 302 VHPTKHEVRFRDPQWVRDFLIHAVKTALAQAKPGIAHPLPQSTAEYNPITNFAPTPLIEG 361

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYI 418
             +L+  QE+       +                           + LG A AQ+   YI
Sbjct: 362 QGNLSLIQEQPAPYTQTI------------------------VHKHPLGHALAQLQGIYI 397

Query: 419 ISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDE 478
           +SQ   GLVIVD HAAHER+++EKM++      +  Q+LL P  + L   E      +  
Sbjct: 398 LSQNEKGLVIVDMHAAHERILYEKMKKQLAEVGLAMQSLLVPINLSLNPQEITAWQTNKA 457

Query: 479 DLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILA 538
              RLG + E FGP+ I +R  P++L  KN+  L+RD++ ++I  +TT  + +RI   LA
Sbjct: 458 LFARLGFEIESFGPDKIVVRRHPSLLKPKNLENLIRDVLADLITHNTTSRVGERINAALA 517

Query: 539 TMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           T+AC+ ++R+   +   EM  LLREMEK  +   CNHGRPT+ +  +++++  F R
Sbjct: 518 TLACHAALRAPHYLTIEEMEALLREMEKTEHGGLCNHGRPTWKQFDIAELDTFFLR 573


>gi|164685701|ref|ZP_01946749.2| DNA mismatch repair protein MutL [Coxiella burnetii 'MSU Goat
           Q177']
 gi|164601208|gb|EAX32616.2| DNA mismatch repair protein MutL [Coxiella burnetii 'MSU Goat
           Q177']
          Length = 574

 Score =  540 bits (1390), Expect = e-151,   Method: Composition-based stats.
 Identities = 213/596 (35%), Positives = 327/596 (54%), Gaps = 26/596 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L+++  NQIAAGE++ERP+  +KELIENS+DA +S +   I  GG    +I D+G
Sbjct: 1   MYIRRLNDQTANQIAAGEVVERPASVVKELIENSIDAHASCIRVDILQGGAKQIRIQDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  E++ +A++RH TSKI+  DD  +I T GFRGEAL SI AVS LTL SR      G
Sbjct: 61  DGIHPEDLVLALERHATSKIAKIDDLQDITTLGFRGEALSSISAVSRLTLTSRQKNAEMG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +I+    KI +  P A   GT ++V+DLF+  PAR  FL+S   E   I  +I R+A++
Sbjct: 121 YRISNISHKIMTPVPAAHPQGTTIDVQDLFYNTPARRKFLRSPATEFQHIRRIIERLALS 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +    F     +         +T      RI  ++G+ F+ +A+ +    + +TL+GY  
Sbjct: 181 HFTTEFLLHHNEKEIIHFKPATTISGQENRIKSILGDVFMQSALAIEFSQSGLTLKGYIA 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
              + R   +  Y+++NGR V+DK I   +R AY + +  GR+P  VL LEIDP  VD+N
Sbjct: 241 EAAYTRSQPDLQYIYVNGRFVRDKLIAQALRQAYHDVLFHGRHPAYVLYLEIDPAFVDIN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RFR+P  +R+F+I +++ A+ +     +  L +         N   T L + 
Sbjct: 301 VHPTKHEVRFRDPQWVRDFLIHAVKTALAQAKPGIAHPLPQSTAEYNPITNFAPTPLIEG 360

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYI 418
             +L+  QE+       +                           + LG A AQ+   YI
Sbjct: 361 QGNLSLIQEQPAPYTQTI------------------------VHKHPLGHALAQLQGIYI 396

Query: 419 ISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDE 478
           +SQ   GLVIVD HAAHER+++EKM++      +  Q+LL P  + L   E      +  
Sbjct: 397 LSQNEKGLVIVDMHAAHERILYEKMKKQLAEVGLAMQSLLVPINLSLNPQEITAWQTNKA 456

Query: 479 DLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILA 538
              RLG + E FGP+ I +R  P++L  KN+  L+RD++ ++I  +TT  + +RI   LA
Sbjct: 457 LFARLGFEIESFGPDKIVVRRHPSLLKPKNLENLIRDVLADLITHNTTSRVGERINAALA 516

Query: 539 TMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           T+AC+ ++R+   +   EM  LLREMEK  +   CNHGRPT+ +  +++++  F R
Sbjct: 517 TLACHAALRAPHYLTIEEMEALLREMEKTEHGGLCNHGRPTWKQFDIAELDTFFLR 572


>gi|328545053|ref|YP_004305162.1| DNA mismatch repair protein mutL [polymorphum gilvum SL003B-26A1]
 gi|326414796|gb|ADZ71859.1| DNA mismatch repair protein mutL [Polymorphum gilvum SL003B-26A1]
          Length = 606

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 254/605 (41%), Positives = 382/605 (63%), Gaps = 20/605 (3%)

Query: 8   EKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTSEE 67
           E +IN+IAAGE+IERP+  +KEL+EN++DA +  VE V A GGK+  +++D+G GMT+ +
Sbjct: 3   EAVINRIAAGEVIERPASVVKELVENAVDAGAGMVEIVTAAGGKTLLRVSDDGSGMTAAD 62

Query: 68  IPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAISGE 126
           + +AV+RHCTSKI+D D  +I T GFRGEALPSIGAV  L++++R        +IA+ G 
Sbjct: 63  LALAVRRHCTSKIADEDLFDIRTLGFRGEALPSIGAVGRLSIVTRHVDEPHAWRIAVEGG 122

Query: 127 KISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVSFTF 186
           + + + P A + GT VEVRDLFF  PARL FLKS++ E   IT+V+RR+A+AYP + F+ 
Sbjct: 123 RETPLGPAARHRGTQVEVRDLFFATPARLKFLKSDRAEAAAITEVVRRIALAYPHIGFSL 182

Query: 187 STIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNRGN 246
           S                    RI+Q++G DF++NA+EL+ +   + L G+ G+PTF+RG 
Sbjct: 183 SGADRQAQSWPPARDADPRLARIAQILGRDFVDNALELDAEREGVRLTGFAGLPTFHRGT 242

Query: 247 ANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSYI 306
           A Q + ++NGR V+DK +LS +R AYA+ +   R+PV VL LE+DP  VDVNVHPAK+ +
Sbjct: 243 AQQQFFYVNGRPVKDKLLLSALRGAYADVLARDRHPVAVLFLELDPAHVDVNVHPAKADV 302

Query: 307 RFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMIS----------------SFHQDNA 350
           RFR+  ++R  ++ +I++A+   G   S+  +   +                  +    +
Sbjct: 303 RFRDGQLVRGLLVGAIRQALVTAGHRASTANAAAAMDAIRAGGFGGCAAAAEAPYRSPAS 362

Query: 351 PKTHLPKYATSL-TNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIA 409
                    ++         F +  +    D+LP      +       + EA    LG A
Sbjct: 363 GAAGWDWRRSAFRPGPAPAGFSEPMQAGLGDVLPLSADARA--GAVPVDEEALRRPLGAA 420

Query: 410 CAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGE 469
            AQ+H  YII+QT DGLVIVDQHAAHERL++E++++   +  +  Q LL PEI++L E +
Sbjct: 421 RAQVHGTYIIAQTEDGLVIVDQHAAHERLVYERLKEALAARAVARQMLLIPEIVELPEED 480

Query: 470 CALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTL 529
              + E   +L  +G+  E FGP A+A+RE PA+L + +I  L+RD+ DE+ +  T   L
Sbjct: 481 VGRLAERAAELESVGLVLEPFGPGAVAVRETPALLGEIDIRGLVRDLADELAEWDTATGL 540

Query: 530 QDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIE 589
           ++R++++ ATMAC+GS+R+GR++++ EM+ LLR+ME  P S QCNHGRPT+I+LKL DIE
Sbjct: 541 KERLDHVAATMACHGSVRAGRRLRAEEMDALLRDMEATPLSGQCNHGRPTWIELKLGDIE 600

Query: 590 KLFGR 594
           +LFGR
Sbjct: 601 RLFGR 605


>gi|309379702|emb|CBX21691.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 658

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 217/658 (32%), Positives = 343/658 (52%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQKDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+       N  ERI+ ++G+DF   ++E++  S  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPA----QNLHERIAAIVGDDFQTASLEIDSGSGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK--------------------------KGIST 333
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRADLTESVGNAGEVLHDITGVTPAPMPSEN 358

Query: 334 SSVLSKKMISSFHQDNAP----------KTHLPKYATSLTNTQEKLFLQENRLSTNDLLP 383
            S       S++   N P          KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DSENLFDSASNYPTGNKPDTRNAFGASGKTAPMPYQAAYAPQQRSLSLRESRAAMNTYAE 418

Query: 384 SDDPT-----------YSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
               T            +   +   E+ A                    G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSRFEQARFGNMPSETPAPKTDTPLSDGIPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM RQ   + ++ SQ LL P        ECA + +H
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRRENGRLQSQRLLIPSTFAASHEECAALADH 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R +PA+L K ++  L +D+++E+    ++ T+++    I
Sbjct: 539 AETLAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLNELAQVGSSQTIEEHENRI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSVRAGRQLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|304387173|ref|ZP_07369416.1| DNA mismatch repair protein MutL [Neisseria meningitidis ATCC
           13091]
 gi|304338740|gb|EFM04851.1| DNA mismatch repair protein MutL [Neisseria meningitidis ATCC
           13091]
          Length = 658

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 214/658 (32%), Positives = 339/658 (51%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ +E  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIEVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQKDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRADLTESVGNAGEVLHEITGVTPAPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLP 383
                   ++      K  +      + KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DSENLFNRASDYPTGNKPDTRNAFGASGKTAPMPYQAARAPQQRSLSLRESRAAMNTYAE 418

Query: 384 SDDPT-----------YSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
               T            +   +   E+ A                    G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSRFEQARFGNMPSETPAPQTDTPLSDGIPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++       + SQ LL P        ECA + ++
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGRLQSQRLLIPVTFAASHEECAALADY 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R  PA+L K ++  L RD++ E+    ++ T+++    I
Sbjct: 539 AETLAGFGLELSDMGGNTLAVRAAPAMLGKSDVVSLARDVLGELAQVGSSQTIEEHENRI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|161830565|ref|YP_001596643.1| DNA mismatch repair protein [Coxiella burnetii RSA 331]
 gi|81839061|sp|Q83CM9|MUTL_COXBU RecName: Full=DNA mismatch repair protein mutL
 gi|189030397|sp|A9NCK3|MUTL_COXBR RecName: Full=DNA mismatch repair protein mutL
 gi|161762432|gb|ABX78074.1| DNA mismatch repair protein MutL [Coxiella burnetii RSA 331]
          Length = 574

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 212/596 (35%), Positives = 326/596 (54%), Gaps = 26/596 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L+++  NQIAAGE++ERP+  +KELIENS+DA +S +   I  GG    +I D+G
Sbjct: 1   MYIRRLNDQTANQIAAGEVVERPASVVKELIENSIDAHASCIRVDILQGGAKQIRIQDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  E++ +A++RH TSKI+  DD  +I T GFRGEAL SI AVS LTL SR      G
Sbjct: 61  DGIHPEDLVLALERHATSKIAKIDDLQDITTLGFRGEALASISAVSRLTLTSRQKNAEMG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +I+    KI +  P A   GT ++V+DLF+  PAR  FL+S   E   I  +I R+A++
Sbjct: 121 YRISNISHKIMTPVPAAHPQGTTIDVQDLFYNTPARRKFLRSPATEFQHIRRIIERLALS 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +    F     +         +T      RI  ++G+ F+ +A+ +    + +TL+GY  
Sbjct: 181 HFTTEFLLHHNEKEIIHFKSATTISGQENRIKSILGDVFMQSALAIEFSQSGLTLKGYIA 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
              + R   +  Y+++NGR V+DK +   +R AY + +  GR+P  VL LEIDP  VD+N
Sbjct: 241 EAAYTRSQPDLQYIYVNGRFVRDKLVAQALRQAYHDVLFHGRHPAYVLYLEIDPAFVDIN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RFR+P  +R+F+I +++ A+ +        L +         N   T L + 
Sbjct: 301 VHPTKHEVRFRDPQWVRDFLIHAVKTALAQAKPGIVHPLPQSTAEYNPITNFAPTPLIEG 360

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYI 418
             +L+  QE+       +                           + LG A AQ+   YI
Sbjct: 361 QGNLSLIQEQPAPYTQTI------------------------VHKHPLGHALAQLQGIYI 396

Query: 419 ISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDE 478
           +SQ   GLVIVD HAAHER+++EKM++      +  Q+LL P  + L   E      +  
Sbjct: 397 LSQNEKGLVIVDMHAAHERILYEKMKKQLAEVGLAMQSLLVPINLSLNPQEITAWQTNKA 456

Query: 479 DLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILA 538
              RLG + E FGP+ I +R  P++L  KN+  L+RD++ ++I  +TT  + +RI   LA
Sbjct: 457 LFARLGFEIESFGPDKIVVRRHPSLLKPKNLENLIRDVLADLITHNTTSRVGERINAALA 516

Query: 539 TMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           T+AC+ ++R+   +   EM  LLREMEK  +   CNHGRPT+ +  +++++  F R
Sbjct: 517 TLACHAALRAPHYLTIEEMEALLREMEKTEHGGLCNHGRPTWKQFDIAELDTFFLR 572


>gi|261377459|ref|ZP_05982032.1| DNA mismatch repair protein MutL [Neisseria cinerea ATCC 14685]
 gi|269146187|gb|EEZ72605.1| DNA mismatch repair protein MutL [Neisseria cinerea ATCC 14685]
          Length = 658

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 217/658 (32%), Positives = 347/658 (52%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  + GGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELVGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++GEDF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGEDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVTPAPMSSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
                   +++     K  +     ++ KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DNENLFDSASNYPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMNTYAE 418

Query: 380 --------DLLPSDDPTYSEDNDPVE--------------ESEATHYQLGIACAQIHQNY 417
                   DL  S        N P E               S++    LG A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSQFEQVRFGNMPSEMLIPQTDTPLSDGIPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNST-KITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++      K+ SQ LL P        ECA + +H
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGKLQSQRLLIPVTFAASHEECAALSDH 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            + L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++   +I
Sbjct: 539 ADALAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLGELAQVGSSQTIEEHENHI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSVRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|313668557|ref|YP_004048841.1| DNA mismatch repair protein [Neisseria lactamica ST-640]
 gi|313006019|emb|CBN87478.1| DNA mismatch repair protein [Neisseria lactamica 020-06]
          Length = 658

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 215/658 (32%), Positives = 340/658 (51%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATEIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   +    
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSAHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+       N  ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPA----QNLHERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRANLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLP 383
                   ++      K  +     ++ KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DSENLFDRASDYPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQRSLSLRESRTAMNTYAE 418

Query: 384 SDDPT-----------YSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
               T            +   +   E+ A                    G A AQ+   Y
Sbjct: 419 LYKKTGDIDLELSRLEQARFGNMPSETPAPKTDTPLSDGIPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM RQ   + ++ SQ LL P        ECA + +H
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRRENGRLQSQRLLIPSTFAASHEECAALADH 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R  PA+L K ++  L RD++ E+    ++ T+++    I
Sbjct: 539 AETLAGFGLELSDMGGNTLAVRAAPAMLGKSDVVSLARDVLGELAQVGSSQTIEEHENRI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|315500444|ref|YP_004089247.1| DNA mismatch repair protein mutl [Asticcacaulis excentricus CB 48]
 gi|315418456|gb|ADU15096.1| DNA mismatch repair protein MutL [Asticcacaulis excentricus CB 48]
          Length = 643

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 233/639 (36%), Positives = 374/639 (58%), Gaps = 47/639 (7%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I +L +  IN+IAAGE++ERP+ AIKEL+EN++DA +++++     GG S   I DNG G
Sbjct: 4   ISRLPQDTINRIAAGEVVERPASAIKELVENAIDAGATQIDIFAEMGGLSRILIEDNGRG 63

Query: 63  MTSEEIPMAVQRHCTSKISD------DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNN 116
           M ++++P+AV+RH TSK+        D  +I T GFRGEALPS+G+V+ L + SR    +
Sbjct: 64  MDADDLPLAVERHATSKLKPQADGTWDLLHIQTLGFRGEALPSMGSVARLDITSRAKGMD 123

Query: 117 TGAQIAISGEKISSVRPV--AMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRR 174
               I +    +S +RP   +   GT VE++DLF+  PARL F+K+++ E   I++ ++R
Sbjct: 124 GAIAITVDAGAMSPLRPAAFSRPHGTRVELKDLFYATPARLKFMKTDRAENMAISEEVKR 183

Query: 175 MAIAYPKVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITL 233
            A+A+  V F+ +       ++  + +      +R++ ++G+DF +NA+ ++++   + L
Sbjct: 184 QAMAHEHVGFSLTLDGKRSLRLYPEEAGFEGRLKRLAALLGDDFGHNALLIDQQREGVRL 243

Query: 234 QGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPR 293
            GY G+PTF+RGNA   Y+F+NGR V+DK +   +R AYA+ +   R+P+ VL +E DP+
Sbjct: 244 TGYAGLPTFSRGNAQHQYLFVNGRPVRDKLLTGALRGAYADFLARDRHPMAVLYVETDPQ 303

Query: 294 QVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH------- 346
            +DVNVHPAK+ +RFR+P ++R  I+ +++ A+   G   ++ ++ + +S+F        
Sbjct: 304 NIDVNVHPAKAEVRFRDPNLVRGLIVGALKHALASAGHRAATTVADQALSAFSPLSSGYR 363

Query: 347 ------------------QDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPT 388
                             Q  A  T    +          L    +     D + +    
Sbjct: 364 APVQPTLSLHSSALGAGYQPRAYATPQQPHPNYQPAWNADLTFAPSARVERDFVAAAPML 423

Query: 389 YSEDNDPVEE-------------SEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAH 435
            +  +  + E              E   Y LG A AQ+H+ YI++QT DGL+IVDQHAAH
Sbjct: 424 QTPGDSGLAEAGGDLRTLSQPLPPEFESYPLGAARAQLHETYILAQTKDGLIIVDQHAAH 483

Query: 436 ERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAI 495
           ERL++E+M+       +  QTLL PEI+DL   + + +M   +DL   G+  E FGP  I
Sbjct: 484 ERLVYERMKAMMAEGNVARQTLLIPEIVDLDPADVSRLMARRDDLEGFGLMIESFGPATI 543

Query: 496 AIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSI 555
            +RE+PA++   ++  L+RD+ D+I ++     L++R+  I   MAC  S+R+GR++ + 
Sbjct: 544 LVREVPALIGDGDVAGLIRDLADDIAENGQALILKERMAEICGNMACRNSVRAGRRLSAS 603

Query: 556 EMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           EMN LLR+ME  P+S QCNHGRPT+++LKL DIEKLFGR
Sbjct: 604 EMNALLRQMEATPHSGQCNHGRPTYVELKLKDIEKLFGR 642


>gi|212218528|ref|YP_002305315.1| DNA mismatch repair protein [Coxiella burnetii CbuK_Q154]
 gi|212012790|gb|ACJ20170.1| DNA mismatch repair protein [Coxiella burnetii CbuK_Q154]
          Length = 575

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 213/596 (35%), Positives = 327/596 (54%), Gaps = 26/596 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L+++  NQIAAGE++ERP+  +KELIENS+DA +S +   I  GG    +I D+G
Sbjct: 2   MYIRRLNDQTANQIAAGEVVERPASVVKELIENSIDAHASCIRVDILQGGAKQIRIQDDG 61

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  E++ +A++RH TSKI+  DD  +I T GFRGEAL SI AVS LTL SR      G
Sbjct: 62  DGIHPEDLVLALERHATSKIAKIDDLQDITTLGFRGEALSSISAVSRLTLTSRQKNAEMG 121

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +I+    KI +  P A   GT ++V+DLF+  PAR  FL+S   E   I  +I R+A++
Sbjct: 122 YRISNISHKIMTPVPAAHPQGTTIDVQDLFYNTPARRKFLRSPATEFQHIRRIIERLALS 181

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +    F     +         +T      RI  ++G+ F+ +A+ +    + +TL+GY  
Sbjct: 182 HFTTEFLLHHNEKEIIHFKPATTISGQENRIKSILGDVFMQSALAIEFSQSGLTLKGYIA 241

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
              + R   +  Y+++NGR V+DK I   +R AY + +  GR+P  VL LEIDP  VD+N
Sbjct: 242 EAAYTRSQPDLQYIYVNGRFVRDKLIAQALRQAYHDVLFHGRHPAYVLYLEIDPAFVDIN 301

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RFR+P  +R+F+I +++ A+ +     +  L +         N   T L + 
Sbjct: 302 VHPTKHEVRFRDPQWVRDFLIHAVKTALAQAKPGIAHPLPQSTAEYNPITNFAPTPLIEG 361

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYI 418
             +L+  QE+       +                           + LG A AQ+   YI
Sbjct: 362 QGNLSLIQEQPAPYTQTI------------------------VHKHPLGHALAQLQGIYI 397

Query: 419 ISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDE 478
           +SQ   GLVIVD HAAHER+++EKM++      +  Q+LL P  + L   E      +  
Sbjct: 398 LSQNEKGLVIVDMHAAHERILYEKMKKQLAEVGLAMQSLLVPINLSLNPQEITAWQTNKA 457

Query: 479 DLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILA 538
              RLG + E FGP+ I +R  P++L  KN+  L+RD++ ++I  +TT  + +RI   LA
Sbjct: 458 LFARLGFEIESFGPDKIVVRRHPSLLKPKNLENLIRDVLADLITHNTTSRVGERINAALA 517

Query: 539 TMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           T+AC+ ++R+   +   EM  LLREMEK  +   CNHGRPT+ +  +++++  F R
Sbjct: 518 TLACHAALRAPHYLTIEEMEALLREMEKTEHGGLCNHGRPTWKQFDIAELDTFFLR 573


>gi|302389748|ref|YP_003825569.1| DNA mismatch repair protein MutL [Thermosediminibacter oceani DSM
           16646]
 gi|302200376|gb|ADL07946.1| DNA mismatch repair protein MutL [Thermosediminibacter oceani DSM
           16646]
          Length = 593

 Score =  539 bits (1388), Expect = e-151,   Method: Composition-based stats.
 Identities = 198/600 (33%), Positives = 319/600 (53%), Gaps = 19/600 (3%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI+ L E I ++IAAGEIIE+P   +KEL+ENS+DA S  +   I  GGKS  ++ D+G 
Sbjct: 3   KIKVLDENISSKIAAGEIIEKPVSVVKELVENSIDAGSRHIFVEIEKGGKSLIKVIDDGE 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           GM  E++ +A +RH TSKIS  DD  NI T GFRGEALPSI AVS LT++++   +  G 
Sbjct: 63  GMDPEDVRLAFERHATSKISSLDDIFNIKTLGFRGEALPSIAAVSLLTVLTKTHGSVVGT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +  ++G  I      A+  G  V VR++FF  PARL FL+S+  E +L+ D++ R AI +
Sbjct: 123 KCVLNGGVIEKFEEAAVAEGCCVIVRNIFFNTPARLKFLQSDSREASLVVDLVTRYAIGH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P +SF  S       ++ +   NGN  E I+++ G +   + + +N+  +   + G+   
Sbjct: 183 PDISFRLSVDGK---EVLYTPGNGNLKEVIARIYGFNLAKDLIHINKTFDFGRIDGFISP 239

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P + RGN +    F+NGR V+D+ + +++  AY   +P  ++P+  + + ID   VDVNV
Sbjct: 240 PKYTRGNRSWETFFVNGRLVKDRGLSASLEKAYRTLLPGDKFPIAFIKISIDGSLVDVNV 299

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HPAK  IRF+    +   + +++++ +    +     L         +   PK      A
Sbjct: 300 HPAKIEIRFQRENEVHQALYETVKEGLFSNTLVPKEDL------PIPKTTFPKPKNYDGA 353

Query: 360 TSLTNTQEKLFLQ-----ENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIH 414
            +    +E+ F +     EN+    +     +       +  EE +A          Q+ 
Sbjct: 354 VNENFLKEEYFTRTSGKIENKPVFTETAVPSETKKHSAPNIKEEKKAPEIYFSRILGQLF 413

Query: 415 QNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIM 474
           + YI+ Q      +VDQHAAHER+++E      +   + SQ L++P I+ L   E   I 
Sbjct: 414 ETYIVVQGNGEFYLVDQHAAHERILYEYYSCGMDL-PVISQELVSPFILKLTFEEINFIE 472

Query: 475 EHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIE 534
           E+ + + R+G   E FG + + IR +P   +K   P  L++I+DE+ ++          E
Sbjct: 473 ENRDFIKRMGFDIEVFGKDTVLIRSVPYFFNKPVEPASLQEIMDELKENGEFRLRS--RE 530

Query: 535 NILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            ILA+MAC+ +I++G  +   EM  LL ++ +  N   C HGRPT I + L ++EK F R
Sbjct: 531 KILASMACHTAIKAGDTLSPDEMRELLDQLMRTQNPYTCPHGRPTMISISLYELEKKFRR 590


>gi|215919100|ref|NP_820082.2| DNA mismatch repair protein [Coxiella burnetii RSA 493]
 gi|206583985|gb|AAO90596.2| DNA mismatch repair protein [Coxiella burnetii RSA 493]
          Length = 575

 Score =  539 bits (1388), Expect = e-151,   Method: Composition-based stats.
 Identities = 212/596 (35%), Positives = 326/596 (54%), Gaps = 26/596 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L+++  NQIAAGE++ERP+  +KELIENS+DA +S +   I  GG    +I D+G
Sbjct: 2   MYIRRLNDQTANQIAAGEVVERPASVVKELIENSIDAHASCIRVDILQGGAKQIRIQDDG 61

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  E++ +A++RH TSKI+  DD  +I T GFRGEAL SI AVS LTL SR      G
Sbjct: 62  DGIHPEDLVLALERHATSKIAKIDDLQDITTLGFRGEALASISAVSRLTLTSRQKNAEMG 121

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +I+    KI +  P A   GT ++V+DLF+  PAR  FL+S   E   I  +I R+A++
Sbjct: 122 YRISNISHKIMTPVPAAHPQGTTIDVQDLFYNTPARRKFLRSPATEFQHIRRIIERLALS 181

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +    F     +         +T      RI  ++G+ F+ +A+ +    + +TL+GY  
Sbjct: 182 HFTTEFLLHHNEKEIIHFKSATTISGQENRIKSILGDVFMQSALAIEFSQSGLTLKGYIA 241

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
              + R   +  Y+++NGR V+DK +   +R AY + +  GR+P  VL LEIDP  VD+N
Sbjct: 242 EAAYTRSQPDLQYIYVNGRFVRDKLVAQALRQAYHDVLFHGRHPAYVLYLEIDPAFVDIN 301

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RFR+P  +R+F+I +++ A+ +        L +         N   T L + 
Sbjct: 302 VHPTKHEVRFRDPQWVRDFLIHAVKTALAQAKPGIVHPLPQSTAEYNPITNFAPTPLIEG 361

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYI 418
             +L+  QE+       +                           + LG A AQ+   YI
Sbjct: 362 QGNLSLIQEQPAPYTQTI------------------------VHKHPLGHALAQLQGIYI 397

Query: 419 ISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDE 478
           +SQ   GLVIVD HAAHER+++EKM++      +  Q+LL P  + L   E      +  
Sbjct: 398 LSQNEKGLVIVDMHAAHERILYEKMKKQLAEVGLAMQSLLVPINLSLNPQEITAWQTNKA 457

Query: 479 DLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILA 538
              RLG + E FGP+ I +R  P++L  KN+  L+RD++ ++I  +TT  + +RI   LA
Sbjct: 458 LFARLGFEIESFGPDKIVVRRHPSLLKPKNLENLIRDVLADLITHNTTSRVGERINAALA 517

Query: 539 TMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           T+AC+ ++R+   +   EM  LLREMEK  +   CNHGRPT+ +  +++++  F R
Sbjct: 518 TLACHAALRAPHYLTIEEMEALLREMEKTEHGGLCNHGRPTWKQFDIAELDTFFLR 573


>gi|220927109|ref|YP_002502411.1| DNA mismatch repair protein MutL [Methylobacterium nodulans ORS
           2060]
 gi|219951716|gb|ACL62108.1| DNA mismatch repair protein MutL [Methylobacterium nodulans ORS
           2060]
          Length = 621

 Score =  539 bits (1388), Expect = e-151,   Method: Composition-based stats.
 Identities = 234/610 (38%), Positives = 369/610 (60%), Gaps = 20/610 (3%)

Query: 4   RKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGM 63
           R+L   ++++IAAGE++ERP+ A+KEL+EN++DA ++ +E  I  GG+   ++ D+G GM
Sbjct: 12  RRLDPVLVDRIAAGEVVERPAAAVKELVENAIDAGATSIEVTIQAGGRRLIRVLDDGIGM 71

Query: 64  TSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIA 122
             E++ +AV+RH TSK+ + D   I T GFRGEALPSIGAV+ L+L+SR  +  +G  + 
Sbjct: 72  GPEDLALAVERHATSKLPEGDLDRIDTLGFRGEALPSIGAVARLSLVSRTAEAESGHGLV 131

Query: 123 ISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKV 182
           +       VRPVA   GT VEV DLF   PARL FLKS++ E   + +++RR+A+A+P++
Sbjct: 132 VDAGIKGPVRPVAAERGTRVEVTDLFAATPARLKFLKSDRAEAGAVAEILRRLAVAHPQI 191

Query: 183 SFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTF 242
            FT             ++  G++  R++ V+G DF  N+V ++ +     L G+ G+PTF
Sbjct: 192 RFTLRGEGGAGLTFPAETGQGSWLRRLAAVLGADFAANSVPVSLEREGFALDGHIGLPTF 251

Query: 243 NRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPA 302
           +R  A   +  +NGR V+D+ +L  +R AYA+ +   R+PV+ L L  DP +VDVNVHPA
Sbjct: 252 HRAAATHMHFVVNGRPVRDRLLLGAVRGAYADVMASDRHPVLALALTCDPTEVDVNVHPA 311

Query: 303 KSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDN--------APKTH 354
           K+ +RFR P ++R  I+ +I +A+ ++G   S  ++ K + S                  
Sbjct: 312 KTEVRFREPGLVRGLIVSAIHEALRREGGRASGSVAAKTLESLRPAQGPLLPLRRPDPPP 371

Query: 355 LPKYATSLTNTQEKLFLQENRLSTNDLLPSDD----------PTYSEDNDPVEESEATHY 404
                +    +  + FL     +      +D+          P  ++  +P  E  +  +
Sbjct: 372 AAPRGSGRVESFAQDFLGAPEAAEQPAGFADEAQAAFAGAAMPPGADWREPAPEPASPTH 431

Query: 405 QLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIID 464
            LG A AQ+H+ YI++QT DG+VIVDQHAAHERL++E+++++  +  I  Q LL P++++
Sbjct: 432 PLGAARAQLHETYIVAQTQDGIVIVDQHAAHERLVYERLKRERAAGGIARQLLLIPDVVE 491

Query: 465 LLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSS 524
           L   E   + E   DL  LG+  E FG  A+ +RE+PA L+  ++  LL D++D + +  
Sbjct: 492 LDPAEADRLAEAAGDLEALGLVLEAFGHGAVLVREVPAALAGGSVRALLADVVDVLQE-G 550

Query: 525 TTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLK 584
               L  R++ +L+ M+C+GSIR+GR+++  EMN LLREME  P S QCNHGRPT+++LK
Sbjct: 551 GADPLARRLDAVLSRMSCHGSIRAGRRLRPEEMNALLREMEATPLSGQCNHGRPTYVELK 610

Query: 585 LSDIEKLFGR 594
           L DIE+LFGR
Sbjct: 611 LHDIERLFGR 620


>gi|294496663|ref|YP_003543156.1| DNA mismatch repair protein MutL [Methanohalophilus mahii DSM 5219]
 gi|292667662|gb|ADE37511.1| DNA mismatch repair protein MutL [Methanohalophilus mahii DSM 5219]
          Length = 597

 Score =  539 bits (1388), Expect = e-151,   Method: Composition-based stats.
 Identities = 198/596 (33%), Positives = 304/596 (51%), Gaps = 12/596 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I  L E  INQIAAGE+IERP+  +KELI+NSLDA +S +   I G G     + D+G G
Sbjct: 7   IHLLDEATINQIAAGEVIERPASVVKELIDNSLDAGASDIRVEIEGAGSKSITVIDDGSG 66

Query: 63  MTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  EE P+A  +H TSKI   DD   I T GFRGEAL SI AVS + L+SR     +  +
Sbjct: 67  IGREEAPLAFTKHSTSKIESKDDLHRIITLGFRGEALSSIAAVSRVELISRTADCLSAVR 126

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I + G  +        + GT VEV+DLF+  PAR  +LKS++ E + ITD + R A+  P
Sbjct: 127 IGVEGGLVGEATETGSSVGTRVEVQDLFYNTPARRKYLKSKRTELSHITDTVTRQALGNP 186

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V+FT         +       G   +R+ QV+G D     + L  K + ++L GY   P
Sbjct: 187 GVAFTLLNEGKVVLR----CGKGELFDRMVQVLGADVARQLIPLEYKDDLLSLWGYISKP 242

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
            + R N    Y F+NGR +    I + +R  Y   +P GRYP  VL + I+  +VDVNVH
Sbjct: 243 GYYRSNREMNYFFVNGRNISSPAISNAVRLGYYTMLPKGRYPAAVLNVRINLEEVDVNVH 302

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTS--SVLSKKMISSFHQDNAPKTHLPKY 358
           PAK Y+R      I + I  ++++A+ ++ +        +  M SS      P +  P  
Sbjct: 303 PAKRYVRLSRENEIMDGITAAVEQALKQEKLVPEVKPSRTTTMQSSLASPEKPNSKEPIS 362

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYI 418
           + S    +           T   L S +  ++E+     E   +         Q++  YI
Sbjct: 363 SESPVIRENTPNYSAPPRDTQRRLKSSERAFAEEKAH-PERVGSGVSDARILGQVNDLYI 421

Query: 419 ISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDE 478
           +++T +GL+++DQHAAHER+++E++ +     K   Q L++P  +DL   E  L+ E+  
Sbjct: 422 VAETDEGLLLIDQHAAHERIMYEQLSRR---VKHDWQELISPVTVDLTTREKVLLEEYIP 478

Query: 479 DLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILA 538
            L  LG     FG     I  +P ++ K   P ++ D++ ++ +       +   + +  
Sbjct: 479 YLENLGFSLSEFGTQTYVITTVPTVMGKIEDPSVVHDLLADLFEQGRVKEKKGMEDMLCK 538

Query: 539 TMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           TMAC  +I++G      +M  LL ++EK  N   C HGRPT I L  ++++KLF R
Sbjct: 539 TMACRSAIKAGAPCNMEQMQNLLDQLEKTENPYTCPHGRPTMITLGKAELDKLFKR 594


>gi|161870311|ref|YP_001599481.1| DNA mismatch repair protein [Neisseria meningitidis 053442]
 gi|189030402|sp|A9M0G1|MUTL_NEIM0 RecName: Full=DNA mismatch repair protein mutL
 gi|161595864|gb|ABX73524.1| DNA mismatch repair protein [Neisseria meningitidis 053442]
          Length = 658

 Score =  539 bits (1388), Expect = e-151,   Method: Composition-based stats.
 Identities = 210/658 (31%), Positives = 341/658 (51%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  + GGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELDGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKPVFKLPAQS----LHERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLP 383
                   ++      K  +     ++ KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DSENLFDSASDYPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMNTYAE 418

Query: 384 SDDPT-----------YSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
               T            +   +   E+                      G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSRLEQARFGNMPSETPIPKTDTPLSDGIPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNST-KITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++      K+ SQ LL P        ECA + ++
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGKLQSQRLLIPVTFAASHEECAALADY 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++   +I
Sbjct: 539 AETLAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLGELAQVGSSQTIEEHENHI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSVRAGRQLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|319638431|ref|ZP_07993193.1| DNA mismatch repair protein mutL [Neisseria mucosa C102]
 gi|317400180|gb|EFV80839.1| DNA mismatch repair protein mutL [Neisseria mucosa C102]
          Length = 658

 Score =  538 bits (1387), Expect = e-151,   Method: Composition-based stats.
 Identities = 219/658 (33%), Positives = 349/658 (53%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   +    
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQDGSAHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKPVFKLPAQS----LHERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK-------------------KGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                      G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 341 MISSFHQDNAP-----------------KTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
              +   D +                  KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 NSENLFDDVSNYPTGNKSDTRNAFGSSGKTAPMPYQAARAPQQRSLSLRESRAAMNTYAE 418

Query: 380 --------DLLPSDDPTYSEDNDPVE--------------ESEATHYQLGIACAQIHQNY 417
                   DL  S        N P E               S++    LG A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSQFEQARFGNMPSEMPTQKTDTPLSDGLPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++       + SQ LL P        ECA + +H
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQRLLIPVTFAASHEECAALADH 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++   +I
Sbjct: 539 AEALAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLGELAQVGSSQTIEEHENHI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSVRAGRQLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|71908777|ref|YP_286364.1| DNA mismatch repair protein MutL [Dechloromonas aromatica RCB]
 gi|71848398|gb|AAZ47894.1| DNA mismatch repair protein MutL [Dechloromonas aromatica RCB]
          Length = 615

 Score =  538 bits (1386), Expect = e-150,   Method: Composition-based stats.
 Identities = 207/611 (33%), Positives = 333/611 (54%), Gaps = 23/611 (3%)

Query: 1   MK-IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDN 59
           M  I +L + +I+QIAAGE++ERP+  +KEL+ENSLDA S  ++  +  GG    +ITD+
Sbjct: 9   MPTIARLPDLLISQIAAGEVVERPASVLKELLENSLDAGSKAIQVHLEEGGVKLIRITDD 68

Query: 60  GFGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNT 117
           G G+  +E+ +A+ RH TSKIS  DD   + T GFRGEAL S+ +V+ L++ SR      
Sbjct: 69  GCGIARDELALALTRHATSKISSLDDLERVGTLGFRGEALASVASVARLSITSRERGAAH 128

Query: 118 GAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
             ++       +   P A+  GT+VE+RDL+F  PAR  FLKSE  E     D ++R+A+
Sbjct: 129 AWKLRGEPG--AEPEPAALMAGTVVEMRDLYFNTPARRKFLKSESTEFAHCADAVKRLAL 186

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
             P V+ + +    N +++       + P RI+ ++G++F+  A  ++  +  +++ G+ 
Sbjct: 187 TRPDVAISLTHNGRNLFQL----APADAPRRIADILGDEFLGAARAVDAGTGALSIGGFA 242

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
             PT      +  YVF+NGR V+DK I   +R AY + +   R P V L + IDP  VDV
Sbjct: 243 IDPTRATDAKDGQYVFVNGRFVRDKIISHALREAYRDVLHGSRQPAVCLFVNIDPALVDV 302

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKK-----------GISTSSVLSKKMISSFH 346
           NVHPAK+ +RFR+   +  F+  +IQ+ +                + SS      +S  +
Sbjct: 303 NVHPAKTEVRFRDSRAMHQFVFHAIQRTLAAPVQAEAAPALIERATPSSEYQAPALSPEN 362

Query: 347 QDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSE---DNDPVEESEATH 403
           + N       ++  SL   +               +       SE      P+E + +  
Sbjct: 363 RPNVEYAPPLRHQGSLGVAEPAAAAYLAFARAAQDIGQSPAPRSEVAPQFQPIESTGSDG 422

Query: 404 YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEII 463
             LG A AQ+H  YI++Q   GL+++D HAAHER+++EK++  F++ +I +Q LL P + 
Sbjct: 423 PPLGYALAQLHGIYILAQNARGLILIDMHAAHERILYEKLKTAFDNRQIATQALLIPAVF 482

Query: 464 DLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDS 523
                + A + EH + L  LG +    GPN + +R +PA+L   +   L + +I E+ + 
Sbjct: 483 SADPLDIAAVEEHADALADLGFQITPLGPNQLGVRAVPALLQSGDPAALAKSLIAELREH 542

Query: 524 STTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKL 583
             T     R   +LATMAC+G++R+ R++   EMN LLR+ME+   + QCNHGRPT+ +L
Sbjct: 543 GITQLATARRNELLATMACHGAVRARRQLTVPEMNALLRQMEETERAGQCNHGRPTWTEL 602

Query: 584 KLSDIEKLFGR 594
            +  ++KLF R
Sbjct: 603 TMDQLDKLFLR 613


>gi|319405154|emb|CBI78760.1| DNA mismatch repair protein MutL [Bartonella sp. AR 15-3]
          Length = 612

 Score =  538 bits (1385), Expect = e-150,   Method: Composition-based stats.
 Identities = 269/612 (43%), Positives = 392/612 (64%), Gaps = 19/612 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  +KEL+EN++DA +SR+E VIA GGKS  +++DNG
Sbjct: 1   MIIRHLSETIINQIAAGEVIERPANVVKELVENAIDAGASRIEIVIANGGKSLIRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+  +++ +A+ RHCTSKI DD  NI   GFRGEALPSIG+VS L L SR   +N+ A+
Sbjct: 61  CGIPEDQLILAISRHCTSKIIDDVHNICFLGFRGEALPSIGSVSKLKLTSRTQNSNSAAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ++  +I   +P A NPGTIVEVRDLFF  PARL F+KS++ ETN ITD I+R+AIA+P
Sbjct: 121 IIVTAGRIEEPKPSAANPGTIVEVRDLFFVTPARLKFMKSDRAETNAITDTIKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGN-FPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ + I     +      N     +RI+Q++G++F  N++ L+ K   + L G+ G+
Sbjct: 181 HIRFSLAGIDRAPMEFPAMEKNTQGQLQRITQIMGKEFAPNSLLLDAKRESVHLTGFVGL 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNR N+   + ++NGR V+DK +   IR AYA+ I   R+ V +L + + P  VDVNV
Sbjct: 241 PSFNRSNSLYQFAYVNGRPVRDKLLWGAIRGAYADVIAQNRHAVAILFIHLPPTDVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HPAK  +RFR+P++IR  II +I++A+++ GI  +S  S+ M+++F         + +  
Sbjct: 301 HPAKMDVRFRDPSLIRGLIIGAIREALHQTGIRPTSTGSEAMLAAFRTQPLETVKMHQPF 360

Query: 360 TSLTNTQ-----------------EKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEAT 402
           +  T                      + LQE+ +   D L +         +    SE  
Sbjct: 361 SDSTPPYHFGPEITSIFHKPLDMTSSIDLQEDTIPIIDRLSTPSGDTRAAINK-PTSEEL 419

Query: 403 HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEI 462
           HY LG A AQIH+NYI++QT D L+IVDQHAAHERL++E ++    S  + SQ LL PEI
Sbjct: 420 HYPLGAARAQIHKNYIVAQTQDSLIIVDQHAAHERLVYESLKNALYSKPLPSQLLLIPEI 479

Query: 463 IDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIID 522
           +++ E +   ++ H + L + G+  + FG  AI + EIP++L + N+  L++D+ DE  +
Sbjct: 480 VEISEEDATCLLSHKDALKKFGLGIDSFGIGAIVVHEIPSMLGEINVQALIKDLADEAAE 539

Query: 523 SSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIK 582
             T   L+  ++ + ATMAC+ SIRSGR +   EMN LLR++E  PNS+ CNHGRPT+I+
Sbjct: 540 YDTIDNLKGMLDYVAATMACHSSIRSGRLLHPEEMNALLRQIEATPNSATCNHGRPTYIE 599

Query: 583 LKLSDIEKLFGR 594
           LKL+DIE+LFGR
Sbjct: 600 LKLADIERLFGR 611


>gi|297184024|gb|ADI20144.1| DNA mismatch repair enzyme (predicted ATPase) [uncultured alpha
           proteobacterium EB080_L06A09]
          Length = 611

 Score =  538 bits (1385), Expect = e-150,   Method: Composition-based stats.
 Identities = 259/600 (43%), Positives = 387/600 (64%), Gaps = 12/600 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+LS+   N+IAAGE++ERPS AIKEL+ENS+DA +SR++   + GGK+  ++ D+G G
Sbjct: 15  IRQLSDAAANRIAAGEVVERPSSAIKELVENSIDAGASRIDISYSDGGKTLIRVKDDGHG 74

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           +   ++ +A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+ SR      GA I
Sbjct: 75  IAENQLLLALSRHATSKIDGTDLLNIHTFGFRGEALPSMGAVGRLTITSRIQDVAMGATI 134

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            + G  I  VRP     GT+VE+RDLF   PARL FL++++ E   I+DVI+R+A++ P 
Sbjct: 135 TVDGGLIGRVRPAPSTIGTVVELRDLFHATPARLKFLRTDRAEAGAISDVIKRLAMSEPF 194

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQ 234
            +FT    +     R         G+  +    R+S+V+G DF  N+  ++   + +TL 
Sbjct: 195 KAFTLRDVTGGGDGRIIFRADPETGDLFDAMYGRLSKVLGVDFAKNSFRVDADRDGMTLT 254

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT+++G++   ++F+NGR+V+DK +LS +R AY++ +  GRYPVV L +E D  +
Sbjct: 255 GYASLPTYSKGSSVSQFIFVNGRSVKDKNLLSALRAAYSDFLHSGRYPVVALFIECDFER 314

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAK+ +RFR P   R  +I  ++ A+ ++G   SS ++   + +F +       
Sbjct: 315 VDVNVHPAKAEVRFREPGTARGLVISGLRHALAEEGHRASSTIADATLGAFKKSGDINNS 374

Query: 355 LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIH 414
                 S + + E      +++  +++         ++ + +E+      +LG A AQIH
Sbjct: 375 S-NLRMSQSWSMEVPRHHPDQVGFSEIQNDFSSRQLDNENIIEQIS---NKLGAARAQIH 430

Query: 415 QNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIM 474
           +NYI+SQT DGLVIVDQHAAHERL++EK++       +++QTLL PEII+L E + A +M
Sbjct: 431 ENYILSQTFDGLVIVDQHAAHERLVYEKLKNQMAMNGVSAQTLLIPEIIELSEQDAAELM 490

Query: 475 EHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIE 534
           E   +L+  G+  E FG N+I +RE PAIL + N   L+ DI+DE+ D S +  ++++++
Sbjct: 491 EISGELNGFGLNIENFGGNSIIVRETPAILGEVNAKNLILDILDELKDWSQSNIVKEKLD 550

Query: 535 NILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            IL+ +AC+GSIRSGR M+  EMN LLREME  P+S QCNHGRPT+++LKL+DIEKLFGR
Sbjct: 551 AILSRVACHGSIRSGRIMKVEEMNALLREMEATPHSGQCNHGRPTYVELKLNDIEKLFGR 610


>gi|325144738|gb|EGC67033.1| DNA mismatch repair protein MutL [Neisseria meningitidis
           M01-240013]
          Length = 658

 Score =  538 bits (1385), Expect = e-150,   Method: Composition-based stats.
 Identities = 213/658 (32%), Positives = 342/658 (51%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ +E  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIEVELAGGGIRLIRVSDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQNDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++GEDF   ++ ++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGEDFQTASLGIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRANLTESVGNAGEVLHDITGVVSTPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLP 383
                    ++     K  +     ++ KT    Y ++    Q  L L+E+R + N    
Sbjct: 359 DSENLFDSVSNYPTGNKSDTHNAFGSSGKTAPMPYQSAYAPQQRSLSLRESRAAMNTYAE 418

Query: 384 SDDPT-----------YSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
               T            +   +   E+ A                    G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSRFEQARFGNMPSETPAPQTDTPLSDGIPSPSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++       + SQ LL P        ECA + ++
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQRLLIPVTFAASHEECAALADY 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R +PA+L K ++  L +D+++E+    ++ T+++    I
Sbjct: 539 AETLAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLNELAQVGSSQTIEEHENRI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|15677300|ref|NP_274454.1| DNA mismatch repair protein [Neisseria meningitidis MC58]
 gi|20455152|sp|Q9JYT2|MUTL_NEIMB RecName: Full=DNA mismatch repair protein mutL
 gi|7226683|gb|AAF41803.1| mismatch repair protein MutL [Neisseria meningitidis MC58]
 gi|316984569|gb|EFV63534.1| DNA mismatch repair MutL family protein [Neisseria meningitidis
           H44/76]
 gi|325134577|gb|EGC57221.1| DNA mismatch repair protein MutL [Neisseria meningitidis M13399]
 gi|325140613|gb|EGC63133.1| DNA mismatch repair protein MutL [Neisseria meningitidis CU385]
 gi|325199942|gb|ADY95397.1| DNA mismatch repair protein MutL [Neisseria meningitidis H44/76]
 gi|325205804|gb|ADZ01257.1| DNA mismatch repair protein MutL [Neisseria meningitidis
           M04-240196]
          Length = 658

 Score =  538 bits (1385), Expect = e-150,   Method: Composition-based stats.
 Identities = 213/658 (32%), Positives = 342/658 (51%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ +E  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIEVELAGGGIRLIRVSDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQNDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++GEDF   ++ ++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGEDFQTASLGIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRANLTESVGNAGEVLHDITGVVSTPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLP 383
                    ++     K  +     ++ KT    Y ++    Q  L L+E+R + N    
Sbjct: 359 DSENLFDSVSNYPTGNKSDTHNAFGSSGKTAPMPYQSAYAPQQRSLSLRESRAAMNTYAE 418

Query: 384 SDDPT-----------YSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
               T            +   +   E+ A                    G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSRFEQARFGNMPSETPAPQTDTPLSDGIPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++       + SQ LL P        ECA + ++
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQRLLIPVTFAASHEECAALADY 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R +PA+L K ++  L +D+++E+    ++ T+++    I
Sbjct: 539 AETLAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLNELAQVGSSQTIEEHENRI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|238916922|ref|YP_002930439.1| DNA mismatch repair protein MutL [Eubacterium eligens ATCC 27750]
 gi|238872282|gb|ACR71992.1| DNA mismatch repair protein MutL [Eubacterium eligens ATCC 27750]
          Length = 625

 Score =  538 bits (1385), Expect = e-150,   Method: Composition-based stats.
 Identities = 189/627 (30%), Positives = 295/627 (47%), Gaps = 37/627 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I  L +  IN+IAAGE++ERPS  +KEL+EN++DA ++ +   I  GG SF ++TDNG
Sbjct: 1   MPITLLDQNTINKIAAGEVVERPSSVVKELVENAIDAGATAITVEIKEGGISFIRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  +EI +A +RH TSKI   +D   + + GFRGEAL SI AVS + L+++   + +G
Sbjct: 61  SGINKDEIEIAFKRHATSKIESIEDLMAVSSLGFRGEALASIAAVSQVELITKTADSLSG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +  I G     V  +    GT   VR+LF+  P R  FLK+   E   I  ++  +A++
Sbjct: 121 VRYTIDGGVPGEVAEIGAPEGTTFIVRNLFYNTPVRRKFLKTATTEGGYIGSLVEYLALS 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +P +SF F +   N+      S N N  + I  V G D  NN  E++ KS +I   G+ G
Sbjct: 181 HPDISFRFISNNQNKLH---TSGNMNLKDIIYNVYGRDITNNLYEISGKSQDIEASGFIG 237

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P   RGN      +INGR ++   I   I  AY   I    YP   +  +I+P  +DVN
Sbjct: 238 KPMVVRGNRTYENYYINGRYIKSSIITKAIEDAYKGFIMPHNYPFSAIHFKINPAIIDVN 297

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RF N   I NF+  +  KA+N K +     +   +     ++   +  +P  
Sbjct: 298 VHPTKMELRFSNNEYIYNFVYDTCLKALNSKELIAEVSVPDPVAVKMQEEPVVRNVMPDV 357

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDD-----------------PTYSEDNDPVEESEA 401
                N  + +  +    S                                 + V +SE 
Sbjct: 358 KLPEKNVSDSMPCKTETKSAESAKAEIKPKRLPEPFEIKGSLQMVMEDKVRYEAVTKSEP 417

Query: 402 THYQLG--------------IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDF 447
                                   Q+   Y + +  D   ++DQHAAHE++++E+     
Sbjct: 418 PKQMNLFENKLLDENSRNKYRIIGQLFDTYWLIEFEDKFYMMDQHAAHEKVLYERTMNKL 477

Query: 448 NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKK 507
           ++  I +Q +L P ++ L   E  +   + +   RLG + E FG N   +  IPA L K 
Sbjct: 478 HNKTIGTQMILPPIVLSLNMHEEEIYKTNQDIFKRLGYEIEEFGGNEYKVTGIPAGLPKM 537

Query: 508 NIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKN 567
           +  QLL D++D + + S      D I   +A+M+C  +++   ++   E   L+ E+ K 
Sbjct: 538 DYKQLLIDVLDGLSEESAGKD-PDIITEKVASMSCKAAVKGNNRLSFNEAFELMDELMKA 596

Query: 568 PNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            N   C HGRPT I +   +IEK F R
Sbjct: 597 ENPYNCPHGRPTLIMMSRYEIEKKFKR 623


>gi|291613850|ref|YP_003524007.1| DNA mismatch repair protein MutL [Sideroxydans lithotrophicus ES-1]
 gi|291583962|gb|ADE11620.1| DNA mismatch repair protein MutL [Sideroxydans lithotrophicus ES-1]
          Length = 640

 Score =  538 bits (1385), Expect = e-150,   Method: Composition-based stats.
 Identities = 203/641 (31%), Positives = 333/641 (51%), Gaps = 53/641 (8%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            I+ L + +INQIAAGE+IERP+ A+KEL+ENSLDA ++ +   + GGG     + DNG 
Sbjct: 3   SIQLLPDLLINQIAAGEVIERPASALKELLENSLDAGATDIAVQLEGGGIKRLVVRDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  E++P+A+ RH TSKI+  DD   + + GFRGEAL S+ AV+ +TL SR        
Sbjct: 63  GIAREQLPLALMRHATSKIASLDDLQRVASMGFRGEALASMAAVAQVTLTSRNADVAHAW 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +I  +    S V P A   GT VE+R+L+F  PAR  FLKSE  E     +  +R+A++ 
Sbjct: 123 KIEAADGTQSDVTPAAHPQGTSVEMRELYFNTPARRKFLKSESTEFAWCEETFKRIALSR 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGN----------------------------------- 204
           P V+F+        +++    +  +                                   
Sbjct: 183 PDVAFSLQHNGKMVWQLAASKSTPSPYPLPEGEGFGGLPSPSGITSDLPARGLSRLASSS 242

Query: 205 -----------FPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNRGNANQFYVF 253
                        +RI+ ++G +F  +AV +  +   + L G   +P ++R   ++ Y F
Sbjct: 243 IRGIEGEEKHSLQQRITAILGPEFGQHAVNVERQIGPLHLYGIAALPAYSRSTRDEQYFF 302

Query: 254 INGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSYIRFRNPTI 313
           +NGR V+DK ++  +R AY + +   R+P  VL L++ P QVDVNVHPAKS +RFR    
Sbjct: 303 VNGRFVRDKVLMHAVRQAYQDILHHQRHPAFVLFLDMPPEQVDVNVHPAKSEVRFRESQG 362

Query: 314 IRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQE 373
           I  F+  ++Q A++    ST+S  S    S   +    +     +A      Q+ +    
Sbjct: 363 IHQFVFHALQDALSATMGSTASNQSATSPSPSGRGVGVREEPQPFAPI---QQQTMTFSA 419

Query: 374 NRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHA 433
            +      L  +     E      + +A    LG A  Q+   YI++Q   GL++VD HA
Sbjct: 420 AQPQAAYKLWEEAAVVREQESAAPQQDAH--PLGFALGQLSGIYILAQNQQGLIVVDMHA 477

Query: 434 AHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPN 493
           AHER+++E+++  F++ ++ +Q LL P        + A   E  E LH+LG        N
Sbjct: 478 AHERIVYERLKTAFDAQQMPTQPLLIPVTFAAEALDVATAEEEQEALHKLGFDIAPISTN 537

Query: 494 AIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQ 553
            +A+R +PA+L + +     R+++ E+ D   +  L +R   +LAT+AC+ ++R+ +++ 
Sbjct: 538 TLAVRAMPAMLKQSHAETAAREVLHELRDFGASRALTERRNELLATLACHSAVRANQQLS 597

Query: 554 SIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
             EMN +LREME+   + QCNHGRPT+ ++ L++++ +F R
Sbjct: 598 LPEMNAILREMEQTERADQCNHGRPTWFQMTLAELDAMFMR 638


>gi|238022530|ref|ZP_04602956.1| hypothetical protein GCWU000324_02438 [Kingella oralis ATCC 51147]
 gi|237867144|gb|EEP68186.1| hypothetical protein GCWU000324_02438 [Kingella oralis ATCC 51147]
          Length = 636

 Score =  537 bits (1384), Expect = e-150,   Method: Composition-based stats.
 Identities = 218/638 (34%), Positives = 332/638 (52%), Gaps = 48/638 (7%)

Query: 1   MK-IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDN 59
           M  I+ L   +INQIAAGE++ERP+ A+KE++ENSLDA ++++   I GGG    ++ DN
Sbjct: 1   MPSIQFLPSHLINQIAAGEVVERPANALKEIVENSLDAGATQISVDIVGGGIKLLRVCDN 60

Query: 60  GFGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNT 117
           G GM ++++P+A+ RH TSKI    D   + + GFRGE L SI +VS LTL SR   N  
Sbjct: 61  GCGMEADDLPLALSRHATSKIKSLSDLERVQSMGFRGEGLASIASVSRLTLTSRTTHNAH 120

Query: 118 GAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
             QI      +  V   A   GT +E+ +LFF  PAR  FLKSE  E      ++ R+A+
Sbjct: 121 AHQIRAVDGALGEVAAAAHPVGTTIEIAELFFNTPARRKFLKSENTEYAHCATMLERLAL 180

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           A P VSF+        +    Q       ER++ ++G  F   A+ ++ ++ E+ L+G+ 
Sbjct: 181 ANPAVSFSLKNNGKTVFDYPAQP----LSERVAAIMGAAFQAAALPIDSQAGEMALRGFV 236

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
             PTF +G +++ + F+N R V+DK +L  ++ AY + +     P  VL L++ P QVDV
Sbjct: 237 SKPTFAQGKSDKQFFFVNNRFVRDKVMLHAVKQAYRDVLHNQITPAFVLFLDLPPEQVDV 296

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKK----MISSFHQDNAP-- 351
           NVHP K+ IRFR+   +   I  ++ KA+ +     +  +S            Q  AP  
Sbjct: 297 NVHPTKTEIRFRDSQAVHQMIFHALNKALAETRADVTESVSNAGALLQQRFVPQPAAPDE 356

Query: 352 ------------------------------KTHLPKYATSLTNTQEKLFLQENRLSTNDL 381
                                            +P  A +    Q  L L ENR +    
Sbjct: 357 TLFLGSLKTEGFNGMTTAIPAADAFSGSPKSAPMPYQAAARAPQQRPLSLNENRAALQAY 416

Query: 382 L----PSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHER 437
                  DD    E            Y LG A AQ+   Y+++Q  D L++VD HAA ER
Sbjct: 417 AELYREDDDLAAFEPQAAQVRQPENAYPLGFAIAQLLGIYVLAQAADSLILVDMHAAAER 476

Query: 438 LIFEKMRQDFN-STKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIA 496
           + +EKM+   +    + +Q LL P   +    E A   ++  +L + G+     G   IA
Sbjct: 477 VNYEKMKAQRDAEGSLKTQMLLIPVAFEASHAELAARADYAAELAQYGLDLADLGNGQIA 536

Query: 497 IREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIE 556
           +R +P +L K ++  L RD++ E+    ++ T++ +   IL+TMAC+GSIR+GR++   E
Sbjct: 537 VRAVPQMLGKADVAALARDVLRELAAVGSSQTIEAKENQILSTMACHGSIRAGRQLTLPE 596

Query: 557 MNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           MN LLR+ME  P S+QCNHGRPT++KL L+D++ LF R
Sbjct: 597 MNALLRDMEATPRSNQCNHGRPTWVKLTLADLDGLFLR 634


>gi|241758859|ref|ZP_04756972.1| DNA mismatch repair protein MutL [Neisseria flavescens SK114]
 gi|241321067|gb|EER57280.1| DNA mismatch repair protein MutL [Neisseria flavescens SK114]
          Length = 658

 Score =  537 bits (1383), Expect = e-150,   Method: Composition-based stats.
 Identities = 218/658 (33%), Positives = 348/658 (52%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ S++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHSDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVTTTPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTN---- 379
                   +++     K  +     ++ KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DGENLFDSASNYPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQRSLSLRESRAAMNTYAE 418

Query: 380 --------DLLPSDDPTYSEDNDPVE--------------ESEATHYQLGIACAQIHQNY 417
                   DL  S        N P E               S++    LG A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSQFEQARFGNMPSETPTPKTDKQCSDGLPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++       + SQ LL P        ECA + +H
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQRLLIPVTFAASHEECAALADH 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++   +I
Sbjct: 539 AEMLTGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLGELAQVGSSQTIEEHENHI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSVRAGRQLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|121602207|ref|YP_989454.1| DNA mismatch repair protein [Bartonella bacilliformis KC583]
 gi|166231105|sp|A1UU01|MUTL_BARBK RecName: Full=DNA mismatch repair protein mutL
 gi|120614384|gb|ABM44985.1| DNA mismatch repair protein MutL [Bartonella bacilliformis KC583]
          Length = 611

 Score =  537 bits (1383), Expect = e-150,   Method: Composition-based stats.
 Identities = 266/611 (43%), Positives = 397/611 (64%), Gaps = 18/611 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  IKEL+EN++DA+++R+E  I  GGK+F +++DNG
Sbjct: 1   MIIRHLSENIINQIAAGEVIERPANVIKELVENAIDAQATRIEISIVNGGKNFIRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+ ++++ +AV RHCTSKI DD SNI   GFRGEALPSIG+V+ L L SR    +   +
Sbjct: 61  CGIPADQLTLAVSRHCTSKIVDDVSNICFLGFRGEALPSIGSVAKLKLTSRTQDADNANE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I++   KI   +P A NPGTIVEVRDLFF  PARL F+K+++ ET+ ITD+I+R+AIA+P
Sbjct: 121 ISVIAGKIEGPKPAAANPGTIVEVRDLFFVTPARLKFMKTDRAETSAITDMIKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGN-FPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ S+      +      N     +RI+Q++G++F  N++ LN +   + L G+T +
Sbjct: 181 HIRFSLSSTDRMLMEFPATENNTQGQLQRITQIMGKEFAPNSIALNAERESVRLTGFTCL 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNR N+   + ++NGR V+DK +   IR AYA+ I   R+ V ++ +++ P  VDVNV
Sbjct: 241 PSFNRSNSLHQFAYVNGRPVRDKLLWGAIRGAYADAIARDRHAVSIIFIDLPPADVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HP K+ +RFR+P +IR  II +I +A+++ G+  +S  S+ ++++F           +  
Sbjct: 301 HPTKADVRFRDPGLIRGLIIGAIHEALHQAGVRHTSTHSESVLTAFQIHPLENLKSAQRP 360

Query: 360 TSLTNTQ----------------EKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATH 403
            S T+                  + + L+E  +   + L +   + +        +E  H
Sbjct: 361 FSYTSQPYHRVSTTTSMLQKPLDDSIDLREGIVPMMECLSAPS-SDTRATIQTSPTEELH 419

Query: 404 YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEII 463
           Y LG A AQIH+NYIISQT D L+IVDQHAAHERL++E ++    S  ++SQ LL PEI+
Sbjct: 420 YPLGAAKAQIHKNYIISQTQDSLIIVDQHAAHERLVYEALKNALYSKPLSSQLLLIPEIV 479

Query: 464 DLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDS 523
           +L E + A ++ H + L + G+  E FGP AI +RE PA+L + N   L++D+ DE  + 
Sbjct: 480 ELSEEDAACLLTHKDSLQKFGLGIEPFGPGAILVRETPAMLGEINAQALIKDLADEAAEY 539

Query: 524 STTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKL 583
            TT  L+  ++ + ATMAC+ S+RSGR ++  EMN LLR++E+ P+SS CNHGRPT+I+L
Sbjct: 540 DTTNNLKAMLDYVAATMACHSSVRSGRLLRPEEMNALLRQIEETPHSSTCNHGRPTYIEL 599

Query: 584 KLSDIEKLFGR 594
           KL+DIE+LFGR
Sbjct: 600 KLADIERLFGR 610


>gi|167745631|ref|ZP_02417758.1| hypothetical protein ANACAC_00323 [Anaerostipes caccae DSM 14662]
 gi|167654943|gb|EDR99072.1| hypothetical protein ANACAC_00323 [Anaerostipes caccae DSM 14662]
          Length = 620

 Score =  537 bits (1383), Expect = e-150,   Method: Composition-based stats.
 Identities = 192/623 (30%), Positives = 305/623 (48%), Gaps = 39/623 (6%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L +K I+ IAAGE+IERP+  +KEL+EN++DA+++ V   I  GG +  ++TDNG G
Sbjct: 4   IQLLDQKTIDNIAAGEVIERPASVVKELVENAIDAKATAVTVEIRDGGMTLMRVTDNGCG 63

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  EE+  A  RH TSKI   +D  ++ + GFRGEAL SI AV  + ++++     +G  
Sbjct: 64  IPKEEVRTAFLRHATSKIRTVEDLVSVSSLGFRGEALSSISAVGQVEVITKTAGAFSGVS 123

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
             I G +   +  +    GT   VR+LF+  PAR  FLKS   E   +  ++  MA+++P
Sbjct: 124 YKIFGGEEQGLDEIGAPDGTTFLVRNLFYNTPARRKFLKSPVTEAGYVEQIMVHMALSHP 183

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            ++F F     N+    + S NGN  + I  + G D     + ++ K   +++ GY G P
Sbjct: 184 DIAFKFIHNSKNKM---YTSGNGNVKDIIYHLYGRDVAGALLPISLKGPTVSVDGYVGKP 240

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
             +RGN N    FINGR ++ K I   I   Y       +YP V L +E++P  +DVNVH
Sbjct: 241 FISRGNRNYESYFINGRYIKSKIIYKAIEDGYKTFTMAHKYPFVCLNIEVEPELLDVNVH 300

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGIST-----------SSVLSKKMISSFHQDN 349
           P K  IRFRN   +   +   I++ ++ + +               VL +KM   F Q  
Sbjct: 301 PTKMEIRFRNEKELYELLASGIKETLSHREMIPKAELGKQKKEAKPVLPEKMPEPFEQVR 360

Query: 350 APKTHLPKYA------------------TSLTNTQEKLFLQENRLSTNDLLPSDDPTYSE 391
             + H  K A                   +    ++ +F   N  + +        T +E
Sbjct: 361 REERHEEKAAEYTAPEIPAGPQGTLKKYAAKPEAKKSVFAGVNYRNDDGKEDLQQMTLNE 420

Query: 392 DNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK 451
            +   EE++           Q+ + Y + +  D L I+DQHAAHE++ +EK+ + F   K
Sbjct: 421 TSLLDEEAKPDR----KVIGQLFKTYWLIEYEDQLFIMDQHAAHEKVNYEKLMKSFREKK 476

Query: 452 ITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQ 511
           I SQ +  P ++ L   E  ++ E  +    LG   E FG N   IR++PA L      +
Sbjct: 477 IYSQGVEPPYVVTLSMAEAKVLEETKDIFQELGFTIEAFGGNEFCIRQVPANLYGLKEKE 536

Query: 512 LLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSS 571
           L  +++D +          + I + +A+MAC  S +  ++M   E+  LL  + +  N  
Sbjct: 537 LFMELLDSLTADGVKKD-PEMITDKIASMACKMSAKGNQRMSLPEVRNLLDLLMECENPY 595

Query: 572 QCNHGRPTFIKLKLSDIEKLFGR 594
            C HGRPT IK+   +IEK F R
Sbjct: 596 TCPHGRPTMIKMSKYEIEKKFKR 618


>gi|326795798|ref|YP_004313618.1| DNA mismatch repair protein mutL [Marinomonas mediterranea MMB-1]
 gi|326546562|gb|ADZ91782.1| DNA mismatch repair protein mutL [Marinomonas mediterranea MMB-1]
          Length = 661

 Score =  536 bits (1382), Expect = e-150,   Method: Composition-based stats.
 Identities = 214/657 (32%), Positives = 348/657 (52%), Gaps = 64/657 (9%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  LS ++ NQIAAGE++ERP+  +KEL+ENSLDAE+++++  I  GG    +I DNG 
Sbjct: 3   RINLLSPRLANQIAAGEVVERPASVVKELLENSLDAEATQLDVDIEQGGVRRMKIRDNGR 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++ +A+ RH TSKIS  DD   + T GFRGEAL SI +VS + L S+    +   
Sbjct: 63  GIVKDDLSLAMSRHATSKISTLDDLEAVQTLGFRGEALASISSVSRMHLTSKAYGEDEAW 122

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           ++   G+ +++  RP +   GT +EVRDLFF  PAR  FL++E+ E N + +V++R+A++
Sbjct: 123 RVEAEGKDMTTAVRPASHPDGTTIEVRDLFFNTPARRKFLRTEKTEFNHLEEVVKRLALS 182

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V F  S      Y +   +   +   R+  ++G+ FI NA+ ++ ++  + L G+ G
Sbjct: 183 RYDVGFRLSHNGKQVYDLRPVTDQLHAEHRLGTLLGKKFIENALTIDVEAAGLRLWGWIG 242

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R  A+  Y F+NGR V+DK +   +R AY + +  GR+P  VL LE+DP  VDVN
Sbjct: 243 LPTFSRSQADLQYFFVNGRVVRDKLVAHAVRQAYRDVLYNGRHPTFVLYLELDPATVDVN 302

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGIST---------------SSVLSKKMIS 343
           VHP K  +RFR+  ++ +F+   I K I      +               +S+ +++   
Sbjct: 303 VHPTKHEVRFRDGRLVHDFLFSRIHKVIADVRPESGEAPTQIGGAPDAEVASMPTQQSRM 362

Query: 344 SFHQDNAPKTHLPKYATSLTNTQ------------------------------------- 366
           +F ++         +     N                                       
Sbjct: 363 AFQREPQSAAGGVPWGAPNNNPVGGEQVRGQLEGLRQLNENANQALGVVGGGEIPQGIDP 422

Query: 367 --------EKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQL-GIACAQIHQNY 417
                             +       +        + V ES+A      G A AQIH  Y
Sbjct: 423 LTGEILELASNSSMPRVETEQTFYRQEGDNGRRFEELVSESDAHDMPPLGYAVAQIHGVY 482

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHD 477
           I+++++ GL++VD HAAHER+++E+M+  F +  + SQ LL P  + + + E  L+ +  
Sbjct: 483 ILAESSVGLIVVDMHAAHERIVYERMKNAFYAKSVPSQPLLVPINVTVSQSEADLVEDSQ 542

Query: 478 EDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENIL 537
                 G K ER G  ++ +RE+P IL   ++  L+RD++ ++  +  T  L+ R   ++
Sbjct: 543 SVFEAFGFKVERTGVESVMVREVPIILINGDVENLVRDVVSDLTVNGATDLLEARANELM 602

Query: 538 ATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           A+MAC+G++R+ RK+   EMN LLR+ME    S QCNHGRPT+ +L +SD++KLF R
Sbjct: 603 ASMACHGAVRANRKLTIAEMNSLLRDMEVTERSGQCNHGRPTWTQLSMSDLDKLFLR 659


>gi|317472766|ref|ZP_07932078.1| DNA mismatch repair protein MutL [Anaerostipes sp. 3_2_56FAA]
 gi|316899758|gb|EFV21760.1| DNA mismatch repair protein MutL [Anaerostipes sp. 3_2_56FAA]
          Length = 620

 Score =  536 bits (1382), Expect = e-150,   Method: Composition-based stats.
 Identities = 192/621 (30%), Positives = 307/621 (49%), Gaps = 35/621 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L +K I+ IAAGE+IERP+  +KEL+EN++DA+++ V   I  GG +  ++TDNG G
Sbjct: 4   IQLLDQKTIDNIAAGEVIERPASVVKELVENAIDAKATAVTVEIRDGGMTLMRVTDNGCG 63

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  EE+  A  RH TSKI   +D  ++ + GFRGEAL SI AV  + ++++     +G  
Sbjct: 64  IPKEEVRTAFLRHATSKIRTVEDLVSVSSLGFRGEALSSISAVGQVEVITKTAGAFSGVS 123

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
             I G +   +  +    GT   VR+LF+  PAR  FLKS   E   +  ++  MA+++P
Sbjct: 124 YKIFGGEEQGLDEIGAPDGTTFLVRNLFYNTPARRKFLKSPVTEAGYVEQIMVHMALSHP 183

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            ++F F     N+    + S NGN  + I  + G D     + ++ K   +++ GY G P
Sbjct: 184 DIAFKFIHNSKNKM---YTSGNGNVKDIIYHLYGRDVAGALLPISLKGPTVSVDGYVGKP 240

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
             +RGN N    FINGR ++ K I   I   Y       +YP V L +E++P  +DVNVH
Sbjct: 241 FISRGNRNYESYFINGRYIKSKIIYKAIEDGYKTFTMAHKYPFVCLNIEVEPELLDVNVH 300

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGIST-----------SSVLSKKMISSF---- 345
           P K  IRFRN   +   +   I++ ++ + +               VL +KM   F    
Sbjct: 301 PTKMEIRFRNEKELYELLASGIKETLSHREMIPKAELGKQKKEAKPVLPEKMPEPFEQVR 360

Query: 346 ----HQDNAPKTHLPKYATSLTNTQEKLFLQENRLST--------NDLLPSDDPTYSEDN 393
               H++ A +   P+       T +K  ++     +        ND    D    + + 
Sbjct: 361 REERHEEKAAEYTAPEIPAGPQGTLKKYAVKPEAKKSVFAGVNYRNDDGKEDLQQMTLNE 420

Query: 394 DPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKIT 453
             + + EA   +      Q+ + Y + +  D L I+DQHAAHE++ +EK+ + F   KI 
Sbjct: 421 TSLLDEEAKPDR--KVIGQLFKTYWLIEYEDQLFIMDQHAAHEKVNYEKLMKSFREKKIY 478

Query: 454 SQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLL 513
           SQ +  P ++ L   E  ++ E  +    LG   E FG N   IR++PA L      +L 
Sbjct: 479 SQGVEPPYVVTLSMAEAKVLEETKDIFQELGFTIEAFGGNEFCIRQVPANLYGLKEKELF 538

Query: 514 RDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQC 573
            +++D +          + I + +A+MAC  S +  ++M   E+  LL  + +  N   C
Sbjct: 539 MELLDSLTADGVKKD-PEMITDKIASMACKMSAKGNQRMSLPEVRNLLDLLMECENPYTC 597

Query: 574 NHGRPTFIKLKLSDIEKLFGR 594
            HGRPT IK+   +IEK F R
Sbjct: 598 PHGRPTMIKMSKYEIEKKFKR 618


>gi|325201860|gb|ADY97314.1| DNA mismatch repair protein MutL [Neisseria meningitidis
           M01-240149]
 gi|325208388|gb|ADZ03840.1| DNA mismatch repair protein MutL [Neisseria meningitidis NZ-05/33]
          Length = 658

 Score =  536 bits (1382), Expect = e-150,   Method: Composition-based stats.
 Identities = 215/658 (32%), Positives = 343/658 (52%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIGLALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E    T ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCTTMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS     PERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPTQS----LPERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLP 383
                   ++      K  +      + KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DSENLFDSASDYPTGNKPDTRNAFGASGKTAPMPYQAARAPQQHSLSLRESRAAMNTYAE 418

Query: 384 SDDPT-----------YSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
               T            +   +   E+ A                    G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSRLEQARFGNMPSETPAPQTDTPLSDGIPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNST-KITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++      K+ SQ LL P        ECA + +H
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGKLQSQRLLIPVTFATSHEECAALSDH 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            + L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++    I
Sbjct: 539 ADALAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLSELAQVGSSQTIEEHENRI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|78065327|ref|YP_368096.1| DNA mismatch repair protein [Burkholderia sp. 383]
 gi|77966072|gb|ABB07452.1| DNA mismatch repair protein MutL [Burkholderia sp. 383]
          Length = 661

 Score =  536 bits (1382), Expect = e-150,   Method: Composition-based stats.
 Identities = 198/644 (30%), Positives = 327/644 (50%), Gaps = 59/644 (9%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L +++I+QIAAGE++ERP+  +KEL+EN++DA +S +  V+  GG     ITD+G G
Sbjct: 23  IQPLPDQLISQIAAGEVVERPASVVKELLENAMDAGASTLRIVLEEGGVKRISITDDGCG 82

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  +E+ +A+ RH TSKI   ++   + T GFRGEAL SI +V+ +++ SR        +
Sbjct: 83  IPPDELALALMRHATSKIRSLEELEAVATLGFRGEALASIASVAEMSITSRTADAAHAMK 142

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I     +   + P A + GT +EVR+L+F  PAR  FLKSEQ E     ++IRR A+A P
Sbjct: 143 I---DAQTGVLSPAAGSTGTTIEVRELYFNTPARRKFLKSEQTEFGHCLEMIRRAALARP 199

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V+ +           N         +R+++++G+ F    + L+E++  + + G  G+P
Sbjct: 200 DVAISVLHNGKAVEHWNATEP----AQRVAKILGDSFATAHLPLDEQAGPLAVYGCAGLP 255

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           T +RG A+Q Y F+NGR V+DK +   +R AY + +   RYP  VL L++ P  VDVNVH
Sbjct: 256 TASRGRADQQYFFVNGRFVRDKLLTHAVRAAYEDVLHGDRYPSYVLFLDLPPEAVDVNVH 315

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVL---SKKMISSFHQDNAPKTHLPK 357
           P+K  +RFR+   I  ++  ++Q+A+ +   ++           +S   +  A     P 
Sbjct: 316 PSKIEVRFRDSRSIHQYVFHAVQRALARHAGASPETTAGGHAAQLSPAPRGPASFLDTPL 375

Query: 358 YATSLTNT-------------QEKLFLQENRLSTNDLLPSDDPTYSED------------ 392
             +   N                  ++++ R++   L  +      +             
Sbjct: 376 GQSQQGNAIGGSGFSPSSSSSSGNTWMRQARMTQGTLPVAQPLALYDALFGRKDTGAGTP 435

Query: 393 ----------------------NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVD 430
                                   P+  +      LG A  QIH  Y+++Q   GLVIVD
Sbjct: 436 DGTTTIARDSADAPLAPLPGFLASPIAATAHDEQPLGFALGQIHGIYVLAQNAHGLVIVD 495

Query: 431 QHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERF 490
            HAAHER+++E+ +       +  Q LL P  +     E   + E  + L  LG      
Sbjct: 496 MHAAHERILYEQFKNALADRSVAVQALLLPISMTATPVEIGTVEEERDTLESLGFDLAVL 555

Query: 491 GPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGR 550
            P  +AIR +PA+L   ++  L R ++ ++     +  L +R   +L T+AC+ ++R+ R
Sbjct: 556 SPTTLAIRAVPALLKDADLQSLARAVLADLHAFGGSRVLTERQHELLGTLACHHAVRANR 615

Query: 551 KMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ++   EMN LLR+ME    + QCNHGRPT+ +L L+D+++LF R
Sbjct: 616 RLTLDEMNALLRQMEATERADQCNHGRPTWYQLTLNDLDRLFMR 659


>gi|319406600|emb|CBI80242.1| DNA mismatch repair protein MutL [Bartonella sp. 1-1C]
          Length = 612

 Score =  536 bits (1382), Expect = e-150,   Method: Composition-based stats.
 Identities = 275/612 (44%), Positives = 394/612 (64%), Gaps = 19/612 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  +KELIEN++DA +SR+E VIA GGKS  +++DNG
Sbjct: 1   MIIRHLSETIINQIAAGEVIERPANVVKELIENAIDAGASRIEIVIANGGKSLIRVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+  +++ +AV RHCTSKI+DD  NI   GFRGEALPSIG+VS L L SR   +++ A+
Sbjct: 61  CGIPEDQLTLAVSRHCTSKITDDVHNICFLGFRGEALPSIGSVSKLKLTSRIQNSDSAAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ++  KI   +P A NPGTIVEVRDLFF  PARL F+KS++ ET  ITD I+R+AIA+P
Sbjct: 121 IIVNAGKIEGPKPSAANPGTIVEVRDLFFVTPARLKFMKSDRSETIAITDTIKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGN-FPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ + I     +      N     +RI+Q++G++F  N++ L+ K   + L G+ G+
Sbjct: 181 HIRFSLAGIDRAPMEFPAMEQNTQGQLQRITQIMGKEFAPNSLILDAKRESVHLTGFIGL 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNR N+   + ++NGR V+DK +   IR AYA+ I   R+ V +L + + P  VDVNV
Sbjct: 241 PSFNRSNSLHQFAYVNGRPVRDKLLWGAIRGAYADVIARDRHAVAILFIHLPPTDVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HPAK  +RFR+P++IR  II +I++A+++ GI  +S  S+ M+++F  +   +T     +
Sbjct: 301 HPAKMDVRFRDPSLIRGLIIGAIREALHQTGIRPTSTDSEAMLAAFRTEPL-ETEKMHQS 359

Query: 360 TSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE-----------------SEAT 402
            S       +  +   +    L  +    + ED  P+ E                 SE  
Sbjct: 360 FSYDARPRHIDPKLTSIFHKPLDINSSIDFQEDTIPIMEHLSTPSGDTRATINALTSEEL 419

Query: 403 HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEI 462
           HY LG A AQIH+NYI++QT D LVIVDQHAAHERL++E ++    S  + SQ LL PEI
Sbjct: 420 HYPLGAARAQIHKNYIVAQTQDSLVIVDQHAAHERLVYEALKNALYSQPLPSQLLLIPEI 479

Query: 463 IDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIID 522
           ++L E +   ++ H + L + G+  E FG  AIA+ E P++L + NI  L++D+ DE  +
Sbjct: 480 VELSEEDATCLLSHKDALKKFGLGIESFGIGAIAVHETPSMLGEINIQALIKDLADEATE 539

Query: 523 SSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIK 582
             T   L+  ++ + ATMAC+ SIRSGR +   EMN LLR++E  PNS+ CNHGRPT+I+
Sbjct: 540 YDTIDNLKGMLDYVAATMACHSSIRSGRLLHPEEMNALLRQIEATPNSATCNHGRPTYIE 599

Query: 583 LKLSDIEKLFGR 594
           LKL+DIE+LFGR
Sbjct: 600 LKLADIERLFGR 611


>gi|298368806|ref|ZP_06980124.1| DNA mismatch repair protein MutL [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298282809|gb|EFI24296.1| DNA mismatch repair protein MutL [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 665

 Score =  536 bits (1382), Expect = e-150,   Method: Composition-based stats.
 Identities = 216/665 (32%), Positives = 348/665 (52%), Gaps = 76/665 (11%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA+++ +E  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDADATAIEVELAGGGIRLIRVSDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   +    
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQDGSAHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+S+    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSNPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDF-INNAVELNEKSNEITLQGYTG 238
           P ++F+        +K+       N  ERI+ ++GEDF    ++E++  +  + L G   
Sbjct: 183 PHIAFSLKRDGKQVFKLPA----QNLHERIAAIVGEDFQAAASLEIDSGNGALRLYGAIA 238

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVN
Sbjct: 239 KPTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVN 298

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINK-------------------KGISTSSVLSK 339
           VHP K+ IRFR+   +   +  ++ KA+                      GI  ++  S+
Sbjct: 299 VHPTKTEIRFRDSQQVHQLVFHTLNKALADTRADLTESVGNAGEVLHEITGIRPAATSSE 358

Query: 340 KMISSFHQDNAP------------------------KTHLPKYATSLTNTQEKLFLQENR 375
              S FH +                           KT    Y  +    Q  L L+E+R
Sbjct: 359 NEHSGFHPNPTASSENIFAAAPSAHTSEPRNAFSSGKTAPMPYQAARAPQQRSLSLRESR 418

Query: 376 LSTNDLLPSDDPTYSEDND-------------------------PVEESEATHYQLGIAC 410
            + N        T +++ D                           ++ +     LG A 
Sbjct: 419 AALNTYAELFKNTAADEADIELAQFEQARFGSTSATSSENSARSFSDDPKPELPPLGFAI 478

Query: 411 AQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGE 469
           AQ+   YI++Q  D L+++D HAA ER+ +EKM++       + SQ LL P        E
Sbjct: 479 AQLLGIYILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQRLLIPVTFAASHEE 538

Query: 470 CALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTL 529
           CA + +H + L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+
Sbjct: 539 CAALADHADTLAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLGELAQVGSSQTI 598

Query: 530 QDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIE 589
           ++   +ILATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++
Sbjct: 599 EEHENHILATMSCHGSVRAGRQLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELD 658

Query: 590 KLFGR 594
            LF R
Sbjct: 659 ALFLR 663


>gi|261400853|ref|ZP_05986978.1| DNA mismatch repair protein MutL [Neisseria lactamica ATCC 23970]
 gi|269209324|gb|EEZ75779.1| DNA mismatch repair protein MutL [Neisseria lactamica ATCC 23970]
          Length = 658

 Score =  536 bits (1381), Expect = e-150,   Method: Composition-based stats.
 Identities = 216/658 (32%), Positives = 341/658 (51%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++GEDF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGEDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLP 383
                   ++      K  +     ++ KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DNENLFDSASDYPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQRSLSLRESRAAINTYAE 418

Query: 384 SDDPT-----------YSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
               T            +   +   E+ A                    G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSRFEQARFGNMPSETPAPQTDTPLSDGIPSPSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM RQ   + ++ SQ LL P        ECA + ++
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRRENGRLQSQRLLIPVTFAASHEECAALADY 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R  PA+L K ++  L RD++ E     ++ T+++    I
Sbjct: 539 AETLAGFGLELSDMGGNTLAVRAAPAMLGKSDVVSLARDVLGEFAQVGSSQTIEEHENRI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|319410690|emb|CBY91069.1| DNA mismatch repair protein MutL [Neisseria meningitidis WUE 2594]
          Length = 658

 Score =  536 bits (1381), Expect = e-150,   Method: Composition-based stats.
 Identities = 214/658 (32%), Positives = 340/658 (51%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  + GGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELDGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      +I  +A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMIELLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  S  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGDDFQTASLEIDSGSGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRANLTESVGNAGEVLHDITGVVSTPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLP 383
                   ++      K  +     ++ KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DSENLFDSASDYPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMNTYAE 418

Query: 384 SDDPT-----------YSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
               T            +   +   E+                      G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELNRLEQARFGNMPSETPIPKTDTPLSDGLPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM RQ   + K+ SQ LL P        ECA + +H
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRRENGKLQSQRLLIPSTFAASHEECAALADH 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++    I
Sbjct: 539 AEALAGFGLELSDMGGNTLAVRTVPAMLGKADVVSLAKDVLGELAQVGSSQTIEEHENRI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSVRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|91206202|ref|YP_538557.1| DNA mismatch repair protein [Rickettsia bellii RML369-C]
 gi|122990884|sp|Q1RGP6|MUTL_RICBR RecName: Full=DNA mismatch repair protein mutL
 gi|91069746|gb|ABE05468.1| DNA mismatch repair protein MutL [Rickettsia bellii RML369-C]
          Length = 611

 Score =  536 bits (1381), Expect = e-150,   Method: Composition-based stats.
 Identities = 250/610 (40%), Positives = 373/610 (61%), Gaps = 16/610 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LSE  IN+IAAGE+IERP+  +KEL+EN++DA S++++ ++   GK+   I+D+G
Sbjct: 1   MTIKLLSESTINRIAAGEVIERPASVVKELVENAVDAGSTKIDIILERAGKNLIIISDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +E+ +AV+RH TSK+ + DF NIHTFGFRGEALPSI A+S + + S+   N    
Sbjct: 61  VGMTDKELEIAVERHTTSKLDETDFLNIHTFGFRGEALPSIAAISKMLITSKKRDNQKAF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G     + P   N GT +E+RDLFF  PARL FL++++ E     DV++++A+A+
Sbjct: 121 QIKLIGGDEKQIAPAIHNEGTKIEIRDLFFATPARLKFLRTDKTELAATVDVVKKIALAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQS--TNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P++SF+ +       K+  Q+     N  +RI  VIGEDFI NA  ++ KS + ++ GYT
Sbjct: 181 PEISFSLTHDGKTLLKLKGQNKDAENNLKQRIIDVIGEDFIKNASYIDFKSPDFSIYGYT 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
            IPT+NR ++   ++FIN R V+DK +   +R AY + +P  RYP+  + L+IDP+ VDV
Sbjct: 241 SIPTYNRASSEDQFLFINNRPVKDKLLQVALRVAYQDYMPRDRYPLCAIFLQIDPQLVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL-- 355
           NVHPAK+ +RF +P  +RN +I SI+ A++ K    S+ ++   I  F      K     
Sbjct: 301 NVHPAKAEVRFHDPNYVRNLLIDSIKNALSNKSHIASTTIASSAIELFKNPFVNKEPAIS 360

Query: 356 ---------PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQL 406
                     +Y  + + T  K     +     D LP        +     E + +    
Sbjct: 361 KPLNVNSKPSEYRPATSPTVPKYTPNNSCQKLIDTLPHARIEQEVEQRIQNEPQKSSQYR 420

Query: 407 -GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDL 465
            G A AQ+H  Y+ISQT D +VI DQHAAHERL +EK++    + ++  Q LL PEI++L
Sbjct: 421 LGAAKAQLHTTYVISQTEDSIVITDQHAAHERLGYEKIKNYIKNEELIKQRLLIPEIVEL 480

Query: 466 L-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSS 524
             E    ++ E+ + L +LG+  E+FG  +I + EIP IL   N+ +L++D+ D + +  
Sbjct: 481 PDEKRADILYENKDKLSKLGLSLEKFGEKSIIVTEIPNILGDINVQKLIQDLADHLAECG 540

Query: 525 TTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLK 584
               L + IE++  T AC+ SIR+GRK+ + EMN LLR+ME  P S QCNHGRPT+I+LK
Sbjct: 541 ENIALTELIEHVTETYACHYSIRAGRKLSADEMNALLRQMENTPFSGQCNHGRPTYIELK 600

Query: 585 LSDIEKLFGR 594
           L DIE+LFGR
Sbjct: 601 LKDIERLFGR 610


>gi|115350714|ref|YP_772553.1| DNA mismatch repair protein [Burkholderia ambifaria AMMD]
 gi|115280702|gb|ABI86219.1| DNA mismatch repair protein MutL [Burkholderia ambifaria AMMD]
          Length = 661

 Score =  536 bits (1380), Expect = e-150,   Method: Composition-based stats.
 Identities = 199/644 (30%), Positives = 332/644 (51%), Gaps = 59/644 (9%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L +++I+QIAAGE++ERP+  +KEL+EN++DA ++ +  V+  GG     ITD+G G
Sbjct: 23  IQPLPDQLISQIAAGEVVERPASVVKELLENAMDAGATTLRIVLEEGGVKRISITDDGCG 82

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  +E+P+A+ RH TSKI   ++   + T GFRGEAL SI +V+ +++ SR  +     +
Sbjct: 83  IPPDELPLALMRHATSKIRSLEELEAVATLGFRGEALASIASVAEMSITSRTAEVAHATK 142

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I        ++ P A   GT +EVR+L+F  PAR  FLKSEQ E     ++IRR A+A P
Sbjct: 143 I---DATTGALSPAAGAVGTTIEVRELYFNTPARRKFLKSEQTEFGHCLEMIRRAALARP 199

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V+ +           N         +R+++++G+ F    + L+E++  + + G  G+P
Sbjct: 200 DVAISVLHNGKAVEHWNATEP----AQRVAKILGDGFATAHLPLDEQAGPLAVYGCAGLP 255

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           T +RG A+Q Y F+NGR V+DK +   +R AY + +   RYP  VL L++ P  VDVNVH
Sbjct: 256 TASRGRADQQYFFVNGRFVRDKLLTHAVRAAYEDVLHGDRYPSYVLFLDLPPEAVDVNVH 315

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVL---SKKMISSFHQDNAPKTHLP- 356
           P+K  +RFR+   I  ++  ++Q+A+ +   ++           +S      A   + P 
Sbjct: 316 PSKIEVRFRDSRSIHQYVFHAVQRALARHAGASPETTAGGHAAQLSPAPGGPASFLNTPL 375

Query: 357 -------------KYATSLTNTQEKLFLQENRLS-------------------------- 377
                           +S +++    ++++ R++                          
Sbjct: 376 GLGAASGTGGSGFSSPSSSSSSAGNTWMRQARMTQGTLPVAQPLALYDALFGRKDTGAGT 435

Query: 378 -------TNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVD 430
                   +D   +          P+  +      LG A  QIH  Y+++Q   GLVIVD
Sbjct: 436 PDGTTVIAHDSASAPTMPPGFVASPLAATAHDEQPLGFALGQIHGIYVLAQNAHGLVIVD 495

Query: 431 QHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERF 490
            HAAHER+++E+ +       I  Q+LL P  +     E   + E  + L  LG      
Sbjct: 496 MHAAHERILYEQFKNALADRTIAVQSLLLPISMTATPVEIGTVEEERDTLESLGFDLAVL 555

Query: 491 GPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGR 550
            P  +AIR +PA+L   ++  L R ++ ++     +  L +R   +L T+AC+ ++R+ R
Sbjct: 556 SPTTLAIRAVPALLKDADLQSLARAVLADLHAFGGSRVLTERQHELLGTLACHHAVRANR 615

Query: 551 KMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ++   EMN LLR+ME    + QCNHGRPT+ +L L+D+++LF R
Sbjct: 616 RLTLDEMNALLRQMEATERADQCNHGRPTWYQLTLNDLDRLFMR 659


>gi|325136514|gb|EGC59118.1| DNA mismatch repair protein MutL [Neisseria meningitidis M0579]
          Length = 658

 Score =  536 bits (1380), Expect = e-150,   Method: Composition-based stats.
 Identities = 213/658 (32%), Positives = 339/658 (51%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  + GGG     ++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELDGGGIRLIHVSDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSLLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS        GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAATHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  S  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGDDFQTASLEIDSGSGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRANLTESVGNAGEVLHDITGVVSTPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLP 383
                    ++     K  +     ++ KT    Y ++    Q  L L+E+R + N    
Sbjct: 359 DSENLFDSVSNYPTGNKSDTHNAFGSSGKTAPMPYQSAYAPQQRSLSLRESRAAMNTYAE 418

Query: 384 SDDPT-----------YSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
               T            +   +   E+ A                    G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSRFEQARFGNMPSETPAPQTDTPLSDGIPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++       + SQ LL P        ECA + +H
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQRLLIPVTFAASHEECAALADH 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R  PA+L K ++  L RD+++E     ++ T+++   +I
Sbjct: 539 AEALAGFGLELSDMGGNTLAVRAAPAMLGKSDVVSLARDVLNEFAQVGSSQTIEEHENHI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|255066273|ref|ZP_05318128.1| DNA mismatch repair protein MutL [Neisseria sicca ATCC 29256]
 gi|255049483|gb|EET44947.1| DNA mismatch repair protein MutL [Neisseria sicca ATCC 29256]
          Length = 664

 Score =  536 bits (1380), Expect = e-150,   Method: Composition-based stats.
 Identities = 215/664 (32%), Positives = 346/664 (52%), Gaps = 75/664 (11%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ +E  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIEVELAGGGIRLIRVSDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS L L SR   +    
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLILTSRQDGSAHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+S+    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSNPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++GEDF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGEDFQAASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK-------------------KGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                      GI  ++  S+ 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRADLTESVSNAGEVLHEITGIRPTATSSEN 358

Query: 341 MISSFHQDNAP------------------------KTHLPKYATSLTNTQEKLFLQENRL 376
               F Q+                           KT    Y  +    Q  L L+E+R 
Sbjct: 359 EHHQFLQNPTASSENIFAAAPNTHASEPRSTFGSGKTAPMPYQAARAPQQRSLSLRESRA 418

Query: 377 STNDLLPSDDPTYSEDND-------------------------PVEESEATHYQLGIACA 411
           + N        T +++ D                           ++ +     LG A A
Sbjct: 419 ALNTYAELFKNTAADEADIELAQFEQARFGNTTATSSENPARAFSDDPKPELPPLGFAIA 478

Query: 412 QIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGEC 470
           Q+   YI++Q  D L+++D HAA ER+ +EKM++       + SQ LL P        EC
Sbjct: 479 QLLGIYILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQRLLIPVTFAASHEEC 538

Query: 471 ALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQ 530
           A + +H + L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T++
Sbjct: 539 AALADHGDTLAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLGELAQVGSSQTIE 598

Query: 531 DRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEK 590
           +   +ILATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ 
Sbjct: 599 EHENHILATMSCHGSVRAGRQLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDA 658

Query: 591 LFGR 594
           LF R
Sbjct: 659 LFLR 662


>gi|294787957|ref|ZP_06753201.1| DNA mismatch repair protein MutL [Simonsiella muelleri ATCC 29453]
 gi|294484250|gb|EFG31933.1| DNA mismatch repair protein MutL [Simonsiella muelleri ATCC 29453]
          Length = 626

 Score =  536 bits (1380), Expect = e-150,   Method: Composition-based stats.
 Identities = 218/626 (34%), Positives = 339/626 (54%), Gaps = 37/626 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I +L   +INQIAAGE++ERP+ A+KE++ENSLDA +S+V   I GGG    ++TDNG 
Sbjct: 3   RIAQLPNHLINQIAAGEVVERPANALKEILENSLDAGASQVSVEITGGGIKLIRVTDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++++P+A+ RH TSKI    D  ++ + GFRGE L SI +VS LTL SR  +     
Sbjct: 63  GIHADDLPLALSRHATSKIKNLSDLEHVRSMGFRGEGLASIASVSRLTLTSRTAELPHAH 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +I      +S +   +   GT VEV +LFF  PAR  FLKSE  E      ++ R+A+A 
Sbjct: 123 EIRAEDGVLSPIAAASHPIGTTVEVCELFFNTPARRQFLKSENTEYAHCATMLERLALAN 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P+V+F+      + +    Q+      +R+  ++GEDF    + ++   N + + G+   
Sbjct: 183 PQVAFSLKNNGKSVFNYPAQT----LAQRVGTIVGEDFQAACLPVDSGENILRVHGFVSK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G ++  + F+N R V+DK IL  ++ AY + +     P  VL L+I P  VDVNV
Sbjct: 239 PTFAKGKSDMQFCFVNNRFVRDKVILHAVKQAYRDVLHNQIVPAFVLFLDIPPELVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSK-------------------K 340
           HP K+ +RFR+   +   I  ++ K + +     +  +S                    K
Sbjct: 299 HPTKTEVRFRDSQAVHQLIFHNLNKVLAETRADVTDSVSNAGDILHERILPNDTFSGSLK 358

Query: 341 MISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDL------------LPSDDPT 388
             +S +  N  K     YA      Q  L L+E+R + N              L      
Sbjct: 359 SENSNNYSNNQKVAPANYAAFRAPIQRNLSLKESRAAMNTYAELYRQDNELAELEQTRLN 418

Query: 389 YSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFN 448
            + +N      E   Y LG A AQ+   YI+SQT++GL++VD HAA ER+ +EKM+    
Sbjct: 419 VAPENPKNNHVENQEYPLGFALAQLLGIYILSQTSEGLILVDMHAAAERVNYEKMKTQRL 478

Query: 449 STKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKN 508
           S  + +Q LL P        E A + +H + LH  G++ +  G   IAI  IPA+L + +
Sbjct: 479 SGSLKTQMLLIPMRFQATHEERATLADHADTLHEYGLQLQDLGDGQIAILAIPAMLGQAD 538

Query: 509 IPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNP 568
              L +D++ E+    ++  ++     I++TMAC+GS+R+GR++   EMN LLR+ME  P
Sbjct: 539 AVALAQDVLRELACVGSSQIVEKLENQIISTMACHGSVRAGRQLTQPEMNALLRDMENTP 598

Query: 569 NSSQCNHGRPTFIKLKLSDIEKLFGR 594
            S+QCNHGRPT+++L L+D++ LF R
Sbjct: 599 RSNQCNHGRPTWVRLALTDLDALFLR 624


>gi|332283318|ref|YP_004415229.1| DNA mismatch repair protein [Pusillimonas sp. T7-7]
 gi|330427271|gb|AEC18605.1| DNA mismatch repair protein [Pusillimonas sp. T7-7]
          Length = 624

 Score =  535 bits (1379), Expect = e-150,   Method: Composition-based stats.
 Identities = 203/624 (32%), Positives = 333/624 (53%), Gaps = 38/624 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            I +L + +I+QIAAGE+IERP+  +KEL+EN++DA +  +E  + GGG     ++D+G 
Sbjct: 6   SIAQLPDLLISQIAAGEVIERPASVLKELLENAIDAGARAIEVRLDGGGIRRISVSDDGS 65

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+   E+ +A+ RH TSKIS  D+   +++ GFRGEAL S+ +V+ LTL SR        
Sbjct: 66  GIPKSELKLALTRHATSKISSLDELEAVNSMGFRGEALASVASVARLTLTSRSAAEPHAW 125

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI    ++       + + GT ++VR LF  +PAR  FL++E  E     D + R+A+A+
Sbjct: 126 QIEAEQDE---PSAASGSMGTTIDVRQLFDNVPARRKFLRAEATEYGHCVDALERIALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F        +             +R+  V+G++F +  + +  +   I+LQG    
Sbjct: 183 PHIAFRLFHNDKAQRNWRA----SEVGQRVRDVLGQEFTDQGLYVEHEQGLISLQGVITR 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT+ R  A++ Y+++NGR V+D+ +   +R AYA+ +   R P  VL L IDP  VDVNV
Sbjct: 239 PTYARSRADRQYLYVNGRYVKDRTVAHAVRQAYADVLHGDRQPAFVLFLTIDPAMVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HPAK  +RFR    I  F+ Q++ + ++  G  + +              A       YA
Sbjct: 299 HPAKHEVRFRESGAIHRFVNQTLTQVLSAAGGQSLATSELAANHPTESAQAGTMSTDSYA 358

Query: 360 TSL-------------------------TNTQEKLF----LQENRLSTNDLLPSDDPTYS 390
           T                              Q++ F        R      L       +
Sbjct: 359 TEPGIHQPAPTGAGGIADGQAPIPAPYRPQQQQQTFRLHEQAPGRKQDWQSLYRPLDAPA 418

Query: 391 EDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST 450
              D  + + A  + LG+A  Q+H  YI++Q  DGLV+VD HAAHER+++E++++  ++ 
Sbjct: 419 VHADVADSTGAAEFPLGMALGQLHGIYILAQNHDGLVLVDMHAAHERVVYEELKKAMDAQ 478

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
            +  Q LL P + +  E +  LI EH   L+ LG+     GPN+ A+R +PA+L+  +I 
Sbjct: 479 SLPRQELLVPVVFNATEKDIGLIEEHAHTLNELGLSIRPAGPNSAAVRAVPALLANGDIE 538

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
            L R ++ ++     +  L ++   +L+TMAC+GS+R+ R++   EMN LLR+ME+   +
Sbjct: 539 ALARSVLRDLASVGVSPRLTEQRNELLSTMACHGSVRANRRLTLDEMNGLLRKMEQTERA 598

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
            QCNHGRPT+++ K+ +++KLF R
Sbjct: 599 DQCNHGRPTWVQWKVGELDKLFMR 622


>gi|187477234|ref|YP_785258.1| DNA mismatch repair protein [Bordetella avium 197N]
 gi|123752220|sp|Q2KX20|MUTL_BORA1 RecName: Full=DNA mismatch repair protein mutL
 gi|115421820|emb|CAJ48337.1| DNA mismatch repair protein [Bordetella avium 197N]
          Length = 621

 Score =  535 bits (1378), Expect = e-150,   Method: Composition-based stats.
 Identities = 204/621 (32%), Positives = 331/621 (53%), Gaps = 35/621 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            I +L + +I+QIAAGE+IERP+  +KE++EN++DA +  +E  + GGG     ++D+GF
Sbjct: 6   PIAQLPDLLISQIAAGEVIERPASVLKEILENAIDAGARAIEIRLEGGGIRRIAVSDDGF 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  EE+P+AV +H TSKI    +  ++ + GFRGEAL SI +V+ LT++SR    +   
Sbjct: 66  GIPPEELPLAVAQHATSKIRSLSELESVASMGFRGEALASIASVARLTIISRVRNGDHAW 125

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI  S  +I    P +  PGT V+VR LF  +PAR  FL+SE  E     D + R+A+A 
Sbjct: 126 QIDASSGEI---SPASGPPGTTVDVRQLFDNVPARRKFLRSEATEFGHCLDALERIALAN 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P+++F        + +        +  +RI  V+G +F   A+ ++ +   I L G    
Sbjct: 183 PQIAFRLFHHDKAQRQWLP----ADPGQRIRDVLGAEFAGQALPVDTRYGAIGLMGMVTR 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT  R  A++ Y+++NGR V+D+ +   +R+AYA+ +   R P  VL LE+DP  VDVNV
Sbjct: 239 PTAARARADRQYLYVNGRYVRDRTVSHALRSAYADVLHGDRQPAYVLYLEVDPAAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDN---------- 349
           HPAK  +RFR+   +  F+ Q + +A+ + G + +             +           
Sbjct: 299 HPAKHEVRFRDSGAVHRFVSQVVGQALAQTGGAQALDAEDPPPEPIRPETPPPPSLSPAA 358

Query: 350 ----------------APKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDN 393
                            P + +P           + +    R               +  
Sbjct: 359 ALPSAPAQPPAAPYPSRPHSQMPFRLQEPAGVSARDWQSLYRPLAEPGATPQTADRPQAA 418

Query: 394 DPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKIT 453
            P        + LG+A  Q+H  YI++Q   GLV+VD HAAHER+++E+++   +   + 
Sbjct: 419 APARLVSEEEHPLGMALGQLHGVYILAQNARGLVLVDMHAAHERVVYEQLKHALDERSLP 478

Query: 454 SQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLL 513
            Q LL P +    E + AL  E+ E L  LG +    GP +IA+R +PA+L++ +I  L 
Sbjct: 479 RQDLLVPVVFHAQEKDVALAEEYAEQLSELGFEMRPSGPTSIAVRSVPALLARGDIEGLA 538

Query: 514 RDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQC 573
           R ++ ++     +  L ++   +L+TMAC+GS+R+ R++   EMN LLR+ME    + QC
Sbjct: 539 RAVLRDLGAVGASQLLTEQRNELLSTMACHGSVRANRRLTIEEMNALLRQMEATERADQC 598

Query: 574 NHGRPTFIKLKLSDIEKLFGR 594
           NHGRPT+I+  ++D++KLF R
Sbjct: 599 NHGRPTWIQWTVNDLDKLFLR 619


>gi|117924347|ref|YP_864964.1| DNA mismatch repair protein MutL [Magnetococcus sp. MC-1]
 gi|117608103|gb|ABK43558.1| DNA mismatch repair protein MutL [Magnetococcus sp. MC-1]
          Length = 632

 Score =  535 bits (1378), Expect = e-150,   Method: Composition-based stats.
 Identities = 231/624 (37%), Positives = 358/624 (57%), Gaps = 31/624 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           ++++L E + NQIAAGE++ERP+  IKEL+ENS+DA +S +E     GGK   Q+ DNG 
Sbjct: 8   RVQQLPETLANQIAAGEVVERPASVIKELVENSIDAGASLIEVKAEQGGKRLMQVVDNGH 67

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           GM+ +E  +A+ RH TSKI   +D   I T GFRGEALPS+G+V+ L L +R  +N  G 
Sbjct: 68  GMSEDEASLALTRHATSKIHTAEDLFRIATLGFRGEALPSVGSVAQLELATRIEENADGV 127

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + + G    + + +AM  GT V VR+LFF  PARL FLK+++ E N I ++++R AIAY
Sbjct: 128 ALTVMGGARQASKRLAMPVGTRVTVRNLFFNTPARLKFLKADRTEANQIMELMQRFAIAY 187

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V F  S            +    + ER+  V+G +FI N +E+N    ++ ++G+ G+
Sbjct: 188 PHVGFKLSLNGKEVQHYRAVADESAYVERLGAVLGAEFIPNCMEINSGDAQMRVRGWVGL 247

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT NRG+A+  ++F+NGR V+DK + + +R AY + +P  R+P+  L +++DP +VDVNV
Sbjct: 248 PTLNRGSASAMHLFVNGRWVRDKVVTAAVREAYRDLMPRERFPLTALFVQVDPEEVDVNV 307

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDN---------- 349
           HPAK+ +RFR+   +   + +++ + ++  G          + S+               
Sbjct: 308 HPAKAEVRFRHGQSVYGLLRRTLAEVLHGMGARCYQASEAPLQSAEEPPEYGADLGKQRL 367

Query: 350 -----------APKTHLPKYATSLTNTQEKLFLQENRLSTNDLL-------PSDDPTYSE 391
                       P+   P Y  +         +          L        S  P    
Sbjct: 368 AEPVQLPAAVSQPERWRPSYPPAGEGVPRAAAVANWSPQRQGALPLQSRDSYSPAPGQPR 427

Query: 392 DNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST- 450
              P  E+   H  LG A AQ+H  YI++Q+  G+V++DQHAAHER+++E+M+  +    
Sbjct: 428 PTAPHHEAAMDHGPLGQAVAQLHNLYIVAQSEQGMVLIDQHAAHERIVYERMKGAWARKE 487

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
           K+ +Q LL PE++ L E E   +      L +LGI  E FG NA  IRE+PA+L++  I 
Sbjct: 488 KVETQMLLMPEVLQLSEVEAERMSHWRSTLQQLGIAVEPFGQNAFVIREVPALLARGQIA 547

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
            L+RD+++++        L +  + +LA+MAC+GS+RSGR +   EMN LLREME+ P++
Sbjct: 548 PLVRDVVEQLEQVGQESALSEAQDAVLASMACHGSVRSGRALTREEMNALLREMERTPHT 607

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
            QCNHGRPT ++L L+D+E+LF R
Sbjct: 608 GQCNHGRPTHVRLSLADLERLFER 631


>gi|260438406|ref|ZP_05792222.1| DNA mismatch repair protein HexB [Butyrivibrio crossotus DSM 2876]
 gi|292808992|gb|EFF68197.1| DNA mismatch repair protein HexB [Butyrivibrio crossotus DSM 2876]
          Length = 627

 Score =  535 bits (1378), Expect = e-149,   Method: Composition-based stats.
 Identities = 191/630 (30%), Positives = 310/630 (49%), Gaps = 41/630 (6%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I  L +  IN+IAAGE+++RPS  +KEL+EN++DA ++ +   I  GG S  +ITDNG
Sbjct: 1   MAINLLDKNTINKIAAGEVVDRPSSVVKELVENAIDAGATAITVEIKDGGISLIRITDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+   E+ +A  RH TSKI    D + I + GFRGEAL SI AV+ + L+++     TG
Sbjct: 61  CGIDKNEVRLAFLRHSTSKIKSAADLAGISSLGFRGEALSSISAVAQVELITKTKDALTG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +  I G        V    GT   VR+LF+  PAR  FLK+   E   I+ ++  + ++
Sbjct: 121 TRYQIDGGTEKVFEEVGAPDGTTFLVRNLFYNTPARRKFLKTPATEGGYISSLMENLCLS 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           +P++S  F      + +    + NG   + I  V G +  +N +E++ + N+ +++GY G
Sbjct: 181 HPEISIRFINNNQPKIQ---TTGNGKLKDNIYVVYGREITSNLLEIDRQFNDYSIKGYVG 237

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P  +RGN N    +INGR V+   +   I  AYA  I   +YP   L + I+P  +DVN
Sbjct: 238 KPLISRGNRNFENYYINGRYVKSNIVARAIEDAYAGFIMQHKYPFTSLHITINPELLDVN 297

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSK-KMISSFHQDNAPKTH--- 354
           VHP+K  +RF N   I N + +SI  A+  + +     L K K       +   K     
Sbjct: 298 VHPSKMELRFSNEQEIYNNVKESILLALTHRELIPEINLEKAKKEEPLKVEYNKKEPDTV 357

Query: 355 ------------------------LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYS 390
                                   +P+    L + +     +  R    + +  +     
Sbjct: 358 VNYEKAVEKQPETVNEKEPVIVRKVPEVKKPLVSARMPEPFETKRAVVYEEVVKEIKQQE 417

Query: 391 EDNDPV-----EESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQ 445
           E          E  +  + +      Q+   Y I +  + + IVDQHAAHE+++FE+  +
Sbjct: 418 EPKQLELFKVNELLKKENKKDIKIIGQLFDTYWIMEFENSMYIVDQHAAHEKVLFERFMK 477

Query: 446 DFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILS 505
            +N   ITSQ +  P +  L   E  +  +++E L + G + E FG   +AIR IPA  S
Sbjct: 478 RYNDRSITSQMINPPVVFSLTTEEQNVYKDNEEYLAQFGYEIEDFGGGELAIRGIPADFS 537

Query: 506 KKNIPQLLRDIIDEI-IDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREM 564
           + +  ++  +I+D + ID        + I+N +ATM+C  +++   ++   EM +L+ E+
Sbjct: 538 EADPKEIFTEIMDSLCIDYGKNT--PETIKNRIATMSCKAAVKGNNRLNIKEMEKLMDEL 595

Query: 565 EKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            +  N   C HGRPTFI +   ++EK F R
Sbjct: 596 MELENPYNCPHGRPTFITISKYELEKKFKR 625


>gi|254805223|ref|YP_003083444.1| DNA mismatch repair protein MutL [Neisseria meningitidis alpha14]
 gi|254668765|emb|CBA06657.1| DNA mismatch repair protein MutL [Neisseria meningitidis alpha14]
          Length = 658

 Score =  535 bits (1377), Expect = e-149,   Method: Composition-based stats.
 Identities = 214/658 (32%), Positives = 346/658 (52%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   +    
Sbjct: 63  GIHPDDIKLALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQDGSAHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSEATEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  S  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGDDFQTASLEIDSGSGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVVSTPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLL- 382
                   ++      K  +     ++ KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DSENLFDSASDYPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQRSLSLRESRAAMNTYAE 418

Query: 383 ----------------------PSDDPTYSEDNDPVEE---SEATHYQLGIACAQIHQNY 417
                                    +    + + P+ +   S++    LG A AQ+   Y
Sbjct: 419 LYKKTDGIDLELNRLEQARFGNMPSEMPIPKTDAPLSDGIPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNST-KITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++      K+ SQ LL P        ECA + +H
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGKLQSQRLLIPVTFAASHEECAALSDH 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            + L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++   +I
Sbjct: 539 ADALAGFGLELSDMGGNTLAVRAVPAMLGKADVVSLAKDVLGELAQVGSSQTIEEHENHI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSIRAGRRLTLPEMNVLLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|296314214|ref|ZP_06864155.1| DNA mismatch repair protein MutL [Neisseria polysaccharea ATCC
           43768]
 gi|296839113|gb|EFH23051.1| DNA mismatch repair protein MutL [Neisseria polysaccharea ATCC
           43768]
          Length = 658

 Score =  535 bits (1377), Expect = e-149,   Method: Composition-based stats.
 Identities = 213/658 (32%), Positives = 342/658 (51%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ +E  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIEVELAGGGIRLIRVSDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQNDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  S  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPTQS----LHERIAAIVGDDFQTASLEIDSGSGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLP 383
                   +++     K  +     ++ KT    Y ++    Q  L L+E+R + N    
Sbjct: 359 DSENLFNRASNYPTGNKPDTRNAFGSSGKTAPMPYQSAYAPQQRSLPLRESRAAMNTYAE 418

Query: 384 SDDPT-----------YSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
               T            +   +   E+ A                    G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSRFEQARFGNMPSETPAPKTDTPLSDGIPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++       + SQ LL P        ECA + ++
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGRLQSQRLLIPVTFAASHEECAALADY 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R  PA+L K ++  L +D+++E     ++ T+++    I
Sbjct: 539 AETLAGFGLELSDMGGNTLAVRAAPAMLGKADVVSLAKDVLNEFAQVGSSQTIEEHENRI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSVRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|288940953|ref|YP_003443193.1| DNA mismatch repair protein MutL [Allochromatium vinosum DSM 180]
 gi|288896325|gb|ADC62161.1| DNA mismatch repair protein MutL [Allochromatium vinosum DSM 180]
          Length = 642

 Score =  534 bits (1376), Expect = e-149,   Method: Composition-based stats.
 Identities = 206/637 (32%), Positives = 354/637 (55%), Gaps = 44/637 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            IR LS+ ++NQIAAGE++ERP+  IKELIENSLDA  +R+E  +  GG    ++ D+G 
Sbjct: 4   PIRVLSDHLVNQIAAGEVVERPASVIKELIENSLDAGCARLEIDVEQGGIKRLRVRDDGR 63

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSR-------- 111
           G+  +++ +A+ RH TSK+ +  D   + T GFRGEALPSI +VS LTL SR        
Sbjct: 64  GIARDQLALALARHATSKLFELADLEAVGTLGFRGEALPSIASVSRLTLTSRVRPDSDDA 123

Query: 112 ---PPQNNTGAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLI 168
                 ++          ++   RP A   GT VEVRDLFF  PAR  FL++E+ E + +
Sbjct: 124 ASDRAGDSAWEVAVAIDGRLEGPRPAAHPSGTSVEVRDLFFNTPARRKFLRTEKTEFDHV 183

Query: 169 TDVIRRMAIAYPKVSFTFSTIKSNRYKMNFQST-NGNFPERISQVIGEDFINNAVELNEK 227
             V+RR+A+A P V+          +++        +   R+ +++G  F   ++E++  
Sbjct: 184 DQVVRRLALARPDVALELRHNGRVVHQLPAADGRPESVLARLDRLLGAGFAEQSLEIDVS 243

Query: 228 SNEITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLL 287
           + ++ L G+   P F+R   +Q + ++NGR ++D+ I   IR A+++ +   R+P  VL 
Sbjct: 244 AVDLRLHGWVRRPAFSRSQPDQQFFYVNGRLIRDRLITHAIRQAFSDFLHQARHPGYVLF 303

Query: 288 LEIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ 347
           LE+ PR VDVNVHPAK  +RFR    + +FI +++Q+ + +  +  +   +    +S   
Sbjct: 304 LELPPRLVDVNVHPAKHEVRFRESRQVHDFIQRALQRRLAQGVLGGAESDAPMPETSGMA 363

Query: 348 -------------------DNAPKTHLPKYATSLTNTQ-----------EKLFLQENRLS 377
                              D+A +   P    S   T+            +++     L 
Sbjct: 364 AGAFGGAPDRLAGSPGGGGDSAIQYRSPPPRASGVGTRHPTSALGVGDGRRVYQASLALQ 423

Query: 378 TNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHER 437
              +  +       D +P   +      LG A AQ++  Y+++++ +GL++VD HAAHER
Sbjct: 424 RPAVDAARAARAGGDTEPSVAAATDLPPLGFALAQLNGVYLLAESAEGLILVDIHAAHER 483

Query: 438 LIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAI 497
           + +E++++ +++ ++TSQ LL P  + +   E   + E  E L RLG+  +R G + + +
Sbjct: 484 IGYERLKRAWSAGRVTSQPLLVPHSLQVDPREADRLEEQRETLARLGLVLDRLGIDRVVV 543

Query: 498 REIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEM 557
           RE+PA+L + ++  L+RD++ ++     +  L++ I+++LAT+AC+GS+R+ R++   EM
Sbjct: 544 REVPALLRQADMDALVRDLLADLAAQGESTRLEEAIDSVLATLACHGSVRANRRLTLDEM 603

Query: 558 NRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           N LLR+ME+     QCNHGRPT+++L  +D+++LF R
Sbjct: 604 NALLRDMERTERIDQCNHGRPTWVRLSHADLDRLFLR 640


>gi|302386430|ref|YP_003822252.1| DNA mismatch repair protein MutL [Clostridium saccharolyticum WM1]
 gi|302197058|gb|ADL04629.1| DNA mismatch repair protein MutL [Clostridium saccharolyticum WM1]
          Length = 639

 Score =  534 bits (1376), Expect = e-149,   Method: Composition-based stats.
 Identities = 192/641 (29%), Positives = 310/641 (48%), Gaps = 51/641 (7%)

Query: 1   MK-IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDN 59
           M  I  L +  IN+IAAGE+IERP+  +KEL+EN++DA ++ V   I  GG S  ++TDN
Sbjct: 1   MPNITVLDQNTINKIAAGEVIERPASVVKELLENAIDARATAVTVEIKEGGTSLIRVTDN 60

Query: 60  GFGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNT 117
           G G+  EE+ +A  RH TSKI   +D   + + GFRGEAL SI AVS + L+++     T
Sbjct: 61  GCGIPKEEVSLAFLRHSTSKIKSVEDLFTVSSLGFRGEALASIAAVSQVELITKTSIGLT 120

Query: 118 GAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           G +  I G +  S+  V    GT    R+LF+  PAR  FLK+   E   + +++ ++A+
Sbjct: 121 GTRYQIDGGQERSMEEVGAPEGTTFIARNLFYNTPARKKFLKTPMTEGAHVAELVEKLAL 180

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           ++P+VS  F     N+      S N N  + +  V G +   N +E+  K  E+++ GY 
Sbjct: 181 SHPEVSIRFIQNNQNKLH---TSGNHNLKDIVYTVFGREIAANLLEVTVKKPEVSIHGYI 237

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G P  +RGN N    FINGR ++   I   I  AY   +   +YP  +L   IDP  +DV
Sbjct: 238 GKPVISRGNRNYENYFINGRYIKSSIISRAIEEAYKPFMMQHKYPFTMLHFSIDPEMLDV 297

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGIST----------------------SS 335
           NVHP K  +RFR+  +I + + Q++  A+  K +                          
Sbjct: 298 NVHPTKMELRFRDGEMIYHMVYQAVSSALAHKELIPEVKLEKKAEEKKGFLEKKHEPSPE 357

Query: 336 VLSKKMISSFHQDNA-----------PKTHLPKYAT-----------SLTNTQEKLFLQE 373
              K+ + +  Q  A           PK   P  A+            L      +  Q+
Sbjct: 358 PFEKRRLMAIEQQAAALENKELSIPFPKRLTPPPASLLMERDELGDNWLKPKAPDIDSQQ 417

Query: 374 NRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHA 433
                  +   ++ T   D    +  E     +     Q+   Y + +  + L I+DQHA
Sbjct: 418 EVPPVPAVSKQEEKTEQLDLFDGKLLEPKARSMHKLIGQVFDTYWLVEFHEQLYIIDQHA 477

Query: 434 AHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPN 493
           AHE++++EK      S +  SQ +  P I+ L + E AL+  H +    +G + E FG  
Sbjct: 478 AHEKVLYEKTMGTLKSKEYLSQLVSPPIILTLNQNEEALLKRHLKYFTDIGFEIEPFGGR 537

Query: 494 AIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQ 553
             A+R +PA L      +LL ++ID + +  ++++  D I   +A+++C  +++ G ++ 
Sbjct: 538 EYAVRGVPANLFSIAKKELLIEMIDGLSEDGSSHS-PDIIYEKVASLSCKAAVKGGHRLS 596

Query: 554 SIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           + E N L+ ++    N   C HGRPT I +   ++EK F R
Sbjct: 597 AAEANELIDQLLNLENPYACPHGRPTIISMSKYELEKKFKR 637


>gi|172059745|ref|YP_001807397.1| DNA mismatch repair protein [Burkholderia ambifaria MC40-6]
 gi|171992262|gb|ACB63181.1| DNA mismatch repair protein MutL [Burkholderia ambifaria MC40-6]
          Length = 661

 Score =  534 bits (1376), Expect = e-149,   Method: Composition-based stats.
 Identities = 200/644 (31%), Positives = 331/644 (51%), Gaps = 59/644 (9%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L +++I+QIAAGE++ERP+  +KEL+EN++DA +S +  V+  GG     ITD+G G
Sbjct: 23  IQPLPDQLISQIAAGEVVERPASVVKELLENAMDAGASTLRIVLEEGGVKRISITDDGCG 82

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  +E+P+A+ RH TSKI   ++   + T GFRGEAL SI +V+ +++ SR        +
Sbjct: 83  IPPDELPLALMRHATSKIRSLEELEAVATLGFRGEALASIASVAEMSITSRTADVAHATK 142

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I        ++ P A   GT +EVR+L+F  PAR  FLKSEQ E     ++IRR A+A P
Sbjct: 143 I---DATTGALSPAAGAVGTTIEVRELYFNTPARRKFLKSEQTEFGHCLEMIRRAALARP 199

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V+ +           N         +R+++++G+ F    + L+E++  + + G  G+P
Sbjct: 200 DVAISVLHNGKAVEHWNATEP----AQRVAKILGDGFATAHLPLDEQAGPLAVYGCAGLP 255

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           T +RG A+Q Y F+NGR V+DK +   +R AY + +   RYP  VL L++ P  VDVNVH
Sbjct: 256 TASRGRADQQYFFVNGRFVRDKLLTHAVRAAYEDVLHGDRYPSYVLFLDLPPEAVDVNVH 315

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVL---SKKMISSFHQDNAPKTHLP- 356
           P+K  +RFR+   I  ++  ++Q+A+ +   ++           +S      A   + P 
Sbjct: 316 PSKIEVRFRDSRSIHQYVFHAVQRALARHAGASPETTAGGHAAQLSPAPGGPASFLNTPL 375

Query: 357 -------------KYATSLTNTQEKLFLQENRLS-------------------------- 377
                           +S +++    ++++ R++                          
Sbjct: 376 GLGAATGTGGSGFSSPSSSSSSAGNTWMRQARMTQGTLPVAQPLALYDALFGRKDTGAGT 435

Query: 378 -------TNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVD 430
                   +D   +          P+  +      LG A  QIH  Y+++Q   GLVIVD
Sbjct: 436 PDGTTVIAHDSASAPTTPPGFVASPLAATAHDEQPLGFALGQIHGIYVLAQNAHGLVIVD 495

Query: 431 QHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERF 490
            HAAHER+++E+ +       I  Q+LL P  +     E   + E  + L  LG      
Sbjct: 496 MHAAHERILYEQFKNALADRTIAVQSLLLPISMTATPVEIGTVEEERDTLESLGFDLAVL 555

Query: 491 GPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGR 550
            P  +AIR +PA+L   ++  L R ++ ++     +  L +R   +L T+AC+ ++R+ R
Sbjct: 556 SPTTLAIRAVPALLKDADLQSLARAVLADLHAFGGSRVLTERQHELLGTLACHHAVRANR 615

Query: 551 KMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ++   EMN LLR+ME    + QCNHGRPT+ +L L+D+++LF R
Sbjct: 616 RLTLDEMNALLRQMEATERADQCNHGRPTWYQLTLNDLDRLFMR 659


>gi|78485428|ref|YP_391353.1| DNA mismatch repair protein MutL [Thiomicrospira crunogena XCL-2]
 gi|78363714|gb|ABB41679.1| DNA mismatch repair protein MutL [Thiomicrospira crunogena XCL-2]
          Length = 630

 Score =  534 bits (1375), Expect = e-149,   Method: Composition-based stats.
 Identities = 210/614 (34%), Positives = 352/614 (57%), Gaps = 22/614 (3%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I  L   + +QIAAGE++ERP+  +KEL+EN+LD+ ++++E  I  GG+    + DNG G
Sbjct: 15  ISLLPSHLADQIAAGEVVERPASVVKELLENALDSGATQIEIQIEEGGEKLISVIDNGMG 74

Query: 63  MTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +   ++ +AV RH TSKI    D + + T GFRGEAL SI +VS LTL S+    +   Q
Sbjct: 75  IRQSQLMLAVSRHATSKIHTAQDLAAVATLGFRGEALASISSVSRLTLTSKFQGESAAWQ 134

Query: 121 IAIS-GEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           ++     + S   P A   GT VEV+DLFF  PAR  FL++ + E   I  +++R+ ++ 
Sbjct: 135 LSGEGEGRWSEPTPTAHPQGTHVEVKDLFFNTPARKKFLRAARTEFMHIDQLVKRVMLSR 194

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P++S      +    +++    +    +R+ Q++G  F++ ++ELN ++ +I L G+ G 
Sbjct: 195 PEISMKLVHNQKVVRQVHAAHDDAALKQRLKQLMGTPFVDQSLELNFEAQDIQLSGWVGQ 254

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
            TFNR   +  Y+F+NGR V+D+ +   ++ AYA+ +  GR+P  +L L I    VDVNV
Sbjct: 255 ATFNRSQTDMQYLFVNGRIVRDRLLSYAVKQAYADVLYHGRHPAYLLFLNIPHDLVDVNV 314

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISS--FHQDNAPKTHLPK 357
           HPAK  +RF N   + +F+ +S+++A+ +     S+  +  +I S  F  +++ ++H   
Sbjct: 315 HPAKYEVRFANGRWVYDFLRRSVREAVTQPVGVASNPNNAALIPSNVFSGNHSGESHQMD 374

Query: 358 YATSLTNTQEKLFLQENRLSTNDLLPS--------DDPTYSEDNDPVEESEATHYQL--- 406
              S +  Q ++       S   +  S        D  T     +   E++A        
Sbjct: 375 SQVSQSAMQFQMPSSSASGSGMGVSESVPYYAMAPDAETVESLKNRFHEADAYSQNSTPI 434

Query: 407 -GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEK-----MRQDFNSTKITSQTLLTP 460
            G A AQIH  +I+++   GLV+VD HAAHER+++E+     M+Q +   ++ SQ LL P
Sbjct: 435 LGYAKAQIHGVFILAENEKGLVLVDMHAAHERIVYERIVYERMKQQWQQDRLISQPLLVP 494

Query: 461 EIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEI 520
            ++ L   +  +   + E+  +LG +AE FGP  +    +P++LSK +IP+L+ D+I ++
Sbjct: 495 IVVSLESSQVQVWEAYQEEFQKLGFEAEAFGPEQLKFTMVPSLLSKSDIPRLINDMIADL 554

Query: 521 IDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTF 580
             +  T  + ++I  IL+TMAC+GS+R+ R +   EMN LLR+ME   +S+QCNHGRPT+
Sbjct: 555 AVAGQTQLVDEKINAILSTMACHGSVRANRHLTLDEMNALLRDMEATESSAQCNHGRPTW 614

Query: 581 IKLKLSDIEKLFGR 594
           ++L +  ++ LF R
Sbjct: 615 VQLSMEQLDGLFMR 628


>gi|206561596|ref|YP_002232361.1| DNA mismatch repair protein [Burkholderia cenocepacia J2315]
 gi|198037638|emb|CAR53580.1| putative DNA mismatch repair protein [Burkholderia cenocepacia
           J2315]
          Length = 665

 Score =  534 bits (1375), Expect = e-149,   Method: Composition-based stats.
 Identities = 198/648 (30%), Positives = 326/648 (50%), Gaps = 63/648 (9%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L +++I+QIAAGE++ERP+  +KEL+EN++DA +S +  V+  GG     ITD+G G
Sbjct: 23  IQPLPDQLISQIAAGEVVERPASVVKELLENAMDAGASTLRIVLEEGGVKRISITDDGCG 82

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  +E+ +A+ RH TSKI   ++   + T GFRGEAL SI +V+ +++ SR        +
Sbjct: 83  IPPDELALALMRHATSKIRSLEELEAVATLGFRGEALASIASVAEMSITSRTADAAHAMK 142

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I     +   + P A   GT +EVR+L+F  PAR  FLKSEQ E     ++IRR A+A P
Sbjct: 143 I---DAQTGVLSPAAGATGTTIEVRELYFNTPARRKFLKSEQTEFGHCLEMIRRAALARP 199

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V+ +           N         +R+++++G+ F    + L+E++  + + G  G+P
Sbjct: 200 DVAISVLHNGKAVEHWNATEP----AQRVAKILGDSFATAHLPLDEQAGPLAVYGCAGLP 255

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           T +RG A+Q Y F+NGR V+DK +   +R AY + +   RYP  VL L++ P  VDVNVH
Sbjct: 256 TASRGRADQQYFFVNGRFVRDKLLTHAVRAAYEDVLHGDRYPSYVLFLDLPPEAVDVNVH 315

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVL---SKKMISSFHQDNAPKTHLPK 357
           P+K  +RFR+   I  ++  ++Q+A+ +   ++           +S   +  A     P 
Sbjct: 316 PSKIEVRFRDSRSIHQYVFHAVQRALARHAGASPETTAGGHAAQLSPVPRGPASFLDTPL 375

Query: 358 YATSLTNT-----------------QEKLFLQENRLSTNDLLPSDDPTYSE--------- 391
             +    T                     ++++ R++   L  +      +         
Sbjct: 376 GQSQGHATGSGGSGFSSPSSSSSSSSGNTWMRQARMTQGTLPVAQPLALYDALFGRKDTG 435

Query: 392 -------------------------DNDPVEESEATHYQLGIACAQIHQNYIISQTTDGL 426
                                       P+  +      LG A  QIH  Y+++Q   GL
Sbjct: 436 AGTPDGTTTLARDSADAPIAPLSGFTASPIATTTHDEQPLGFALGQIHGIYVLAQNAHGL 495

Query: 427 VIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIK 486
           VIVD HAAHER+++E+ +       +  Q LL P  +     E   + E  + L  LG  
Sbjct: 496 VIVDMHAAHERILYEQFKNALADRSVAVQALLLPISMTATPVEIGTVEEERDTLESLGFD 555

Query: 487 AERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSI 546
                P  +AIR +PA+L   ++  L R ++ ++     +  L +R   +L T+AC+ ++
Sbjct: 556 LAVLSPTTLAIRAVPALLKDADLQSLARAVLADLHAFGGSRVLTERQHELLGTLACHHAV 615

Query: 547 RSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           R+ R++   EMN LLR+ME    + QCNHGRPT+ +L L+D+++LF R
Sbjct: 616 RANRRLTLDEMNALLRQMEATERADQCNHGRPTWYQLTLNDLDRLFMR 663


>gi|83594278|ref|YP_428030.1| DNA mismatch repair protein [Rhodospirillum rubrum ATCC 11170]
 gi|123766944|sp|Q2RQ52|MUTL_RHORT RecName: Full=DNA mismatch repair protein mutL
 gi|83577192|gb|ABC23743.1| DNA mismatch repair protein MutL [Rhodospirillum rubrum ATCC 11170]
          Length = 629

 Score =  533 bits (1374), Expect = e-149,   Method: Composition-based stats.
 Identities = 237/630 (37%), Positives = 358/630 (56%), Gaps = 38/630 (6%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR L   ++N+IAAGE++ERP+ A+KEL+EN++DA +SR++  +  GG++   + D+G
Sbjct: 1   MTIRLLPPVLVNRIAAGEVVERPASAVKELVENAIDAGASRIDITMTDGGRARILVVDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM   E+ +AV+RH TSK+  DD  +IHT GFRGEALPSIG+V+ LTL SR        
Sbjct: 61  RGMDPGELSLAVERHATSKLPGDDLLDIHTLGFRGEALPSIGSVARLTLTSRAAGAGDAW 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + + G       P +   GT VEVRDLF+  PARL FLK+ + E     DV+ R+A+A+
Sbjct: 121 ALTVEGGAKGEPEPASHPQGTRVEVRDLFYATPARLKFLKAPRTEQMHAVDVVHRLAMAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQG 235
           P V FT S     R ++      G   E    R+  ++G +F +NA+ +  +   I L G
Sbjct: 181 PAVGFTLS--DGTRQQIRLSGAQGELFEARLTRLGAILGREFSDNAIAIEAEREGIRLTG 238

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           +  +PT+N+  +   Y+F+NGR V+DK +   +R AY + +   R  V+ L L++ P  V
Sbjct: 239 HAALPTYNKATSAGQYLFVNGRPVRDKLLHGAVRGAYQDVLAHDRNAVLALYLDLPPEMV 298

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ-DNAPKTH 354
           DVNVHPAK+ +RFR+P ++R  II +++ A+   G   SS +S   + +      +    
Sbjct: 299 DVNVHPAKAEVRFRDPGLVRGLIIGALRHALAAAGHRASSTVSLAALGALRPAQGSGAPA 358

Query: 355 LPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSED---------------------- 392
           LP  A           L+E R +     P+  P                           
Sbjct: 359 LPWGAGGYGGGASHPGLEERRSAYAAQAPAGTPDPWAGRGMGAGGGSGQAAMAWLAGAPP 418

Query: 393 -------NDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQ 445
                        + A  + LG A  QIH  YII+QT DG+VIVDQHAAHERL+ E+M+ 
Sbjct: 419 AAPRLAGEPEAPPTGAEDFPLGAARGQIHDTYIIAQTRDGVVIVDQHAAHERLVMERMKA 478

Query: 446 DFNSTK-ITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAIL 504
                  +  Q LL PE+++L E     +     +L +LG+  E FGP A+ +RE+PA+L
Sbjct: 479 ALAERGEVARQILLLPEVVELDEPGAVRVATAAAELAKLGLVVEGFGPGAVVVREVPALL 538

Query: 505 SKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREM 564
              ++  L+ D+ + + +  T   L+DR+ +++ATMAC+GS+R+GR+++  EMN LLR+M
Sbjct: 539 GDTDVKGLVADLAEGLAEWGTAQALEDRLGDVVATMACHGSVRAGRRLRIEEMNALLRDM 598

Query: 565 EKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           E+ P + QCNHGRPT+++L+L DIE+LFGR
Sbjct: 599 ERTPRAGQCNHGRPTYVELRLGDIERLFGR 628


>gi|161525790|ref|YP_001580802.1| DNA mismatch repair protein [Burkholderia multivorans ATCC 17616]
 gi|189349489|ref|YP_001945117.1| DNA mismatch repair protein [Burkholderia multivorans ATCC 17616]
 gi|160343219|gb|ABX16305.1| DNA mismatch repair protein MutL [Burkholderia multivorans ATCC
           17616]
 gi|189333511|dbj|BAG42581.1| DNA mismatch repair protein [Burkholderia multivorans ATCC 17616]
          Length = 662

 Score =  533 bits (1374), Expect = e-149,   Method: Composition-based stats.
 Identities = 200/647 (30%), Positives = 329/647 (50%), Gaps = 64/647 (9%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L +++I+QIAAGE++ERP+  +KEL+EN++DA ++ +  V+  GG     ITD+G G
Sbjct: 23  IQPLPDQLISQIAAGEVVERPASVVKELLENAMDAGATTLRIVLEEGGVKRISITDDGCG 82

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +   E+P+A+ RH TSKI   ++   + T GFRGEAL SI +V+ + + SR        +
Sbjct: 83  IPPNELPLALMRHATSKIRSLEELEAVATLGFRGEALASIASVAEMYITSRTADAAHATR 142

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I     +   + P A   GT +EVR+L+F  PAR  FLKSEQ E     ++IRR A+A P
Sbjct: 143 I---DAQTGVLSPAAGAVGTTIEVRELYFNTPARRKFLKSEQTEFGHCVEMIRRAALARP 199

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V+ +           N         +R+++++G+ F    + L+E++  + + G  G+P
Sbjct: 200 DVAISVLHNGKAVEHWNATEP----AQRVAKILGDGFATAHLPLDERAGPLAVYGCAGLP 255

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           T +RG A+Q Y F+NGR V+DK +   +R AY + +   RYP  VL L++ P  VDVNVH
Sbjct: 256 TASRGRADQQYFFVNGRFVRDKLLTHAVRAAYEDVLHGDRYPSYVLFLDLPPEAVDVNVH 315

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           P+K  +RFR+   I  F+  ++Q+A+ +   ++    +     + H + AP+      +T
Sbjct: 316 PSKIEVRFRDSRSIHQFVFHAVQRALARHAGASPETTAGGH--AAHLEPAPRGPASFLST 373

Query: 361 SLTNTQEKL-------------------FLQENRLSTNDLL------------------- 382
            L  +  +                    +L++ R++   L                    
Sbjct: 374 PLGQSPNQPASTGGSGFSSPSSSAPGSTWLRQARMTQGTLPVAQPLALYDALFGRKDTSA 433

Query: 383 -----------PSDDPTYSEDNDPVEESEATHYQLGIACA----QIHQNYIISQTTDGLV 427
                       + D + +          A              QIH  Y+++Q   GLV
Sbjct: 434 ATPDATTATAGDAPDDSAAPLAGFAALPSAASMHDEQPLGFALGQIHGIYVLAQNAHGLV 493

Query: 428 IVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKA 487
           IVD HAAHER+++E+ +       +  Q+LL P  +     E   + E  + L  LG   
Sbjct: 494 IVDMHAAHERILYEQFKNALADRTVAVQSLLLPVSMTATPVEIGTVEEERDTLEALGFDL 553

Query: 488 ERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIR 547
               P ++AIR +PA+L   ++  L R ++ ++     +  L +R   +L T+AC+ ++R
Sbjct: 554 AVLSPTSLAIRAVPALLKDADLQALARAVLADLHAFGGSRVLTERQHELLGTLACHHAVR 613

Query: 548 SGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           + R++   EMN LLR+ME    + QCNHGRPT+ +L LSD+++LF R
Sbjct: 614 ANRRLTLDEMNALLRQMEATERADQCNHGRPTWYQLTLSDLDRLFMR 660


>gi|308389547|gb|ADO31867.1| DNA mismatch repair protein [Neisseria meningitidis alpha710]
          Length = 658

 Score =  533 bits (1374), Expect = e-149,   Method: Composition-based stats.
 Identities = 216/658 (32%), Positives = 344/658 (52%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIGLALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E    T ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCTTMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS     PERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPTQS----LPERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRANLTESVGNAGEVLHDITGVVSTPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLP 383
                   ++      K  +     ++ KT    Y  +    Q  L L+E+R + N    
Sbjct: 359 DSENLFDSASDYPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMNTYAE 418

Query: 384 SDDPT-----------YSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
               T            +   +   E+                      G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELNRLEQARFGNMPSETPIPKTDTPLSDGLPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKM-RQDFNSTKITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM RQ   + K+ SQ LL P        ECA + +H
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRRENGKLQSQRLLIPSTFAASHEECAALADH 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++    I
Sbjct: 539 AEALAGFGLELSDMGGNTLAVRTVPAMLGKADVVSLAKDVLGELAQVGSSQTIEEHENRI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSVRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|167758189|ref|ZP_02430316.1| hypothetical protein CLOSCI_00527 [Clostridium scindens ATCC 35704]
 gi|167664086|gb|EDS08216.1| hypothetical protein CLOSCI_00527 [Clostridium scindens ATCC 35704]
          Length = 652

 Score =  533 bits (1374), Expect = e-149,   Method: Composition-based stats.
 Identities = 190/651 (29%), Positives = 312/651 (47%), Gaps = 61/651 (9%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI+ L    I++IAAGE+IERP+  +KEL+EN++DA ++ + T I  GG S  +I DNG 
Sbjct: 3   KIQVLDPVTIDKIAAGEVIERPASVVKELVENAIDAGATAIVTEIEEGGISMIRIADNGC 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           GM + ++P A  RH TSKI   +D  +I + GFRGEAL SI AVS + ++++      G 
Sbjct: 63  GMDASDVPNAFLRHSTSKIRTVEDLVHIGSLGFRGEALSSIAAVSQVEMITKTKDQVLGT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +  I+G K   +       GT   +R LF+  PAR  FLK+   E + + D++ RMA+++
Sbjct: 123 RYRIAGGKEEELDETGARDGTTFLIRQLFYNTPARRKFLKTPMTEASHVGDLLTRMALSH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P++SF F     ++      S NGN  + I  V G +   N +  + +S  + ++G+ G 
Sbjct: 183 PEISFQFINNGQSKLH---TSGNGNLKDVIYHVYGREIAANLLAADYESPGLKIRGFLGK 239

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P  +RGN N    FINGR V+   I   I  AY +     +YP VVL +EID   VDVNV
Sbjct: 240 PLISRGNRNFENYFINGRYVKSSIISKAIEDAYKDFTMQHKYPFVVLHIEIDGEHVDVNV 299

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH----- 354
           HP K  +RF N   + N I  ++   ++ + +     +     ++  +      H     
Sbjct: 300 HPTKMELRFNNQQEVYNSIYAAVDHGLHAEELIPHVEVDAPKAAAPMKQEGGAPHAAQKK 359

Query: 355 --------------LPKYATSLTNTQEKL------------------------------- 369
                          P    S+   +E+                                
Sbjct: 360 DNPVVPDRTTSVQPAPSAKKSVPAPEERTLDYFMQKMKERVAAYHAQQNQEAPKKAPDVK 419

Query: 370 ----FLQENRLSTNDLLPSDDPTYSEDNDPVEES--EATHYQLGIACAQIHQNYIISQTT 423
                 ++ R + +D +       ++  +  EE+  E           Q+ + Y + +  
Sbjct: 420 VSAQPSEDRREAPSDRVCETPEYAAQQLNLFEENLVERKVQAEYKIIGQVFETYWLVEFN 479

Query: 424 DGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRL 483
           D L I+DQHAAHER+++EK  +   + + TSQ +  P ++DL   E  L+ ++ +   R+
Sbjct: 480 DSLYIIDQHAAHERVLYEKTLKSMKTREFTSQFISPPIVLDLSMQEAELLNQYMDQFTRI 539

Query: 484 GIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACY 543
           G + E FG  + A+R +P  L       LL  ++D + D  +     D I+  +A+M+C 
Sbjct: 540 GFEIEEFGQESYAVRAVPGNLFGIAKKDLLLQMLDGLSDEVSRNLSPDMIDEKVASMSCK 599

Query: 544 GSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            +++   K+ + E++ L+ E+    N   C HGRPT I +   ++EK F R
Sbjct: 600 AAVKGNMKLSATEVDSLIGELLTLENPYHCPHGRPTIIAMTKRELEKKFKR 650


>gi|293399028|ref|ZP_06643193.1| DNA mismatch repair protein mutL [Neisseria gonorrhoeae F62]
 gi|291610442|gb|EFF39552.1| DNA mismatch repair protein mutL [Neisseria gonorrhoeae F62]
          Length = 654

 Score =  533 bits (1374), Expect = e-149,   Method: Composition-based stats.
 Identities = 214/654 (32%), Positives = 338/654 (51%), Gaps = 65/654 (9%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ V+  + GGG    ++ DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAVDVELEGGGIRLIRVGDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  ++ + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGDDFQTASLEIDSGNSALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL LE+ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLELPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRANLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDL-- 381
                   +++     K  +     ++ KT    Y  +    Q  L L+E+R + +    
Sbjct: 359 DGENLFDSASNHPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMDTYAE 418

Query: 382 ---------LPSDDPTYSEDNDPVEESEATH-----------YQLGIACAQIHQNYIISQ 421
                    L       +   +   ES   +             LG A AQ+   YI++Q
Sbjct: 419 LYKKTDNIDLELSQFEQARFGNMPSESSTNNVSDGIGQASELPPLGFAIAQLLGIYILAQ 478

Query: 422 TTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEHDEDL 480
             D L+++D HAA ER+ +EKM++       + SQ LL P        ECA + +H E L
Sbjct: 479 AEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQHLLIPVTFAASHEECAALADHAETL 538

Query: 481 HRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATM 540
              G++    G N +A+R  P +L K ++  L RD++ E+    ++ T+      ILATM
Sbjct: 539 AGFGLELSDMGGNTLAVRAAPVMLGKSDVVSLARDVLGELAQVGSSQTIASHENRILATM 598

Query: 541 ACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 SCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDTLFLR 652


>gi|240123593|ref|ZP_04736549.1| DNA mismatch repair protein [Neisseria gonorrhoeae PID332]
 gi|268682221|ref|ZP_06149083.1| DNA mismatch repair protein [Neisseria gonorrhoeae PID332]
 gi|268622505|gb|EEZ54905.1| DNA mismatch repair protein [Neisseria gonorrhoeae PID332]
          Length = 654

 Score =  533 bits (1374), Expect = e-149,   Method: Composition-based stats.
 Identities = 214/654 (32%), Positives = 338/654 (51%), Gaps = 65/654 (9%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ V+  + GGG    ++ DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAVDVELEGGGIRLIRVGDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  ++ + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGDDFQTASLEIDSGNSALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL LE+ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLELPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRANLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDL-- 381
                   +++     K  +     ++ KT    Y  +    Q  L L+E+R + +    
Sbjct: 359 DSENLFDSASNHPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMDTYAE 418

Query: 382 ---------LPSDDPTYSEDNDPVEESEATH-----------YQLGIACAQIHQNYIISQ 421
                    L       +   +   ES   +             LG A AQ+   YI++Q
Sbjct: 419 LYKKTDDIDLELSQFEQARFGNMPSESSTNNVSDGIGQASELPPLGFAIAQLLGIYILAQ 478

Query: 422 TTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEHDEDL 480
             D L+++D HAA ER+ +EKM++       + SQ LL P        ECA + +H E L
Sbjct: 479 AEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQHLLIPVTFAASHEECAALADHAETL 538

Query: 481 HRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATM 540
              G++    G N +A+R  P +L K ++  L RD++ E+    ++ T+      ILATM
Sbjct: 539 AGFGLELSDMGGNTLAVRAAPVMLGKSDVVSLARDVLGELAQVGSSQTIASHENRILATM 598

Query: 541 ACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 SCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDTLFLR 652


>gi|157827812|ref|YP_001496876.1| DNA mismatch repair protein [Rickettsia bellii OSU 85-389]
 gi|166232103|sp|A8GY89|MUTL_RICB8 RecName: Full=DNA mismatch repair protein mutL
 gi|157803116|gb|ABV79839.1| DNA mismatch repair protein [Rickettsia bellii OSU 85-389]
          Length = 611

 Score =  533 bits (1374), Expect = e-149,   Method: Composition-based stats.
 Identities = 250/610 (40%), Positives = 372/610 (60%), Gaps = 16/610 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LSE  IN+IAAGE+IERP+  +KEL+EN++DA S++++ ++   GK+   I+D+G
Sbjct: 1   MTIKLLSESTINRIAAGEVIERPASVVKELVENAVDAGSTKIDIILERAGKNLIIISDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +E+ +AV+RH TSK+ + DF NIHTFGFRGEALPSI A+S + + S+   N    
Sbjct: 61  VGMTDKELEIAVERHTTSKLDETDFLNIHTFGFRGEALPSIAAISKMLITSKKRDNQKAF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G     + P   N GT +E+RDLFF  PARL FL++++ E     DV++++A+A+
Sbjct: 121 QIKLIGGDEKQIAPAIHNEGTKIEIRDLFFATPARLKFLRTDKTELAATVDVVKKIALAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQS--TNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P++SF+ +       K+  Q+     N  +RI  VIGEDFI NA  ++ KS + ++ GYT
Sbjct: 181 PEISFSLTHDGKTLLKLKGQNKDAENNLKQRIIDVIGEDFIKNASYIDFKSPDFSIYGYT 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
            IPT+NR ++   ++FIN R V+DK +   +R AY + +   RYP+  + L+IDP+ VDV
Sbjct: 241 SIPTYNRASSEDQFLFINNRPVKDKLLQVALRVAYQDYMLRDRYPLCAIFLQIDPQLVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL-- 355
           NVHPAK+ +RF +P  +RN +I SI+ A++ K    S+ ++   I  F      K     
Sbjct: 301 NVHPAKAEVRFHDPNYVRNLLIDSIKNALSNKSHIASTTIASSAIELFKNPFVNKEPAIS 360

Query: 356 ---------PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQL 406
                     KY  + + T  K     +     D LP        +     E + +    
Sbjct: 361 KPLNVNSKPSKYRPATSPTVPKYTPNNSCQKLIDTLPHARIEQEVEQRIQNEPQKSSQYR 420

Query: 407 -GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDL 465
            G A AQ+H  Y+ISQT D +VI DQHAAHERL +EK++    + ++  Q LL PEI++L
Sbjct: 421 LGAAKAQLHTTYVISQTEDSIVITDQHAAHERLGYEKIKNYIKNEELIKQRLLIPEIVEL 480

Query: 466 L-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSS 524
             E    ++ E+ + L +LG+  E+FG  +I + EIP IL   N+ +L++D+ D + +  
Sbjct: 481 PDEKRADILYENKDKLSKLGLSLEKFGEKSIIVTEIPNILGDINVQKLIQDLADHLAECG 540

Query: 525 TTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLK 584
               L + IE++  T AC+ SIR+GRK+ + EMN LLR+ME  P S QCNHGRPT+I+LK
Sbjct: 541 ENIALTELIEHVTETYACHYSIRAGRKLSADEMNALLRQMENTPFSGQCNHGRPTYIELK 600

Query: 585 LSDIEKLFGR 594
           L DIE+LFGR
Sbjct: 601 LKDIERLFGR 610


>gi|240128296|ref|ZP_04740957.1| DNA mismatch repair protein [Neisseria gonorrhoeae SK-93-1035]
 gi|268686693|ref|ZP_06153555.1| DNA mismatch repair protein [Neisseria gonorrhoeae SK-93-1035]
 gi|268626977|gb|EEZ59377.1| DNA mismatch repair protein [Neisseria gonorrhoeae SK-93-1035]
          Length = 654

 Score =  533 bits (1373), Expect = e-149,   Method: Composition-based stats.
 Identities = 212/654 (32%), Positives = 338/654 (51%), Gaps = 65/654 (9%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ V+  + GGG    ++ DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAVDVELEGGGIRLIRVGDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKS+  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSKNTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  ++ + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGDDFQTASLEIDSGNSALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRANLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDL-- 381
                   +++     K  +     ++ KT    Y  +    Q  L L+E+R + +    
Sbjct: 359 DSENLFDSASNHPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMDTYAE 418

Query: 382 ---------LPSDDPTYSEDNDPVEESEATH-----------YQLGIACAQIHQNYIISQ 421
                    L       +   +   ES   +             LG A AQ+   YI++Q
Sbjct: 419 LYKKTDNIDLELSQFEQARFGNMPSESSTNNVSDGIGQASELPPLGFAIAQLLGIYILAQ 478

Query: 422 TTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEHDEDL 480
             D L+++D HAA ER+ +EKM++       + SQ LL P        ECA + +H E L
Sbjct: 479 AEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQHLLIPVTFAASHEECAALADHAETL 538

Query: 481 HRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATM 540
              G++    G N +A+R  P +L K ++  L RD++ E+    ++ T+      ILATM
Sbjct: 539 AGFGLELSDMGGNTLAVRAAPVMLGKSDVVSLARDVLGELAQVGSSQTIASHENRILATM 598

Query: 541 ACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 SCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDTLFLR 652


>gi|294669657|ref|ZP_06734724.1| hypothetical protein NEIELOOT_01558 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291308570|gb|EFE49813.1| hypothetical protein NEIELOOT_01558 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 638

 Score =  533 bits (1373), Expect = e-149,   Method: Composition-based stats.
 Identities = 221/638 (34%), Positives = 332/638 (52%), Gaps = 49/638 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ +E  + GGG     + DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGAAEIEVELDGGGIKRLLVRDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++++P+A+ RH TSKI+   D  ++ + GFRGE L SI +VS LTL SR P +    
Sbjct: 63  GIHADDLPLALSRHATSKIASLTDLEHVSSMGFRGEGLASIASVSRLTLTSRTPGSAHAH 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +I      +S V   A   GT VEV DLFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 EIRAEDGILSPVAAAAHPEGTTVEVADLFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P+ +F+      + +K   QS      ER + ++G DF   ++ +      + L G    
Sbjct: 183 PETAFSLKRDGKSVFKYPPQS----LEERAAAILGSDFQTASLPVEGGGGSMRLYGLIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G   Q Y F+N R V+DK +L  ++ AY + +     P  VL LE+ P  VDVNV
Sbjct: 239 PTFAKGKTGQQYCFVNRRFVRDKVMLHAVKQAYRDVLHQALAPAFVLFLELPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKG----------------------ISTSSVL 337
           HP K+ IRFRN   +   +  ++ KA+                             S   
Sbjct: 299 HPTKTEIRFRNSQAVHQLVFHTLDKALAGTRADRTESVGNAGEVLHKMMGLAEERPSENH 358

Query: 338 SKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLL--------------- 382
                       A KT    Y+ +    Q  L L E+R + +                  
Sbjct: 359 GGSHAPFSDGLQAGKTAPVSYSAARVPQQRSLSLNESRRAIDTYAELYRRDDELAQLEHE 418

Query: 383 -PSDDPTYSEDNDPVEESEA----THYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHER 437
                   +  +D  +E+        Y LG A AQ+   YI++Q  D L++VD HAA ER
Sbjct: 419 RFGGAIAQTAVSDGRDEAHGGGGGNAYPLGFAIAQLLGIYILAQAEDSLLLVDMHAAAER 478

Query: 438 LIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIA 496
           + +EKM++       + SQ+LL P       GE A + +  ++L R G+     G N IA
Sbjct: 479 VNYEKMKRQRGEQGRLNSQSLLIPVTFSAGHGEIAALADFGDELRRFGLDLSPIGENRIA 538

Query: 497 IREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIE 556
           +R +P +L K ++ QL RD++ E  +   +  ++ R   ILATM+C+GSIR+GRK+   E
Sbjct: 539 VRAVPQMLGKSDVEQLARDMLREFAEVGASQAVEARENRILATMSCHGSIRAGRKLTLPE 598

Query: 557 MNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           MN LLR+ME+ P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 MNALLRDMEQTPRSNQCNHGRPTWVKLTLKELDALFLR 636


>gi|159042919|ref|YP_001531713.1| DNA mismatch repair protein [Dinoroseobacter shibae DFL 12]
 gi|157910679|gb|ABV92112.1| DNA mismatch repair protein MutL [Dinoroseobacter shibae DFL 12]
          Length = 621

 Score =  533 bits (1373), Expect = e-149,   Method: Composition-based stats.
 Identities = 256/601 (42%), Positives = 373/601 (62%), Gaps = 10/601 (1%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE+IERP+ A+KEL+EN+LDA++ ++E   A GGK+  ++TD+G G
Sbjct: 21  IRQLDEAAINRIAAGEVIERPASAVKELVENALDAQARQIEIAYADGGKTLLRVTDDGIG 80

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           + + ++P+A+ RH TSKI   D  NIHTFGFRGEALPS+GAV  LT+          A++
Sbjct: 81  IAAGDLPLALARHATSKIDGADLLNIHTFGFRGEALPSLGAVGRLTIA-SRAAGAEAAEV 139

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
            + G ++  VRP A+N GT+V +RDLF   PARL FL+S++ E   I +V+RR+A+A P 
Sbjct: 140 TVEGGRMGPVRPAALNRGTVVTLRDLFSATPARLKFLRSDRAEVQAIGEVVRRLAMAEPS 199

Query: 182 VSFT---FSTIKSNRYKMNFQSTNGNF----PERISQVIGEDFINNAVELNEKSNEITLQ 234
           V FT    S     R         G+       R+ +V+G +F  NA+ +  +   + L 
Sbjct: 200 VGFTLRDVSGGGEGRVTFRVAPEQGDLFDALHRRLGRVLGSEFAENALRIEGEREGLRLS 259

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQ 294
           GY  +PT++RG A   ++F+NGR V+DK ++  +R AYA+ +   R+P  VL ++  P +
Sbjct: 260 GYAALPTYSRGAAVAQFLFVNGRPVRDKLLVGALRGAYADFLSRDRHPAAVLFVDCPPER 319

Query: 295 VDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH 354
           VDVNVHPAKS +RFR P + R  I+ +++ A+ + G   SS ++   + +F   +A  + 
Sbjct: 320 VDVNVHPAKSEVRFREPGVARGLIVTALRHALAEAGHRASSTVADATLGAFRAPDAVGSG 379

Query: 355 LPKYATSLTNTQE-KLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQI 413
              Y     +              T           S   +P E  EA    LG A AQ+
Sbjct: 380 ARIYQMDRPSAAALGRSTAWQAPETAAQGFGFAEAPSARVEPAETVEAIARPLGAARAQL 439

Query: 414 HQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALI 473
           H+NYI++QT  G+V+VDQHAAHERL++E+++       + SQ LL PEI+++ E +   +
Sbjct: 440 HENYIVAQTETGMVLVDQHAAHERLVYERLKALMAENGVPSQALLIPEIVEMSEADARTL 499

Query: 474 MEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRI 533
           ++  E+L  LG++ E FGP A+A+RE PA+L       LLRDI+DE+ D   T  LQ RI
Sbjct: 500 LDRSEELAALGLRIEPFGPGAVAVRETPALLGPVKAEALLRDILDELSDLGQTDALQARI 559

Query: 534 ENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFG 593
           E IL+ MAC+GS+RSGR+M   EMN LLR+ME  P+S QCNHGRPT+++LKL+DIE+LFG
Sbjct: 560 EAILSRMACHGSVRSGRRMSGEEMNALLRQMEATPHSGQCNHGRPTYVELKLADIERLFG 619

Query: 594 R 594
           R
Sbjct: 620 R 620


>gi|87200143|ref|YP_497400.1| DNA mismatch repair protein MutL [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87135824|gb|ABD26566.1| DNA mismatch repair protein MutL [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 603

 Score =  533 bits (1373), Expect = e-149,   Method: Composition-based stats.
 Identities = 232/605 (38%), Positives = 358/605 (59%), Gaps = 14/605 (2%)

Query: 1   MK-IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDN 59
           M+ IR+L E +IN+IAAGE++ERP+ A+KEL+EN++DA SS V   ++ GG +  +++D+
Sbjct: 1   MRVIRRLPETLINRIAAGEVVERPASALKELVENAIDAGSSHVHVRLSEGGLAMIEVSDD 60

Query: 60  GFGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
           G GM  +EI +A++RH TSK+ D+    + T GFRGEALPSI +V+ +T+ SRP     G
Sbjct: 61  GCGMRPDEIALALERHATSKLPDEAIELVETLGFRGEALPSIASVARVTIESRPHGTAEG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +  +    + +  P A+ PGT V V  LF  IPAR  FL+S + E    +DV+RR+A+A
Sbjct: 121 WKRVVDNGALVAEGPAALPPGTRVRVEHLFEKIPARRKFLRSPRSEWAAASDVVRRLAMA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P V FT          +    T      R++Q++  +   N+VE++    +  L G  G
Sbjct: 181 RPDVGFTLEHDGRRALHVQAGET---LEARVAQLVARELAGNSVEVDLVRGDFHLTGIAG 237

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTFNRG A+  Y+F+NGR V+D+ ++  +R AYA+ +   R+ V+ L L++   +VDVN
Sbjct: 238 LPTFNRGVADHQYLFVNGRPVKDRLLIGAVRGAYADMLARDRHAVLALFLQVPASEVDVN 297

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHPAKS +RFR+P ++R  ++  ++ A++     ++   S   ++++  +          
Sbjct: 298 VHPAKSEVRFRDPALVRGMVVSGLRHALSTGDQRSAQAPSASAMAAWQAEPIAPPPPSSP 357

Query: 359 ATSLTNTQ-EKLFLQENRLSTNDLLP-------SDDPTYSEDNDPVEESEATHYQLGIAC 410
           ++    +   + +  E R+S                P+   +       +A  + LG+A 
Sbjct: 358 SSDWQGSIFSQQWKPEPRVSEAGQAWRGYEQAIMAPPSARAEPAAQPVVDAAQHPLGVAR 417

Query: 411 AQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKI-TSQTLLTPEIIDLLEGE 469
            QI   YI+++  DGLVIVDQHAAHERL+ E++R       +  SQ LL PE+++L E  
Sbjct: 418 GQISNTYIVAEAEDGLVIVDQHAAHERLVLERLRAAGAGQGVAPSQALLIPEVVELDETA 477

Query: 470 CALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTL 529
           C  + E  E L   G+  ERFGPNA+ +R IPA L+K +  +L+ D+ D++        L
Sbjct: 478 CDRLEEASEKLAEFGLALERFGPNAVLVRAIPAALAKGDPARLVADVADDLAHHGDALLL 537

Query: 530 QDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIE 589
            ++++ +LATMAC+GS+R+GR +   EMN LLREME  P S QCNHGRPT++KL   DIE
Sbjct: 538 GEKLDLVLATMACHGSVRAGRTLSVAEMNALLREMEVTPRSGQCNHGRPTWVKLAHGDIE 597

Query: 590 KLFGR 594
           KLFGR
Sbjct: 598 KLFGR 602


>gi|33598139|ref|NP_885782.1| DNA mismatch repair protein [Bordetella parapertussis 12822]
 gi|81836516|sp|Q7W4N5|MUTL_BORPA RecName: Full=DNA mismatch repair protein mutL
 gi|33566697|emb|CAE38907.1| DNA mismatch repair protein [Bordetella parapertussis]
          Length = 629

 Score =  533 bits (1372), Expect = e-149,   Method: Composition-based stats.
 Identities = 203/629 (32%), Positives = 337/629 (53%), Gaps = 43/629 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            I  L + +I+QIAAGE+IERP+  +KE++EN++DA +  +E  + GGG     +TD+G 
Sbjct: 6   PIATLPDLLISQIAAGEVIERPASVLKEILENAIDAGARAIEVRLEGGGIRRIAVTDDGS 65

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  EE+P+A+ RH TSKI   D+  ++ + GFRGEAL SI +V+ LT++SR        
Sbjct: 66  GIPPEELPLALTRHATSKIRSLDELESVASMGFRGEALASIASVADLTIISRTRGAEHAW 125

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI     ++    P +  PGT ++VR LF  +PAR  FL+SE  E     D + R+A+A+
Sbjct: 126 QIDGGSLQV---SPASGPPGTTIDVRQLFDRVPARRKFLRSEATEFGHCVDAMERIALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P+V+F        + +        +  +RI  V+G +F+++ + +   +  I L G    
Sbjct: 183 PEVAFRLFHHDRAQRQWLP----ADHGQRIRDVLGAEFVDHVLPVQAAAGAIALMGMVTR 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT  R  A++ Y+++NGR V+D+ +   +R+AYA+ +   R P  VL L+IDP  VDVNV
Sbjct: 239 PTAARARADRQYLYVNGRFVRDRTVSHALRSAYADVLHGDRQPAYVLYLDIDPGAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVL---------------------- 337
           HPAK  +RFR+   +  F+ Q + + + + G + +                         
Sbjct: 299 HPAKHEVRFRDSGAVHRFVSQVVGQTLAQTGGAEAVPAGVPDGAAPDAAYAGEPAAAAPG 358

Query: 338 ---SKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLL---------PSD 385
               +    + +       +    A   T    +L  +   +   D            + 
Sbjct: 359 LAEPRAPYPAAYPSPGQSPYQGSPARPHTQVPFRLHGEPAGIPATDWQSLYRPLPGDAAP 418

Query: 386 DPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQ 445
             T            A  + LG A AQ+H  YI++Q + GLV+VD HAAHER+++E++++
Sbjct: 419 AATALRAAPATPLPTADEHPLGQALAQLHGIYILAQNSRGLVLVDMHAAHERVVYEQLKR 478

Query: 446 DFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILS 505
             +   +  Q LL P +    E + AL+ EH+  L+ LG +    GP +IA+R +PA+L+
Sbjct: 479 ALDDRALPRQDLLVPVVFHAAEKDVALVEEHETQLNELGFEMRPSGPASIAVRSVPALLA 538

Query: 506 KKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREME 565
           + +I  L R ++ ++     +  L ++   +L+TMAC+GS+R+ R++   EMN LLR+ME
Sbjct: 539 RGDIESLARAVLRDLGAVGVSRLLTEQRNELLSTMACHGSVRANRRLTLEEMNALLRQME 598

Query: 566 KNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
               + QCNHGRPT+++  ++D++KLF R
Sbjct: 599 ITERADQCNHGRPTWVQWSVNDLDKLFLR 627


>gi|298676065|ref|YP_003727815.1| DNA mismatch repair protein MutL [Methanohalobium evestigatum
           Z-7303]
 gi|298289053|gb|ADI75019.1| DNA mismatch repair protein MutL [Methanohalobium evestigatum
           Z-7303]
          Length = 626

 Score =  533 bits (1372), Expect = e-149,   Method: Composition-based stats.
 Identities = 188/623 (30%), Positives = 308/623 (49%), Gaps = 36/623 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L +  IN+IAAGE+IERP+  +KELIENS+DA ++ ++  +  GG     ++DNG 
Sbjct: 5   RIHILDDSTINKIAAGEVIERPASVVKELIENSIDAGATEIKIDVKEGGAKKITVSDNGT 64

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           GM+ +++ +A  +H TSKI   +D  +  T GFRGEAL SI +VS + +++R   +  G 
Sbjct: 65  GMSYDDVRLAFTKHATSKIWKLEDLYSTTTLGFRGEALSSIASVSKVEMITRQKDDLAGT 124

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            I +  E I+ V  +  + GT V V DLF+  PAR  +LKS++ E   ITD + + A+  
Sbjct: 125 MIVVQPEGINDVSEIGASAGTSVNVYDLFYNTPARRKYLKSKRTELAHITDTVSKQALGN 184

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
             VSFT ++       +    ++GN  + I  V G D   + + ++ +S  I + GY   
Sbjct: 185 INVSFTLTSNGR---NVLHTPSSGNLFDNIVHVYGRDVARSMIPVDHESELIRVSGYISK 241

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P F R   +    FIN R+V  + I + +RT Y   +P GRYP  VL ++I+P +VD+NV
Sbjct: 242 PEFTRSGTDFQSFFINNRSVSSRAISNALRTGYYTLLPKGRYPAAVLNIQINPEEVDINV 301

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISS--------------- 344
           HP KS++R  +   I + I +S++ A+ +  +  S    +   S                
Sbjct: 302 HPRKSHVRLSHEQDIMDAISESVKTALGQAELIPSVNKKENDKSQETSVQLNIKEVGNKS 361

Query: 345 -FHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATH 403
              +DN  +    +Y TS T  ++ L    N  S  D       +        E  E+  
Sbjct: 362 QVSKDNIIREKPAEYKTSKTGEKKHLKSATNVSSIKDTEKRLKRSERLTTAENENKESQI 421

Query: 404 YQLG------------IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK 451
            +                  Q+ + YI+++    LV++DQHAAHER+++E +R   NS  
Sbjct: 422 PKQSSGIQLQSESSNIKVLGQVDELYIVAEMDSRLVLIDQHAAHERIMYEHIR---NSKN 478

Query: 452 ITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQ 511
              Q L++P  ++L   E  L+ E+   L   G     FGP+   I  +P I      P 
Sbjct: 479 PDWQELISPITLELSIKEKVLMEEYIPYLEEFGFAISEFGPSTYIITSVPVIFGNIEKPD 538

Query: 512 LLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSS 571
            L D+I EI+ +          + +  T+AC  +I++G    + +M  L+ +++   N  
Sbjct: 539 TLHDMISEILSAGRIKNDVGIYDYMCKTIACRSAIKAGHICNTEQMENLIVQLKNTQNPY 598

Query: 572 QCNHGRPTFIKLKLSDIEKLFGR 594
            C HGRPT +     ++ ++F R
Sbjct: 599 TCPHGRPTMLSFTRDELYRMFKR 621


>gi|294084710|ref|YP_003551468.1| DNA mismatch repair enzyme [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664283|gb|ADE39384.1| DNA mismatch repair enzyme [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 613

 Score =  533 bits (1372), Expect = e-149,   Method: Composition-based stats.
 Identities = 222/609 (36%), Positives = 363/609 (59%), Gaps = 16/609 (2%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR+L ++++NQIAAGE++ERP+ A+KEL+EN+LDA + ++   +  GG     +TD+G 
Sbjct: 4   RIRQLPDRLVNQIAAGEVVERPASALKELVENALDAGAGKISITLKRGGIDEIIVTDDGS 63

Query: 62  GMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           GM+ ++I +AVQRH TSK+ DD   +I   GFRGEALPSIGAVS L+L S     +   +
Sbjct: 64  GMSLDDIKLAVQRHATSKLPDDNLVHIKALGFRGEALPSIGAVSRLSLTSIMADMDHAWR 123

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + +    +    P A+  G+++ V  LF  +PARL FLK+E+ E     D+++R+A+A+P
Sbjct: 124 LVVDAGHVHDPEPAALKQGSMIAVNQLFKAVPARLKFLKTERTEQGQCVDMVKRLAMAWP 183

Query: 181 KVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            V+F  S    +  +++           R+S ++G+ F + A E++   + ITL G  G+
Sbjct: 184 TVAFDLSNDGRSLIRLDACLPGAAGLKRRLSAIMGQSFADEAAEMDAVRDRITLTGLVGL 243

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT NR      ++F+NGR + D+ +L  +R  Y +T+P GR+P+  L + + P  VDVNV
Sbjct: 244 PTMNRPTTGHVFLFVNGRPINDRSLLGAVRAGYGDTLPRGRHPMCALFISLPPEDVDVNV 303

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTH----- 354
           HPAK+ +RF++   +R  ++  I+  +   GI  +S   ++ ++     ++  +      
Sbjct: 304 HPAKAEVRFKDAAAVRGLLVGGIRARLEDAGIQATSEGGQQALARLSSSSSSSSSSSSFS 363

Query: 355 ------LPKYATSLTNTQEKLFLQENRLST---NDLLPSDDPTYSEDNDPVEESEATHYQ 405
                       S   +  +   Q    ++           P   + +    +  A H  
Sbjct: 364 GFTAGGSGARGISHVASGPRAHYQPAPPASAHMWQSPVEAPPAARQIDINEADESARHNL 423

Query: 406 LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDL 465
           LG A AQ+H+ YI+++T DG+ I+DQHAAHERL+ E+M+     T + SQ LL PE+I++
Sbjct: 424 LGAAKAQLHKTYIVAETEDGIAIIDQHAAHERLVMERMKAAMAETGVPSQALLLPEVINM 483

Query: 466 LEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSST 525
            E  C  +++  + L ++G+  E FG  A+ +R++PA+L   N+ QL++DI +E+I+   
Sbjct: 484 QEHHCEAVLDAADMLGKMGLTVENFGVGAVVVRDVPAMLGNPNVVQLVQDIAEELIELGD 543

Query: 526 TYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKL 585
           + +L+DRI ++LAT++C+GS+R+GR +   EMN LLREME  P S QCNHGRPT++ L L
Sbjct: 544 STSLEDRINHVLATVSCHGSVRAGRILNGDEMNALLREMEVTPRSGQCNHGRPTWVSLSL 603

Query: 586 SDIEKLFGR 594
           ++IE LFGR
Sbjct: 604 TEIETLFGR 612


>gi|260440446|ref|ZP_05794262.1| DNA mismatch repair protein [Neisseria gonorrhoeae DGI2]
 gi|291043745|ref|ZP_06569461.1| DNA mismatch repair protein mutL [Neisseria gonorrhoeae DGI2]
 gi|291012208|gb|EFE04197.1| DNA mismatch repair protein mutL [Neisseria gonorrhoeae DGI2]
          Length = 658

 Score =  532 bits (1371), Expect = e-149,   Method: Composition-based stats.
 Identities = 213/658 (32%), Positives = 337/658 (51%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ V+  + GGG    ++ DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAVDVELEGGGIRLIRVGDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  ++ + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGDDFQTASLEIDSGNSALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL LE+ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLELPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRANLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDL-- 381
                   +++     K  +     ++ KT    Y  +    Q  L L+E+R + +    
Sbjct: 359 DSENLFDSASNHPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMDTYAE 418

Query: 382 ---------LPSDDPTYSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
                    L       +   +   E+ A                    G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSQFEQARFGNMPSETPAHKTDTPLSDGIPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++       + SQ LL P        ECA + +H
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQHLLIPVTFAASHEECAALADH 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R  P +L K ++  L RD++ E+    ++ T+      I
Sbjct: 539 AETLAGFGLELSDMGGNTLAVRAAPVMLGKSDVVSLARDVLGELAQVGSSQTIASHENRI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDTLFLR 656


>gi|240014088|ref|ZP_04721001.1| DNA mismatch repair protein [Neisseria gonorrhoeae DGI18]
 gi|240016522|ref|ZP_04723062.1| DNA mismatch repair protein [Neisseria gonorrhoeae FA6140]
 gi|240115743|ref|ZP_04729805.1| DNA mismatch repair protein [Neisseria gonorrhoeae PID18]
 gi|240121649|ref|ZP_04734611.1| DNA mismatch repair protein [Neisseria gonorrhoeae PID24-1]
 gi|268601421|ref|ZP_06135588.1| DNA mismatch repair protein [Neisseria gonorrhoeae PID18]
 gi|268585552|gb|EEZ50228.1| DNA mismatch repair protein [Neisseria gonorrhoeae PID18]
          Length = 654

 Score =  532 bits (1371), Expect = e-149,   Method: Composition-based stats.
 Identities = 215/654 (32%), Positives = 340/654 (51%), Gaps = 65/654 (9%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ V+  + GGG    ++ DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAVDVELEGGGIRLIRVGDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  ++ + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGDDFQTASLEIDSGNSALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL LE+ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLELPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK-------------------KGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                      G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRANLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 341 MISSFHQDNAP-----------------KTHLPKYATSLTNTQEKLFLQENRLSTNDL-- 381
              +     +                  KT    Y  +    Q  L L+E+R + +    
Sbjct: 359 DGENLFDSASNHPTGNKPDIRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMDTYAE 418

Query: 382 ---------LPSDDPTYSEDNDPVEESEATH-----------YQLGIACAQIHQNYIISQ 421
                    L       +   +   ES   +             LG A AQ+   YI++Q
Sbjct: 419 LYKKTDNIDLELSQFEQARFGNMPSESSTNNVSDGIGQASELPPLGFAIAQLLGIYILAQ 478

Query: 422 TTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEHDEDL 480
             D L+++D HAA ER+ +EKM++       + SQ LL P        ECA + +H E L
Sbjct: 479 AEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQHLLIPVTFAASHEECAALADHAETL 538

Query: 481 HRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATM 540
              G++    G N +A+R  P +L K ++  L RD++ E+    ++ T+      ILATM
Sbjct: 539 AGFGLELSDMGGNTLAVRAAPVMLGKSDVVSLARDVLGELAQVGSSQTIASHENRILATM 598

Query: 541 ACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 SCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDTLFLR 652


>gi|59801161|ref|YP_207873.1| DNA mismatch repair protein [Neisseria gonorrhoeae FA 1090]
 gi|240118039|ref|ZP_04732101.1| DNA mismatch repair protein [Neisseria gonorrhoeae PID1]
 gi|268603752|ref|ZP_06137919.1| DNA mismatch repair protein [Neisseria gonorrhoeae PID1]
 gi|81311203|sp|Q5F8M6|MUTL_NEIG1 RecName: Full=DNA mismatch repair protein mutL
 gi|59718056|gb|AAW89461.1| putative DNA mismatch repair protein [Neisseria gonorrhoeae FA
           1090]
 gi|268587883|gb|EEZ52559.1| DNA mismatch repair protein [Neisseria gonorrhoeae PID1]
          Length = 658

 Score =  532 bits (1371), Expect = e-149,   Method: Composition-based stats.
 Identities = 213/658 (32%), Positives = 337/658 (51%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ V+  + GGG    ++ DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAVDVELEGGGIRLIRVGDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  ++ + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGDDFQTASLEIDSGNSALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL LE+ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLELPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRANLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDL-- 381
                   +++     K  +     ++ KT    Y  +    Q  L L+E+R + +    
Sbjct: 359 DGENLFDSASNHPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMDTYAE 418

Query: 382 ---------LPSDDPTYSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
                    L       +   +   E+ A                    G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSQFEQARFGNMPSETPAHKTDTPLSDGIPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++       + SQ LL P        ECA + +H
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQHLLIPVTFAASHEECAALADH 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R  P +L K ++  L RD++ E+    ++ T+      I
Sbjct: 539 AETLAGFGLELSDMGGNTLAVRAAPVMLGKSDVVSLARDVLGELAQVGSSQTIASHENRI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDTLFLR 656


>gi|33603032|ref|NP_890592.1| DNA mismatch repair protein [Bordetella bronchiseptica RB50]
 gi|81836878|sp|Q7WG61|MUTL_BORBR RecName: Full=DNA mismatch repair protein mutL
 gi|33568663|emb|CAE34421.1| DNA mismatch repair protein [Bordetella bronchiseptica RB50]
          Length = 629

 Score =  532 bits (1371), Expect = e-149,   Method: Composition-based stats.
 Identities = 203/629 (32%), Positives = 336/629 (53%), Gaps = 43/629 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            I  L + +I+QIAAGE+IERP+  +KE++EN++DA +  +E  + GGG     +TD+G 
Sbjct: 6   PIATLPDLLISQIAAGEVIERPASVLKEILENAIDAGARAIEVRLEGGGIRRIAVTDDGS 65

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  EE+P+A+ RH TSKI   D+  ++ + GFRGEAL SI +V+ LT++SR        
Sbjct: 66  GIPPEELPLALTRHATSKIRSLDELESVASMGFRGEALASIASVADLTIISRTRGAEHAW 125

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI     ++    P +  PGT ++VR LF  +PAR  FL+SE  E     D + R+A+A+
Sbjct: 126 QIDGGSLQV---SPASGPPGTTIDVRQLFDRVPARRKFLRSEATEFGHCVDAMERIALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P+V+F        + +        +  +RI  V+G +F+ + + +   +  I L G    
Sbjct: 183 PEVAFRLFHHDRAQRQWLP----ADHGQRIRDVLGAEFVGHVLPVQAAAGAIALMGMVTR 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT  R  A++ Y+++NGR V+D+ +   +R+AYA+ +   R P  VL L+IDP  VDVNV
Sbjct: 239 PTAARARADRQYLYVNGRFVRDRTVSHALRSAYADVLHGDRQPAYVLYLDIDPGAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVL---------------------- 337
           HPAK  +RFR+   +  F+ Q + + + + G + +                         
Sbjct: 299 HPAKHEVRFRDSGAVHRFVSQVVGQTLAQTGGAEAVPAGVPDGAAPDAAYAGEPAAAAPG 358

Query: 338 ---SKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLL---------PSD 385
               +    + +       +    A   T    +L  +   +   D            + 
Sbjct: 359 LAEPRAPYPAAYPSPGQSPYQGSPARPHTQVPFRLHGEPAGIPATDWQSLYRPLPGDAAP 418

Query: 386 DPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQ 445
             T            A  + LG A AQ+H  YI++Q + GLV+VD HAAHER+++E++++
Sbjct: 419 AATALRAAPATPLPTADEHPLGQALAQLHGIYILAQNSRGLVLVDMHAAHERVVYEQLKR 478

Query: 446 DFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILS 505
             +   +  Q LL P +    E + AL+ EH+  L+ LG +    GP +IA+R +PA+L+
Sbjct: 479 ALDDRALPRQDLLVPVVFHAAEKDVALVEEHETQLNELGFEMRPSGPASIAVRSVPALLA 538

Query: 506 KKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREME 565
           + +I  L R ++ ++     +  L ++   +L+TMAC+GS+R+ R++   EMN LLR+ME
Sbjct: 539 RGDIESLARAVLRDLGAVGVSRLLTEQRNELLSTMACHGSVRANRRLTLEEMNALLRQME 598

Query: 566 KNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
               + QCNHGRPT+++  ++D++KLF R
Sbjct: 599 ITERADQCNHGRPTWVQWSVNDLDKLFLR 627


>gi|329120521|ref|ZP_08249185.1| DNA mismatch repair protein MutL [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327461260|gb|EGF07592.1| DNA mismatch repair protein MutL [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 699

 Score =  532 bits (1371), Expect = e-149,   Method: Composition-based stats.
 Identities = 206/634 (32%), Positives = 327/634 (51%), Gaps = 45/634 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ +   I GGG    ++TDNG 
Sbjct: 68  RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAISVEIEGGGVKLLRVTDNGA 127

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++ +A+ RH TSKIS   D   + + GFRGE L SI +VS LTL SR        
Sbjct: 128 GIHPDDLALALSRHATSKISGLRDLERVASMGFRGEGLASIASVSRLTLTSRQSGEGHAR 187

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            I      +S V   A   GT VEV DLFF  PAR  FLKS+  E      ++ R+A+A+
Sbjct: 188 TIRAEDGSLSPVSAAAAPEGTTVEVADLFFNTPARRKFLKSDNTEAAHCAAMLERLALAF 247

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P  +F+ +      +K+  Q+       R + ++G DF   ++ ++ ++  +TL G    
Sbjct: 248 PATAFSLTREGKPVFKLPPQT----LEARAAAIVGHDFQTASLPVSAQAGGMTLYGLIAK 303

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G + Q Y F+N R V+DK IL  ++ AY + +     P  VL L++ P  VD NV
Sbjct: 304 PTFAKGKSTQQYCFVNRRCVRDKVILHAVKQAYRDVLHHALVPAFVLFLDLPPEAVDANV 363

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVL------------SKKMISSFHQ 347
           HPAK+ IRFR+ + +  F+  ++ KA+       +  +                      
Sbjct: 364 HPAKTEIRFRDSSAVHQFVFHTLDKALADTRADRTESIGNAGALLHQIAGIPDADRPSEN 423

Query: 348 DNAPKTHLPKYATSLTNTQEKLFLQENR-----------------------LSTNDLLPS 384
              P +  P   T    T    + +  +                          +  L +
Sbjct: 424 PQNPFSDAPNAPTGGGKTAPAPYARAPQQRSLGLNESRRALDTYAELYRRSPQEDHELAA 483

Query: 385 DDPTYSEDNDPVEESE---ATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFE 441
            + +     +   E+       + LG A AQ+   YI++Q  D L+++D HAA ER+ +E
Sbjct: 484 LEHSRRLPPERPSENPSDNPPEHPLGYAIAQLLGIYILAQAEDSLLLIDMHAAAERVNYE 543

Query: 442 KMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREI 500
           KM++  ++   + SQ+LL P        E A + EH + L   G+     G N IA+R +
Sbjct: 544 KMKRQRDTQGRLNSQSLLIPVTFAASREETAALAEHADSLRAYGLDLSAVGENRIAVRAV 603

Query: 501 PAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRL 560
           P +L   +I  L RD++ +  +   +  ++ R   +LATM+C+GS+R+GR++   EMN L
Sbjct: 604 PQMLGTSDIESLARDMLRDFAEHGASQQIEARENRLLATMSCHGSVRAGRRLTLPEMNAL 663

Query: 561 LREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 664 LRDMEHTPRSNQCNHGRPTWVKLTLKELDALFLR 697


>gi|85373986|ref|YP_458048.1| DNA mismatch repair protein [Erythrobacter litoralis HTCC2594]
 gi|84787069|gb|ABC63251.1| DNA mismatch repair enzyme [Erythrobacter litoralis HTCC2594]
          Length = 607

 Score =  532 bits (1371), Expect = e-149,   Method: Composition-based stats.
 Identities = 220/609 (36%), Positives = 357/609 (58%), Gaps = 18/609 (2%)

Query: 1   MK-IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDN 59
           M  IR+L E ++N+IAAGE++ERPS A+KEL+EN++DA ++R+   +  GG +  ++TD+
Sbjct: 1   MPTIRRLPEALVNRIAAGEVVERPSAALKELVENAVDAGATRIAVHLIDGGLTRIEVTDD 60

Query: 60  GFGMTSEEIPMAVQRHCTSKISDDF-------SNIHTFGFRGEALPSIGAVSHLTLMSRP 112
           G GM    + +A++RH TSK+ DD          + T GFRGEALPSIG+VS   L SRP
Sbjct: 61  GCGMDPAAMELALERHATSKLPDDLIGEAQAIERVATLGFRGEALPSIGSVSRFALESRP 120

Query: 113 PQNNTGAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVI 172
             +  G +  +    +    P A+ PGT   +  +F  +PAR  FL++ + E     DVI
Sbjct: 121 HGSEQGWRRVVDHGTLVEEGPAALPPGTRARIEQVFAKVPARRKFLRTPRSEYGACLDVI 180

Query: 173 RRMAIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEIT 232
           RR+A+A P + FT    +   + +         P+R++Q++  +  +NAV L+ + + +T
Sbjct: 181 RRLAMARPDIGFTLDHGERRVFALQ---PGEELPDRVAQIVAPELKDNAVLLDMQRDTMT 237

Query: 233 LQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDP 292
           L G  G+PT+NRG A+  Y+F+NGR V+D+ ++  +R AY++ +   R+ V+ L L++  
Sbjct: 238 LTGIAGLPTYNRGVADHQYLFVNGRPVKDRLLVGAVRGAYSDMLARDRHAVLALFLDLPS 297

Query: 293 RQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPK 352
             VDVNVHPAK+ +RFR+   +R FI+  +++A++     ++    +  +  + Q+   +
Sbjct: 298 EDVDVNVHPAKTEVRFRDAQAVRGFIVSGLRQALSTGDRRSAQGPDRTAMKRWQQEPVRE 357

Query: 353 THLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESE------ATHYQL 406
              P   +              R  +++    +    +       E+E        H+ L
Sbjct: 358 EPSPALRSIFEGRGWSKPGTGVREPSHEWHSHEGEVIASPQGRAVEAEDIAADAKQHFPL 417

Query: 407 GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKIT-SQTLLTPEIIDL 465
           G+A  Q+   YI+++  DGLV+VDQHAAHERL+ E+++       ++ SQ LL PE+++L
Sbjct: 418 GVARGQVANTYIVAEAADGLVLVDQHAAHERLVLERLKAAGAGEAVSRSQALLMPEVVEL 477

Query: 466 LEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSST 525
            E  C  +    E L  +G+  ERFGP A+ +R +P  L+  N  +LL+DI D++     
Sbjct: 478 DEPSCDRLESAAEKLDAMGLSIERFGPGAMLVRSLPHALAGSNPGKLLQDIADDLAKHGD 537

Query: 526 TYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKL 585
              L+++++ +L TMAC+GS+R+GR ++  EMN LLREME+ P S QCNHGRPT++KL +
Sbjct: 538 ALWLEEKLDLVLGTMACHGSVRAGRTLRVDEMNALLREMERTPRSGQCNHGRPTWVKLSM 597

Query: 586 SDIEKLFGR 594
            D+EKLFGR
Sbjct: 598 EDVEKLFGR 606


>gi|257094379|ref|YP_003168020.1| DNA mismatch repair protein MutL [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257046903|gb|ACV36091.1| DNA mismatch repair protein MutL [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 615

 Score =  532 bits (1371), Expect = e-149,   Method: Composition-based stats.
 Identities = 199/612 (32%), Positives = 332/612 (54%), Gaps = 23/612 (3%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + +I+QIAAGE+++RP+  +KEL+EN+LDA SS ++  +  GG    +++D+G 
Sbjct: 6   RIALLPDLLISQIAAGEVVDRPASVLKELLENALDAGSSTIQIQLEEGGVKLLRVSDDGG 65

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG- 118
           GM  +E+ +A+ RH TSKI+   D   + T GFRGEAL S+ AV+ LTL SR   ++   
Sbjct: 66  GMARDELALALTRHATSKINSLADLERVGTLGFRGEALASVAAVARLTLTSRQASSDRAA 125

Query: 119 --AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMA 176
                 ++ E  +  +P A+  GT+VE+RDL++  PAR  FLKSE  E     + ++R+A
Sbjct: 126 GQHAWRLTDEPGAGPQPAALQAGTVVEMRDLYYNTPARRKFLKSEGSEFAHCAEAVKRIA 185

Query: 177 IAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGY 236
           +A+P V+FT S        ++      +   R+  ++G++F+  +  L+  +  + + GY
Sbjct: 186 LAHPGVAFTLSHNGRVALHLSA----SDSRVRVGAILGDEFLAESRCLDVSAGPLRVAGY 241

Query: 237 TGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
             +P ++R   +  Y ++NGR V+DK +   +R AY + +   RYP   L L+IDP  VD
Sbjct: 242 CALPAYSRARGDAQYCYVNGRFVRDKLLGHALRQAYQDLLHGSRYPAYCLFLDIDPAGVD 301

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKK-----GISTSSVLSKKMISSFHQDNAP 351
           VNVHP K+ +RFR+   +  F+  ++Q+ +          S+S V +     S   +  P
Sbjct: 302 VNVHPQKTEVRFRDARAVHQFVFHAVQRLLASPLATLGTASSSEVPTPNTQVSPWPEQRP 361

Query: 352 KTHLPKYATSL-----TNTQEKLFLQENRLSTNDLLPSDDPTYSEDND----PVEESEAT 402
                  A  +     T  Q  L + E   +   L   D     E            +  
Sbjct: 362 AAPAMHAAEPVAFGRRTPFQGSLHVGEPARAGTYLSFVDATQSPEPAPEELSNAAGDDGR 421

Query: 403 HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEI 462
              LG A AQ+   YI++Q T GL++VD HAAHER+++E+++Q  +  ++ +Q LL P +
Sbjct: 422 APPLGYALAQLQGVYILAQNTHGLIVVDMHAAHERILYERLKQALDGERVATQPLLIPAV 481

Query: 463 IDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIID 522
                 + A   EH   L RLG      GP  +A+R +PA+L   +   L+R ++ E+ +
Sbjct: 482 FMADALDVAAAEEHSVALQRLGFDVAAMGPRQLAVRSVPALLLGGDPAALVRSLLGELRE 541

Query: 523 SSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIK 582
              +  +      +LA+MAC+G++R+ R +   EMN LLR+ME+   S  CNHGRPT+++
Sbjct: 542 HGISQLMTTHRNELLASMACHGAVRARRLLSLSEMNALLRQMEETERSDHCNHGRPTWMQ 601

Query: 583 LKLSDIEKLFGR 594
             ++++++ F R
Sbjct: 602 FSMAELDRYFQR 613


>gi|170698332|ref|ZP_02889407.1| DNA mismatch repair protein MutL [Burkholderia ambifaria IOP40-10]
 gi|170136751|gb|EDT05004.1| DNA mismatch repair protein MutL [Burkholderia ambifaria IOP40-10]
          Length = 661

 Score =  532 bits (1370), Expect = e-149,   Method: Composition-based stats.
 Identities = 199/644 (30%), Positives = 330/644 (51%), Gaps = 59/644 (9%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L +++I+QIAAGE++ERP+  +KEL+EN++DA ++ +  V+  GG     ITD+G G
Sbjct: 23  IQPLPDQLISQIAAGEVVERPASVVKELLENAMDAGATTLRIVLEEGGVKRISITDDGCG 82

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +   E+P+A+ RH TSKI   ++   + T GFRGEAL SI +V+ +++ SR        +
Sbjct: 83  IPPGELPLALMRHATSKIRSLEELEAVATLGFRGEALASIASVAEMSITSRTADVAHATK 142

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I        ++ P A   GT +EVR+L+F  PAR  FLKSEQ E     ++IRR A+A P
Sbjct: 143 I---DATTGALSPAAGAVGTTIEVRELYFNTPARRKFLKSEQTEFGHCLEMIRRAALARP 199

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V+ +           N         +R+++++G+ F    + L+E++  + + G  G+P
Sbjct: 200 DVAISVLHNGKAVEHWNATEP----AQRVAKILGDGFATAHLPLDEQAGPLAVYGCAGLP 255

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           T +RG A+Q Y F+NGR V+DK +   +R AY + +   RYP  VL L++ P  VDVNVH
Sbjct: 256 TASRGRADQQYFFVNGRFVRDKLLTHAVRAAYEDVLHGDRYPSYVLFLDLPPEAVDVNVH 315

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVL---SKKMISSFHQDNAPKTHLP- 356
           P+K  +RFR+   I  ++  ++Q+A+ +   ++           +S      A   + P 
Sbjct: 316 PSKIEVRFRDSRSIHQYVFHAVQRALARHAGASPETTAGGHAAQLSPAPGGPASFLNTPL 375

Query: 357 -------------KYATSLTNTQEKLFLQENRLS-------------------------- 377
                           +S +++    ++++ R++                          
Sbjct: 376 GLGAATGTGGSGFSSPSSSSSSAGNTWMRQARMTQGTLPVAQPLALYDALFGRKDTGAGT 435

Query: 378 -------TNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVD 430
                   +D     +        P+  +      LG A  QIH  Y+++Q   GLVIVD
Sbjct: 436 PDGTTVIAHDSASVTNTPPGFVASPLAATAHDEQPLGFALGQIHGIYVLAQNAHGLVIVD 495

Query: 431 QHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERF 490
            HAAHER+++E+ +       I  Q+LL P  +     E   + E  + L  LG      
Sbjct: 496 MHAAHERILYEQFKNALADRTIAVQSLLLPISMTATPVEIGTVEEERDTLESLGFDLAVL 555

Query: 491 GPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGR 550
            P  +AIR +PA+L   ++  L R ++ ++     +  L +R   +L T+AC+ ++R+ R
Sbjct: 556 SPTTLAIRAVPALLKDADLQSLARAVLADLHAFGGSRVLTERQHELLGTLACHHAVRANR 615

Query: 551 KMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ++   EMN LLR+ME    + QCNHGRPT+ +L L+D+++LF R
Sbjct: 616 RLTLDEMNALLRQMEATERADQCNHGRPTWYQLTLNDLDRLFMR 659


>gi|182677997|ref|YP_001832143.1| DNA mismatch repair protein MutL [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|238691233|sp|B2II71|MUTL_BEII9 RecName: Full=DNA mismatch repair protein mutL
 gi|182633880|gb|ACB94654.1| DNA mismatch repair protein MutL [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 637

 Score =  532 bits (1370), Expect = e-149,   Method: Composition-based stats.
 Identities = 233/636 (36%), Positives = 368/636 (57%), Gaps = 42/636 (6%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L   +I++IAAGE+IERP+ A+KEL+EN+LDA++S ++ V+ GGGK+  ++TDNG
Sbjct: 1   MTIRRLDPVLIDRIAAGEVIERPAAAVKELVENALDAQASEIDVVLEGGGKTLIRVTDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM++E++ ++V+RH TSK+ D D   I T GFRGEALPSIG+VS L+L SR      G 
Sbjct: 61  CGMSAEDLELSVERHATSKLPDGDLFAIATLGFRGEALPSIGSVSVLSLTSRMETATHGV 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            +++   +  +V P     GT +EVR+LF T PARL FLK ++ E     D ++R+A+A+
Sbjct: 121 ALSVEHGRKQTVIPCGQPRGTRIEVRELFRTTPARLKFLKGDRAEARAAADAVQRLAMAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQS-TNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           P   FTF++  +  +     +        RI  V+G+DF  NA+ +  +   I L+G+ G
Sbjct: 181 PTRRFTFTSTDTAGFDYLPCAEGPEGLLARIGAVLGKDFEANALPVEAEREGIILEGFIG 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PT++R N    Y+F+NGR V+DK +   +R AY + +P GRYP + L L  DP++VDVN
Sbjct: 241 LPTWHRANGLAQYLFVNGRPVRDKLLTGAVRAAYMDYLPAGRYPALALFLRCDPQEVDVN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHPAK+ +RFR+  ++R  ++ ++++ + +     +    +  +      +A +   P  
Sbjct: 301 VHPAKAEVRFRDQGLVRGLLVGALKQTLQQAMHRATPDGGRVALGLLAMHSAGQGQRPVS 360

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDN------------------------- 393
           + S+ +   +      R    + +   D   S                            
Sbjct: 361 SASMPSASRQAPTMPPRDWIKEGVQDWDWRQSPARPQNPPQNPPPGDRIEMSGSLPLGFA 420

Query: 394 --------------DPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLI 439
                                     LG A AQ+H+ YI++QT DG V+VDQHAAHERL+
Sbjct: 421 ETPAGLNGDSGKELSEAASETPHDEPLGFARAQLHETYIVAQTRDGFVLVDQHAAHERLV 480

Query: 440 FEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIRE 499
           +E+++Q   +  +  Q LL P I++L E +   +++    L   G+  E FGP A+A+RE
Sbjct: 481 YERLKQARAAQTVERQILLLPTIVELPEADVERLVDAASMLADFGLVVESFGPGALAVRE 540

Query: 500 IPAILSKKNIPQLLRDIIDEIIDSSTTY-TLQDRIENILATMACYGSIRSGRKMQSIEMN 558
           IP +L   ++P L+ D+ +++ +       L+ +++++LAT AC+ S+R+GR++   EMN
Sbjct: 541 IPIVLKDGSVPALIHDLANQLQEDDKALIPLERKLDHVLATFACHHSVRAGRRLGIEEMN 600

Query: 559 RLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            LLREME+ P S QCNHGRPT+I+LKL DIE+LFGR
Sbjct: 601 ALLREMERTPGSGQCNHGRPTYIELKLGDIERLFGR 636


>gi|33591485|ref|NP_879129.1| DNA mismatch repair protein [Bordetella pertussis Tohama I]
 gi|81836381|sp|Q7W0A6|MUTL_BORPE RecName: Full=DNA mismatch repair protein mutL
 gi|33571127|emb|CAE40624.1| DNA mismatch repair protein [Bordetella pertussis Tohama I]
 gi|332380926|gb|AEE65773.1| DNA mismatch repair protein [Bordetella pertussis CS]
          Length = 629

 Score =  532 bits (1370), Expect = e-149,   Method: Composition-based stats.
 Identities = 203/629 (32%), Positives = 336/629 (53%), Gaps = 43/629 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            I  L + +I+QIAAGE+IERP+  +KE++EN++DA +  +E  + GGG     +TD+G 
Sbjct: 6   PIATLPDLLISQIAAGEVIERPASVLKEILENAIDAGARAIEVRLEGGGIRRIAVTDDGS 65

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  EE+P+A+ RH TSKI   D+  ++ + GFRGEAL SI +V+ LT++SR        
Sbjct: 66  GIPPEELPLALTRHATSKIRSLDELESVASMGFRGEALASIASVADLTIISRTRGAEHAW 125

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI     ++    P +  PGT ++VR LF  +PAR  FL+SE  E     D + R+A+A+
Sbjct: 126 QIDGGSLQV---SPASGPPGTTIDVRQLFDRVPARRKFLRSEATEFGHCVDAMERIALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P+V+F        + +        +  +RI  V+G +F+ + + +   +  I L G    
Sbjct: 183 PEVAFRLFHHDRAQRQWLP----ADHGQRIRDVLGAEFVGHVLPVLAAAGAIALMGMVTR 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT  R  A++ Y+++NGR V+D+ +   +R+AYA+ +   R P  VL L+IDP  VDVNV
Sbjct: 239 PTAARARADRQYLYVNGRFVRDRTVSHALRSAYADVLHGDRQPAYVLYLDIDPGAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVL---------------------- 337
           HPAK  +RFR+   +  F+ Q + + + + G + +                         
Sbjct: 299 HPAKHEVRFRDSGAVHRFVSQVVGQTLAQTGGAEAVPAGVPDGAAPDTAYAGEPAAAAPG 358

Query: 338 ---SKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLL---------PSD 385
               +    + +       +    A   T    +L  +   +   D            + 
Sbjct: 359 LAEPRAPYPAAYPSPGQSPYQGSPARPHTQVPFRLHGEPAGIPATDWQSLYRPLPGDAAP 418

Query: 386 DPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQ 445
             T            A  + LG A AQ+H  YI++Q + GLV+VD HAAHER+++E++++
Sbjct: 419 AATALRAAPATPLPTADEHPLGQALAQLHGIYILAQNSRGLVLVDMHAAHERVVYEQLKR 478

Query: 446 DFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILS 505
             +   +  Q LL P +    E + AL+ EH+  L+ LG +    GP +IA+R +PA+L+
Sbjct: 479 ALDDRALPRQDLLVPVVFHAAEKDVALVEEHETQLNELGFEMRPSGPASIAVRSVPALLA 538

Query: 506 KKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREME 565
           + +I  L R ++ ++     +  L ++   +L+TMAC+GS+R+ R++   EMN LLR+ME
Sbjct: 539 RGDIESLARAVLRDLGAVGVSRLLTEQRNELLSTMACHGSVRANRRLTLEEMNALLRQME 598

Query: 566 KNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
               + QCNHGRPT+++  ++D++KLF R
Sbjct: 599 ITERADQCNHGRPTWVQWSVNDLDKLFLR 627


>gi|307545956|ref|YP_003898435.1| DNA mismatch repair protein [Halomonas elongata DSM 2581]
 gi|307217980|emb|CBV43250.1| DNA mismatch repair protein [Halomonas elongata DSM 2581]
          Length = 661

 Score =  532 bits (1370), Expect = e-149,   Method: Composition-based stats.
 Identities = 210/653 (32%), Positives = 343/653 (52%), Gaps = 61/653 (9%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L  ++ NQIAAGE++ERPS  +KEL+EN++DA S R+E  +  GG    ++ D+G G
Sbjct: 7   IQVLDPRLANQIAAGEVVERPSSVVKELVENAIDAGSRRIEVELESGGARLIRVRDDGVG 66

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNN-TGA 119
           +  E++P+A+ RH TSKI+  DD   + + GFRGEAL SI +VS L LMS    +  +G 
Sbjct: 67  IGEEDLPLALSRHATSKIASLDDLEGVASLGFRGEALASISSVSRLELMSNVDDDPTSGW 126

Query: 120 QIAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           ++ + G ++     P     GT V VRDLFF  PAR  FL++E+ E   + +  RR A++
Sbjct: 127 RVVVEGRRMEPRVTPSPHPRGTSVTVRDLFFNTPARRKFLRTEKTEFGHVEEAFRRQALS 186

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              + +     +   ++++          R+  ++G+ F+ NA+ L+ ++  + L G+ G
Sbjct: 187 RLDLGWVLRHNQKTIHQLSPGGDLVGHERRLQALLGKAFLENALHLDIETGGLRLWGWVG 246

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PT +R  A+Q Y F+NGR V+D+ +   IR AY + +  GR+PV VL LE+DP  VDVN
Sbjct: 247 LPTHSRAQADQQYFFVNGRVVRDRLVAHAIRQAYRDVLFHGRHPVFVLYLEVDPTVVDVN 306

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAI--NKKGISTSSVLSKKMISSFHQDNAPKTHLP 356
           VHP K  +RFR+  ++ +F+  S+ +A+   + G      ++++  +      A      
Sbjct: 307 VHPTKHEVRFRDGRMVHDFLFSSLHRALGEARAGQPGEGRVTEESPAGESASQASAPAAS 366

Query: 357 KYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDN----------------------- 393
           + A S    Q++      R  ++    + D   +                          
Sbjct: 367 EVAESAGRWQQQPMALHGRDESDGQKVTPDRVRAFMEGYRALHPEHEESLLTPQPSAPGA 426

Query: 394 ---------------------------DPVEESEATHYQLGIACAQIHQNYIISQTTDGL 426
                                         EE       LG A AQ+H  YI+SQT  GL
Sbjct: 427 GGNAAEVALAEREASPAAATSSPAPAPAMPEEDATKAPPLGYAVAQLHGIYILSQTERGL 486

Query: 427 VIVDQHAAHERLIFEKMRQDF-----NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLH 481
           V+VD HAAHER+++E+M+        N   + +Q LL P  +     E A      E   
Sbjct: 487 VVVDMHAAHERIVYERMKAQVHGEAGNGGGLQAQPLLVPVSLAASAAEVATAEAEREAFS 546

Query: 482 RLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMA 541
           RLG++ +  GP  + +R++PA+L   ++  L+RD++ ++     +  L+  I  +L+TMA
Sbjct: 547 RLGVELDVAGPETLLVRQVPALLVDADVEPLVRDMLGDLERYGRSDRLEAHINELLSTMA 606

Query: 542 CYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           C+GS+R+ R++ + EMN LLR+ME+   S QCNHGRPT+ ++ L ++++LF R
Sbjct: 607 CHGSVRANRQLTTAEMNALLRDMERTERSGQCNHGRPTWTEMSLKELDRLFLR 659


>gi|240125775|ref|ZP_04738661.1| DNA mismatch repair protein [Neisseria gonorrhoeae SK-92-679]
 gi|268684372|ref|ZP_06151234.1| DNA mismatch repair protein [Neisseria gonorrhoeae SK-92-679]
 gi|268624656|gb|EEZ57056.1| DNA mismatch repair protein [Neisseria gonorrhoeae SK-92-679]
          Length = 658

 Score =  531 bits (1369), Expect = e-149,   Method: Composition-based stats.
 Identities = 214/658 (32%), Positives = 339/658 (51%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ V+  + GGG    ++ DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAVDVELEGGGIRLIRVGDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  ++ + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGDDFQTASLEIDSGNSALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL LE+ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLELPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK-------------------KGISTSSVLSKK 340
           HP K+ IRFR+   +   +  ++ KA+                      G++ + + S+ 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRANLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 341 MISSFHQDNAP-----------------KTHLPKYATSLTNTQEKLFLQENRLSTNDL-- 381
              +     +                  KT    Y  +    Q  L L+E+R + +    
Sbjct: 359 DGENLFDSASNHPTGNKPDIRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMDTYAE 418

Query: 382 ---------LPSDDPTYSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
                    L       +   +   E+ A                    G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSQFEQARFGNMPSETPAHKTDTPLSDGIPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++       + SQ LL P        ECA + +H
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQHLLIPVTFAASHEECAALADH 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R  P +L K ++  L RD++ E+    ++ T+      I
Sbjct: 539 AETLAGFGLELSDMGGNTLAVRAAPVMLGKSDVVSLARDVLGELAQVGSSQTIASHENRI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDTLFLR 656


>gi|91773654|ref|YP_566346.1| DNA mismatch repair protein MutL [Methanococcoides burtonii DSM
           6242]
 gi|91712669|gb|ABE52596.1| DNA mismatch repair protein MutL [Methanococcoides burtonii DSM
           6242]
          Length = 603

 Score =  531 bits (1369), Expect = e-149,   Method: Composition-based stats.
 Identities = 197/600 (32%), Positives = 314/600 (52%), Gaps = 13/600 (2%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KIR L E  IN+IAAGE+IERP+  +KEL++N++DA ++ +   +   G     +TDNG 
Sbjct: 8   KIRVLDEATINKIAAGEVIERPASVVKELVDNAIDAGATEIRVEVVAAGTELITVTDNGS 67

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           GM  E+  +A  +H TSKI+  +D   + T GFRGEAL SI AV+ + L +R  +   G 
Sbjct: 68  GMPREDAILAFTKHGTSKIAQIEDLEEVLTLGFRGEALSSIAAVARVYLTTRQKKEIAGT 127

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           ++ ISG  + +V  V   PGT + V  LF+  PAR  +LKS + E   ITD++ R A  +
Sbjct: 128 KVVISGGLVENVVEVGAAPGTSISVESLFYNTPARKKYLKSLRTELAHITDIVTRHAFGH 187

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P +SFT  +       +    T+GN  + I  ++G D     V +  +S+ + + GY   
Sbjct: 188 PDISFTLISDGK---VLVRSPTSGNVLDSIIYLLGVDIAKKIVPVEFRSDIVNISGYISK 244

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P   R   +Q + FINGR V    I + +R  Y   IP GRYPV VL LE+D R+VDVNV
Sbjct: 245 PEVTRSGTDQQFFFINGRGVSSTSISNAVRLGYYNLIPKGRYPVAVLDLELDLREVDVNV 304

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGIST--SSVLSKKMISSFHQDNAPKTHLPK 357
           HPAK Y+R  +   + + +I +++ A+    +    S   ++ + + F +++   T +  
Sbjct: 305 HPAKRYVRLSHEREVSDAVILAVENALKGDDLVPKVSLPENRPVQAVFSEESKTGTEVIS 364

Query: 358 Y---ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIH 414
               + S+   +E            +             +   +  +T         Q++
Sbjct: 365 SEGVSVSVPVAKEADEPYHASARDTEKRLKRSERILSKTEKNPDRVSTGLDKARIVGQVN 424

Query: 415 QNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIM 474
           + YII +   G++IVDQHAAHER+++E++R   +S     Q L+TP ++DL   E  L+ 
Sbjct: 425 ELYIIVEFEGGIMIVDQHAAHERVMYEQIRDGNSSG---WQELITPVMLDLTSKEKVLLD 481

Query: 475 EHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIE 534
           E+   L  +G     FGPN+  +  IP++L K    +L+ DII +++ S          +
Sbjct: 482 EYIPLLEEMGFAISEFGPNSFVVTSIPSLLGKLENTELIHDIIMDVLSSGKVKRDTGMFD 541

Query: 535 NILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ++  TMAC  +I++G      +M  LLR+++   N   C HGRPT I     +++KLF R
Sbjct: 542 SLCKTMACRAAIKAGAGCSMDQMENLLRQLDMAENPYTCPHGRPTVISFTKGELDKLFKR 601


>gi|289207679|ref|YP_003459745.1| DNA mismatch repair protein MutL [Thioalkalivibrio sp. K90mix]
 gi|288943310|gb|ADC71009.1| DNA mismatch repair protein MutL [Thioalkalivibrio sp. K90mix]
          Length = 626

 Score =  531 bits (1369), Expect = e-148,   Method: Composition-based stats.
 Identities = 222/627 (35%), Positives = 347/627 (55%), Gaps = 36/627 (5%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I KLSE++INQIAAGE++ERP+  +KEL+EN+LDA S+R+E  +  GG    QI+DNG
Sbjct: 1   MSIEKLSEQLINQIAAGEVVERPASVVKELVENALDAGSTRIEVRLEQGGIRLIQISDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  +E+P+A+ RH TSKI   +D   +HT GFRGEALPSI +VS L++ S       G
Sbjct: 61  CGIHRDELPLALSRHATSKIRSMEDLEALHTLGFRGEALPSIASVSRLSMTSAVEGERNG 120

Query: 119 AQIAISGEKISSVR-PVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
            ++   G  +     P A   GT VEVRDLFF +PAR  F+++E+ E N    VIR  A 
Sbjct: 121 WRLTGDGSDVFREAAPAAHPVGTTVEVRDLFFNVPARRKFVRTERTEFNHCETVIRTQAA 180

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           A P+V+FT          +   +   +  +R+  ++GE F+  A  + E+   + L G+ 
Sbjct: 181 ACPEVAFTLRHNDRVVLDLPAAA---DPAQRVRALLGEAFMGAATPVGEQRAGLKLSGWL 237

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G PT +R   +Q + F+NGR ++D+ + + +R AY + +  GR+P+ VL LE+DP QVDV
Sbjct: 238 GAPTQSRAQPDQQFFFVNGRAIRDRVLAAAVRKAYQDVLYHGRHPMFVLELELDPVQVDV 297

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKK-------------GISTSSVLSKKMISS 344
           N HP K  +RFR   ++ +FI  ++ KA+                   ++    ++ I +
Sbjct: 298 NAHPTKQEVRFRESRMVHDFIFHALHKALADVRPGDGGMPGYLPADTGSAPAPQERAIPA 357

Query: 345 FHQDNA-PKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEAT- 402
           F ++ A      P+Y     +       +    S      +           V E     
Sbjct: 358 FPRERALSGLGAPEYRAEARSPAAGSGDRREYASGTSSDYAAAWAEFRGPAAVAEPAPRS 417

Query: 403 ---------------HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDF 447
                             LG A  Q+ + +I+++   GL++VD HAAHER+ +E++++++
Sbjct: 418 FEAAGGASESDDAEGMPPLGFALGQVAETFILAENASGLIVVDMHAAHERITYERLKREW 477

Query: 448 NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKK 507
            S  ITSQ LL PE +D+   E AL  EH   L  LG + +R GP  +A+R  PA+L  +
Sbjct: 478 GSQGITSQPLLVPETLDVTPAEAALAEEHAGVLGALGFELDRAGPETLALRAAPALLRGR 537

Query: 508 NIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKN 567
           +  QL+RD++ ++     ++  +  +  +L TMAC+GS+R+GR++   EMN+LLR+ME  
Sbjct: 538 DTAQLVRDVLADLAAVGYSHRAEGEMNAVLGTMACHGSVRAGRRLTLPEMNQLLRDMEAT 597

Query: 568 PNSSQCNHGRPTFIKLKLSDIEKLFGR 594
             S QCNHGRPT+++L    +++LF R
Sbjct: 598 ERSGQCNHGRPTWVELDHHALDRLFLR 624


>gi|304321473|ref|YP_003855116.1| DNA mismatch repair protein [Parvularcula bermudensis HTCC2503]
 gi|303300375|gb|ADM09974.1| DNA mismatch repair protein [Parvularcula bermudensis HTCC2503]
          Length = 632

 Score =  531 bits (1369), Expect = e-148,   Method: Composition-based stats.
 Identities = 235/612 (38%), Positives = 363/612 (59%), Gaps = 22/612 (3%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR+L    +N+IAAGE+IERP+ A+KEL+EN++DA +  +   I  GGK+   + D+G 
Sbjct: 23  RIRRLPAVAVNRIAAGEVIERPAAAVKELVENAIDAGARTITVRIDQGGKALIDVEDDGC 82

Query: 62  GMTSEEIPMAVQRHCTSKISDD------FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQN 115
           GM +E++ +A++RH TSK++ D        +I T GFRGEALPSIGAV+ L + SR    
Sbjct: 83  GMGAEDLILALERHATSKLAADETGCVDLLDIATLGFRGEALPSIGAVAELDIASRCHGG 142

Query: 116 NTGAQIAISGEKISSVRPVAMN-PGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRR 174
           + G +I+     I   RP      GT V V+ LFF  PARL FLK++  ET  +++ ++ 
Sbjct: 143 D-GIKISCRAGVIDPPRPHPFVGVGTKVSVKRLFFATPARLKFLKADSAETRAVSETLKA 201

Query: 175 MAIAYPKVSFTFSTIKSNRYKMNFQ-STNGNFPERISQVIGEDFINNAVELNEKSNEITL 233
           +A+A P++ FT       R+    +         R+  ++G++F +NA+ ++       L
Sbjct: 202 LAMAQPEIGFTLIADGRQRFSYPPEGEGPEGALRRLGHIMGKEFEDNALAIDIDREGARL 261

Query: 234 QGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPR 293
            G+ G+PT NRG  ++ Y+F+NGR V+D+ ++  +R AYA+ +   R+P++ L +++  +
Sbjct: 262 HGFAGVPTLNRGQPDRQYLFVNGRPVKDRLMVGAVRGAYADFLARDRHPLLALYIDLPFQ 321

Query: 294 QVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKT 353
           QVDVNVHPAK+ +RFR+   IR  I+  ++  +   G   S+ ++   +S F    AP  
Sbjct: 322 QVDVNVHPAKTEVRFRDAAAIRGMIVSGLRHMLAAAGHRASTTIAASALSRFEGAEAPPP 381

Query: 354 HLPKYATS-----------LTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEAT 402
             P   T+           L   Q   F  E         PS      ED     E E  
Sbjct: 382 QGPNAPTTFVHGAHRERPILPPRQAPPFAAEGTTLFRGEAPSAQTI--EDPSQAHEEEGP 439

Query: 403 HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEI 462
            + LG+  AQ+H+ Y+++QTTDG+VIVDQHAAHERLI+E M+       I  QTLL PE+
Sbjct: 440 SFPLGVPRAQLHETYVLAQTTDGIVIVDQHAAHERLIYEAMKSRQRDRGIERQTLLIPEV 499

Query: 463 IDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIID 522
           +DL + E  L+++  E+L  LG+  E FG  A+ +RE+P +    ++  L+RDI  +++ 
Sbjct: 500 VDLPQEEAELLIDRTEELAALGLVVEAFGGTAVLVREVPCLFGDGDVAGLIRDIAADLVT 559

Query: 523 SSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIK 582
              +  L+ R+ +I   MAC G+I+SGR++ + EMNRLLR+ME  P+S QCNHGRPT+++
Sbjct: 560 LDGSAALETRLGDIAGNMACRGAIKSGRRLTAEEMNRLLRDMEAVPHSGQCNHGRPTYVE 619

Query: 583 LKLSDIEKLFGR 594
           LKL+DIE+LFGR
Sbjct: 620 LKLADIERLFGR 631


>gi|114319732|ref|YP_741415.1| DNA mismatch repair protein MutL [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226126|gb|ABI55925.1| DNA mismatch repair protein MutL [Alkalilimnicola ehrlichii MLHE-1]
          Length = 636

 Score =  531 bits (1369), Expect = e-148,   Method: Composition-based stats.
 Identities = 202/631 (32%), Positives = 338/631 (53%), Gaps = 38/631 (6%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            I++L  +++NQIAAGE++ERP+  +KEL+ENSLDA +  +   +  GGK   ++ D+G 
Sbjct: 4   PIQQLPLQLVNQIAAGEVVERPASVLKELVENSLDAGARSLAVELEQGGKRLIRVRDDGN 63

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  E++ +A++RH TSKI+   +   + + GFRGEALPSIGAVS L L+SRPP      
Sbjct: 64  GIPREQLGLALRRHATSKITSLSELEQVVSLGFRGEALPSIGAVSRLRLISRPPGAEHAW 123

Query: 120 QIAIS-GEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +      + +   P A  PGT VEVRDLFF  P R  FL++++ E +   + +RR+A+ 
Sbjct: 124 AVRTDGDSEPAGPEPAAHPPGTTVEVRDLFFNTPGRRKFLRTDRTEFSHAQEALRRLALG 183

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
              V+F           +           R+ +++GE F+   + L   +  + L G+  
Sbjct: 184 RFDVAFRLQHNGRTVLDLPPAGDRAGAERRLGELLGEGFLGECIHLECAAAGLKLSGWLA 243

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF+R   +  Y ++NGR ++D+     +R AYA+ +   R+P  +L L++DP +VDVN
Sbjct: 244 LPTFSRSQGDLQYFYVNGRMIRDRMAGHALRRAYADVLYRDRFPAYLLYLDLDPDRVDVN 303

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLP-- 356
           VHP K  +RFR+  ++ +F+ + +++A+ +   +T+S +     S    +          
Sbjct: 304 VHPTKHEVRFRDSRLVYDFLFRQVREALARVSPATASGVQPPQGSVASAEGPRSLAAAAG 363

Query: 357 -----------------------------KYATSLTNTQEKLFLQENRLSTNDLLPSDDP 387
                                        + A  L   + K       +++   +  D P
Sbjct: 364 ERWGGAAPAAGAAPTARRSPHQHGLGLPLEEARLLYGERSKAHAAGPAVASPSGVVRDAP 423

Query: 388 TYSEDNDPV----EESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKM 443
                        + +E     LG A AQ+H  YI++Q   GLV+VD HAAHER+++E+M
Sbjct: 424 AGEAVACETGGAGDPTERGGPPLGHALAQVHGVYILAQNDQGLVLVDMHAAHERVVYERM 483

Query: 444 RQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAI 503
           +   + + I SQ LL PE + +   E   +    E   +LG + +R  P+ + +R +PA+
Sbjct: 484 KAQLSGSGIASQALLMPEGLSVTPAEGEEVERAGERFRQLGFQVDRVAPDRVLVRAVPAL 543

Query: 504 LSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLRE 563
           L+      L+RD++ ++   S +  +++ + ++LATMAC+GS+R+ R++   EM+ LLRE
Sbjct: 544 LANAEPVALVRDVLADLRTQSRSRQVEEALNHVLATMACHGSVRANRRLTLPEMDALLRE 603

Query: 564 MEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ME  PNS QCNHGRPT+  L +  +++LF R
Sbjct: 604 MEATPNSGQCNHGRPTWTVLDMDALDRLFMR 634


>gi|194098697|ref|YP_002001759.1| DNA mismatch repair protein [Neisseria gonorrhoeae NCCP11945]
 gi|239999002|ref|ZP_04718926.1| DNA mismatch repair protein [Neisseria gonorrhoeae 35/02]
 gi|240080646|ref|ZP_04725189.1| DNA mismatch repair protein [Neisseria gonorrhoeae FA19]
 gi|240112989|ref|ZP_04727479.1| DNA mismatch repair protein [Neisseria gonorrhoeae MS11]
 gi|254493793|ref|ZP_05106964.1| DNA mismatch repair protein [Neisseria gonorrhoeae 1291]
 gi|268594850|ref|ZP_06129017.1| DNA mismatch repair protein mutL [Neisseria gonorrhoeae 35/02]
 gi|268596770|ref|ZP_06130937.1| DNA mismatch repair protein mutL [Neisseria gonorrhoeae FA19]
 gi|268599068|ref|ZP_06133235.1| DNA mismatch repair protein [Neisseria gonorrhoeae MS11]
 gi|238690209|sp|B4RLX4|MUTL_NEIG2 RecName: Full=DNA mismatch repair protein mutL
 gi|193933987|gb|ACF29811.1| DNA mismatch repair protein [Neisseria gonorrhoeae NCCP11945]
 gi|226512833|gb|EEH62178.1| DNA mismatch repair protein [Neisseria gonorrhoeae 1291]
 gi|268548239|gb|EEZ43657.1| DNA mismatch repair protein mutL [Neisseria gonorrhoeae 35/02]
 gi|268550558|gb|EEZ45577.1| DNA mismatch repair protein mutL [Neisseria gonorrhoeae FA19]
 gi|268583199|gb|EEZ47875.1| DNA mismatch repair protein [Neisseria gonorrhoeae MS11]
 gi|317164295|gb|ADV07836.1| DNA mismatch repair protein [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 658

 Score =  531 bits (1368), Expect = e-148,   Method: Composition-based stats.
 Identities = 213/658 (32%), Positives = 338/658 (51%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ V+  + GGG    ++ DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAVDVELEGGGIRLIRVGDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  ++ + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGDDFQTASLEIDSGNSALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL LE+ P+ VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLELPPKAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRANLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDL-- 381
                   +++     K  +     ++ KT    Y  +    Q  L L+E+R + +    
Sbjct: 359 DSENLFDSASNHPTGNKPDTRNAFGSSGKTAPMPYQAARAPQQHSLSLRESRAAMDTYAE 418

Query: 382 ---------LPSDDPTYSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
                    L       +   +   E+ A                    G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSQFEQARFGNMPSETPAHKTDTPLSDGIPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++       + SQ LL P        ECA + +H
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGNLQSQHLLIPVTFAASHEECAALADH 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            E L   G++    G N +A+R  P +L K ++  L RD++ E+    ++ T+      I
Sbjct: 539 AETLAGFGLELSDMGGNTLAVRAAPVMLGKSDVVSLARDVLGELAQVGSSQTIASHENRI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDTLFLR 656


>gi|85708576|ref|ZP_01039642.1| DNA mismatch repair enzyme [Erythrobacter sp. NAP1]
 gi|85690110|gb|EAQ30113.1| DNA mismatch repair enzyme [Erythrobacter sp. NAP1]
          Length = 610

 Score =  531 bits (1368), Expect = e-148,   Method: Composition-based stats.
 Identities = 227/610 (37%), Positives = 364/610 (59%), Gaps = 17/610 (2%)

Query: 1   MK-IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDN 59
           M  IR+L   ++N+IAAGE++ERP+ A+KEL+EN++DA + R+  V+  GG +  ++TD+
Sbjct: 1   MPQIRRLPTALVNRIAAGEVVERPAAALKELVENAIDAGARRIGVVLTDGGLTRLEVTDD 60

Query: 60  GFGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
           G GMT +E+ +A++RH TSK+ D+    + T GFRGEALPSI +V+ LTL SRP     G
Sbjct: 61  GCGMTPDEMGLALERHATSKLPDEAIEMVATLGFRGEALPSIASVARLTLESRPKGAADG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            +  +   +     P A+  GT V V  +F  +PAR  FL++ + E     D++RR+A+A
Sbjct: 121 WRRVVDHGETVEDAPAALPVGTRVRVEQIFAKVPARRKFLRTPRSEYIACLDIVRRLAMA 180

Query: 179 YPKVSFTFST--IKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEK----SNEIT 232
            P ++FT         R  +  Q+  G    R++Q++  +  +NAVE+  +       + 
Sbjct: 181 RPDIAFTLENGAEGKIRKALATQTDEG-LSNRVAQIVARELKDNAVEIELERDGPHGPMR 239

Query: 233 LQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDP 292
           L G  G+PT+NRG A+  Y+F+NGR V+DK +   +R AY++ +   R+ V+ L L++ P
Sbjct: 240 LSGLAGLPTYNRGVADHQYLFVNGRPVKDKLLTGAVRGAYSDMLARDRHAVLALFLDVPP 299

Query: 293 RQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD--NA 350
             VDVNVHPAK+ +RFR+ T +R FI+  +++A+      ++    +  +  +  +  + 
Sbjct: 300 EDVDVNVHPAKTEVRFRDSTGVRGFIVSGLRQALATGDRRSAQGPDRAAMERWQAEPVHE 359

Query: 351 PKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIAC 410
           P   +     S   +  +  + E R+       +  P    +     E+E   Y LGIA 
Sbjct: 360 PAPAMRSIFESRDWSAPQQRVAEPRVEYTPRPDAALPQGRAEEAAPIENEVAEYPLGIAR 419

Query: 411 AQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKIT-SQTLLTPEIIDLLEGE 469
            Q+   YI++++ D L++VDQHAAHERL+ E++++         SQ LL P+++++ E +
Sbjct: 420 GQVANTYIVAESKDALILVDQHAAHERLVLERLKRAGAGEATQRSQALLVPDVVEMDEAD 479

Query: 470 CALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEII-----DSS 524
           C  + +  E L R G+  ERFGP A+ +R +P+ ++K +  +LLRD+ D+I      + S
Sbjct: 480 CDRLEDAAEGLARFGLTVERFGPAAMLVRSVPSAIAKADTGKLLRDLADDIAKHGKQEDS 539

Query: 525 TTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLK 584
            +  L +R+E +LATMAC+GS+R+GR +   EMN LLREME  P S QCNHGRPT++KL 
Sbjct: 540 GSLLLAERLEYVLATMACHGSVRAGRVLSVAEMNALLREMEATPRSGQCNHGRPTWVKLS 599

Query: 585 LSDIEKLFGR 594
           + D+EKLFGR
Sbjct: 600 MEDVEKLFGR 609


>gi|171321502|ref|ZP_02910443.1| DNA mismatch repair protein MutL [Burkholderia ambifaria MEX-5]
 gi|171093210|gb|EDT38417.1| DNA mismatch repair protein MutL [Burkholderia ambifaria MEX-5]
          Length = 662

 Score =  531 bits (1367), Expect = e-148,   Method: Composition-based stats.
 Identities = 199/645 (30%), Positives = 330/645 (51%), Gaps = 60/645 (9%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L +++I+QIAAGE++ERP+  +KEL+EN++DA ++ +  V+  GG     ITD+G G
Sbjct: 23  IQPLPDQLISQIAAGEVVERPASVVKELLENAMDAGATTLRIVLEEGGVKRISITDDGCG 82

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +   E+P+A+ RH TSKI   ++   + T GFRGEAL SI +V+ +++ SR        +
Sbjct: 83  IPPGELPLALMRHATSKIRSLEELEAVATLGFRGEALASIASVAEMSITSRTADVAHATK 142

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I        ++ P A   GT +EVR+L+F  PAR  FLKSEQ E     ++IRR A+A P
Sbjct: 143 I---DATTGALSPAAGAVGTTIEVRELYFNTPARRKFLKSEQTEFGHCLEMIRRAALARP 199

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V+ +           N         +R+++++G+ F    + L+E++  + + G  G+P
Sbjct: 200 DVAISVLHNGKAVEHWNATEP----AQRVAKILGDGFATAHLPLDEQAGPLAVYGCAGLP 255

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           T +RG A+Q Y F+NGR V+DK +   +R AY + +   RYP  VL L++ P  VDVNVH
Sbjct: 256 TASRGRADQQYFFVNGRFVRDKLLTHAVRAAYEDVLHGDRYPSYVLFLDLPPEAVDVNVH 315

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVL---SKKMISSFHQDNAPKTHLP- 356
           P+K  +RFR+   I  ++  ++Q+A+ +   ++           +S      A   + P 
Sbjct: 316 PSKIEVRFRDSRSIHQYVFHAVQRALARHAGASPETTAGGHAAQLSPAPGGPASFLNTPL 375

Query: 357 -------------KYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSE------------ 391
                           +S +++    ++++ R++   L  +      +            
Sbjct: 376 GLGAATGTGGSGFSSPSSSSSSAGNTWMRQARMTQGTLPVAQPLALYDALFGRKDTGAGT 435

Query: 392 ----------------------DNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIV 429
                                    P+  +      LG A  QIH  Y+++Q   GLVIV
Sbjct: 436 PDGTTIVARDAAEAPNAPLSGFVASPLTATAHDEQPLGFALGQIHGIYVLAQNAHGLVIV 495

Query: 430 DQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAER 489
           D HAAHER+++E+ +       I  Q+LL P  +     E   + E  + L  LG     
Sbjct: 496 DMHAAHERILYEQFKNALADRTIAVQSLLLPISMTATPVEIGTVEEERDTLESLGFDLAV 555

Query: 490 FGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSG 549
             P  +AIR +PA+L   ++  L R ++ ++     +  L +R   +L T+AC+ ++R+ 
Sbjct: 556 LSPTTLAIRAVPALLKDADLQSLARAVLADLHAFGGSRVLTERQHELLGTLACHHAVRAN 615

Query: 550 RKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           R++   EMN LLR+ME    + QCNHGRPT+ +L L+D+++LF R
Sbjct: 616 RRLTLDEMNALLRQMEATERADQCNHGRPTWYQLTLNDLDRLFMR 660


>gi|221200993|ref|ZP_03574033.1| DNA mismatch repair protein MutL [Burkholderia multivorans CGD2M]
 gi|221206555|ref|ZP_03579568.1| DNA mismatch repair protein MutL [Burkholderia multivorans CGD2]
 gi|221214412|ref|ZP_03587383.1| DNA mismatch repair protein MutL [Burkholderia multivorans CGD1]
 gi|221165669|gb|EED98144.1| DNA mismatch repair protein MutL [Burkholderia multivorans CGD1]
 gi|221173864|gb|EEE06298.1| DNA mismatch repair protein MutL [Burkholderia multivorans CGD2]
 gi|221178843|gb|EEE11250.1| DNA mismatch repair protein MutL [Burkholderia multivorans CGD2M]
          Length = 661

 Score =  531 bits (1367), Expect = e-148,   Method: Composition-based stats.
 Identities = 199/646 (30%), Positives = 327/646 (50%), Gaps = 63/646 (9%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ L +++I+QIAAGE++ERP+  +KEL+EN++DA ++ +  V+  GG     ITD+G G
Sbjct: 23  IQPLPDQLISQIAAGEVVERPASVVKELLENAMDAGATTLRIVLEEGGVKRISITDDGCG 82

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +   E+P+A+ RH TSKI   ++   + T GFRGEAL SI +V+ + + SR        +
Sbjct: 83  IPPGELPLALMRHATSKIRSLEELEAVATLGFRGEALASIASVAEMFITSRTADAAHATR 142

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I     +   + P A   GT +EVR+L+F  PAR  FLKSEQ E     ++IRR A+A P
Sbjct: 143 I---DAQTGVLSPAAGAVGTTIEVRELYFNTPARRKFLKSEQTEFGHCVEMIRRAALARP 199

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V+ +           N         +R+++++G+ F    + L+E++  + + G  G+P
Sbjct: 200 DVAISVLHNGKAVEHWNATEP----AQRVAKILGDGFATAHLPLDERAGPLAVYGCAGLP 255

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           T +RG A+Q Y F+NGR V+DK +   +R AY + +   RYP  VL L++ P  VDVNVH
Sbjct: 256 TASRGRADQQYFFVNGRFVRDKLLTHAVRAAYEDVLHGDRYPSYVLFLDLPPEAVDVNVH 315

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           P+K  +RFR+   I  F+  ++Q+A+ +   ++    +     + H + AP+      +T
Sbjct: 316 PSKIEVRFRDSRSIHQFVFHAVQRALARHAGASPETTAGGH--AAHLEPAPRGPASFLST 373

Query: 361 SLTNTQEKL-------------------FLQENRLSTNDLLPSD---------------- 385
            L  +Q +                    +L++ R++   L  +                 
Sbjct: 374 PLGQSQNQPASTAGSGFSSPSSSAPGSTWLRQARMTQGTLPVAQPLALYDALFGRKDTGA 433

Query: 386 -------------DPTYSEDNDPVEESEATHYQLGIACAQ----IHQNYIISQTTDGLVI 428
                        D   +          A               IH  Y+++Q   GLVI
Sbjct: 434 GTPDATTTARDAADDPAAPLPGFAAMPSAASMHDEQPLGFALGQIHGIYVLAQNAHGLVI 493

Query: 429 VDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAE 488
           VD HAAHER+++E+ +       +  Q+LL P  +     E   + E  + L  LG    
Sbjct: 494 VDMHAAHERILYEQFKNALADRAVAVQSLLLPVSMTATPVEIGTVEEERDTLEALGFDLA 553

Query: 489 RFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRS 548
              P ++AIR +PA+L   ++  L R ++ ++     +  L +R   +L T+AC+ ++R+
Sbjct: 554 VLSPTSLAIRAVPALLKDADLQALARAVLADLHAFGGSRVLTERQHELLGTLACHHAVRA 613

Query: 549 GRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            R++   EMN LLR+ME    + QCNHGRPT+ +L L D+++LF R
Sbjct: 614 NRRLTLDEMNALLRQMEATERADQCNHGRPTWYQLTLGDLDRLFMR 659


>gi|325130516|gb|EGC53271.1| DNA mismatch repair protein MutL [Neisseria meningitidis
           OX99.30304]
          Length = 658

 Score =  530 bits (1366), Expect = e-148,   Method: Composition-based stats.
 Identities = 214/658 (32%), Positives = 341/658 (51%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSEATEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSRQVHQLVFHTLNKALADTRADLTESVGNAGEVLHDITGVTPAPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLP 383
                   ++      K  +      + KT    Y ++    Q  L L+E+R + N    
Sbjct: 359 DSENLFNRASDYPTGNKPDTRNAFGASGKTAPMPYQSAYAPQQRSLSLRESRAAMNTYAE 418

Query: 384 SDDPT-----------YSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
               T            +   +   E+ A                    G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSRFEQARFGNMPSETPAPQTDTPLSDGIPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++       + SQ LL P        ECA + +H
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGRLQSQRLLIPVTFAASHEECAALADH 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            + L   G++    G N +A+R +PA+L K +I  L RD++ E+    ++ T+++    I
Sbjct: 539 ADALAGFGLELSDMGGNTLAVRAVPAMLGKSDIVSLARDVLGELAQVGSSQTIEEHENRI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GSIR+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSIRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|222056190|ref|YP_002538552.1| DNA mismatch repair protein MutL [Geobacter sp. FRC-32]
 gi|254766168|sp|B9M3N0|MUTL_GEOSF RecName: Full=DNA mismatch repair protein mutL
 gi|221565479|gb|ACM21451.1| DNA mismatch repair protein MutL [Geobacter sp. FRC-32]
          Length = 598

 Score =  530 bits (1366), Expect = e-148,   Method: Composition-based stats.
 Identities = 201/599 (33%), Positives = 325/599 (54%), Gaps = 10/599 (1%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I+ L E++ N+IAAGE++ERP+  +KEL+EN+LDA  S V   I  GGK   +++D G 
Sbjct: 4   RIKILPEQLTNKIAAGEVVERPASVVKELVENALDAGCSEVMVEIEAGGKRLIRVSDTGC 63

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           GMT E+  +A++RH TSKI+  +D  ++ T GFRGEALPS+ +VS  TL +R   +  G 
Sbjct: 64  GMTREDALLALERHATSKIANDEDLFSLATLGFRGEALPSVASVSRFTLATREKGSLEGT 123

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +I   G +I  V+   M  GT++ VR+LFF  PARL F+KS + E   + D++ R+AI+ 
Sbjct: 124 EIYAEGGRIKEVKACGMAEGTVISVRNLFFNTPARLKFMKSSETEAGHVGDLLTRLAISR 183

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P + F ++      ++    + N +  ER++ ++G     +   L+    ++ + G  G 
Sbjct: 184 PDIRFIYTNDGKTVFR----ALNADLRERVATLLGRTLSQDLYPLDFCDGQLNVTGLVGK 239

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P  +R  A+  Y +INGR ++DK +   +  AY   +  GRYPVVVL + +   +VDVNV
Sbjct: 240 PECSRSAASHVYTYINGRFIRDKVVQHAVLQAYRNFMERGRYPVVVLFISVPAAEVDVNV 299

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAP----KTHL 355
           HP K  +RFR    + + I ++++  +       +  + +K  +S     A     +  L
Sbjct: 300 HPTKHEVRFREQGRVHDAIQEAVESVLRSSPWVKTQPVVQKTQASTSIAAARIAQVRESL 359

Query: 356 PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQ 415
            +Y    T  Q          ++       DP    D  P  E E  ++       Q + 
Sbjct: 360 TQYRPQKTTQQSFKMSTPAVPASFRETSLPDPVPVADAAPAPEVERGYFSGLSVIGQFNA 419

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
            YI+ Q  + LVI+DQHAAHER+ FE+++    +  + SQ LL PE ++    E A+I E
Sbjct: 420 AYILCQDGNSLVIIDQHAAHERVAFERLKTQHAAMGVESQRLLFPETVEFSFKEGAVIRE 479

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
           H  +L R+G   E FG +   +  +P +LS  +  + LRDI++E+     + + QD +E+
Sbjct: 480 HQTELDRVGFSLEEFGGSTWLLNAVPHLLSGNDYVKTLRDILEELQSLGRSRSFQDILED 539

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ILA +AC+  +R    +   E+  L ++M+    SS C HGRP    L L++IE++F R
Sbjct: 540 ILARIACHSVVRGSHCLSQQEIKALFQQMDTTEFSSNCPHGRPVLHTLTLAEIERMFKR 598


>gi|67459779|ref|YP_247403.1| DNA mismatch repair protein [Rickettsia felis URRWXCal2]
 gi|75535831|sp|Q4UJQ1|MUTL_RICFE RecName: Full=DNA mismatch repair protein mutL
 gi|67005312|gb|AAY62238.1| DNA mismatch repair protein MutL [Rickettsia felis URRWXCal2]
          Length = 609

 Score =  530 bits (1364), Expect = e-148,   Method: Composition-based stats.
 Identities = 249/609 (40%), Positives = 375/609 (61%), Gaps = 15/609 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LSE  IN+IAAGE+IERP+  +KEL+EN++DA S++++ ++   GK+   I+D+G
Sbjct: 1   MTIKFLSESTINRIAAGEVIERPASVVKELVENAVDAGSTKIDIILERAGKNLIIISDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +E+ +AV+RH TSK+ + DF NIHTFGFRGEALPSI A+S + + S+    +   
Sbjct: 61  IGMTDKELEIAVERHTTSKLDESDFLNIHTFGFRGEALPSIAAISKMLITSKKQGADKAF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G     V     N GT +E+RDLFF  PARL FL++++ E     DV++++A+A+
Sbjct: 121 QIKLIGGNEKQVTVSVHNEGTKIEIRDLFFATPARLKFLRADKTELAATVDVVKKIALAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P++SF+ +    N  K   Q+ +   N  +RI  VIG+DFI NA  ++ K+ + ++ GYT
Sbjct: 181 PEISFSLTHDDRNLLKFKGQNKDAETNLKQRIIDVIGDDFIKNAAYIDFKTPDFSICGYT 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
            IPT+NR ++   ++FIN R V+DK +   +R AY + +   RYP+  + L+IDP+ VDV
Sbjct: 241 SIPTYNRASSEDQFLFINNRPVKDKLLQVALRVAYQDYLARDRYPLCAIFLQIDPQLVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPK 357
           NVHPAK+ +RF +P  +RN +I++I+ A+  K   TS+ ++   +  F      K     
Sbjct: 301 NVHPAKAEVRFHDPNYVRNLLIEAIKNALTNKSHVTSTTIASDALQLFKNPLVNKQPSVS 360

Query: 358 YATSLTNTQE--KLFLQENRLSTNDLLPS-------DDPTYSEDNDPVEESEATHYQL-- 406
            A S+ +     +  +  +   T +                 E    +E  +  H Q   
Sbjct: 361 KAVSVNSKPADYRPAMSPSFKPTPNTACQKLIDTLPHAKIEQEVERRIEHEQQVHKQYKL 420

Query: 407 GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLL 466
           G A AQ+H  YIISQT D +VI DQHAAHERL +EK++    + ++  Q LL PEI++L 
Sbjct: 421 GAAKAQLHTTYIISQTEDSIVITDQHAAHERLGYEKIKDYLKTEELIKQRLLIPEIVELP 480

Query: 467 -EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSST 525
            E +   + E+ E L++LG+  E+FG  +I + EIP IL   N+ +L++D+ D + D   
Sbjct: 481 NERKADCLYENREKLYKLGLTLEKFGEKSIIVTEIPNILEDVNVQKLIQDLADHLSDFGE 540

Query: 526 TYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKL 585
              L + IE++  T AC+ SIR+GRK+ + EMN LLR+ME  P S QCNHGRPT+I+LKL
Sbjct: 541 NIALTELIEHVTETYACHYSIRAGRKLSADEMNALLRQMENTPFSGQCNHGRPTYIELKL 600

Query: 586 SDIEKLFGR 594
            DIE+LFGR
Sbjct: 601 KDIERLFGR 609


>gi|77918908|ref|YP_356723.1| DNA mismatch repair protein [Pelobacter carbinolicus DSM 2380]
 gi|123729468|sp|Q3A504|MUTL_PELCD RecName: Full=DNA mismatch repair protein mutL
 gi|77544991|gb|ABA88553.1| DNA mismatch repair protein MutL [Pelobacter carbinolicus DSM 2380]
          Length = 628

 Score =  529 bits (1363), Expect = e-148,   Method: Composition-based stats.
 Identities = 199/627 (31%), Positives = 330/627 (52%), Gaps = 37/627 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI  L E + NQIAAGE++ERP+  +KEL+EN+LDA +SR++  +  GGK   ++TDNG 
Sbjct: 4   KIHILPESLCNQIAAGEVVERPASVVKELVENALDAGASRIQVDVENGGKRLIRVTDNGC 63

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           GM+ E+  + ++RH TSK+    D   + T GFRGEALPSI AVS  TL +R  ++  G 
Sbjct: 64  GMSREDAFLCLERHATSKVRAEQDLFRLTTLGFRGEALPSIAAVSRFTLRTRLAEDVEGW 123

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           ++ + G  +       + PGTI+E+R+LFF  PAR  FL+ ++ E   I + + R+A++ 
Sbjct: 124 ELVVEGGTVKRSSAAGVPPGTIIEIRNLFFNTPARRKFLRRDETELGHIGETLTRLALSC 183

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNE-ITLQGYTG 238
           P+V F F       +++N      +  ER ++++G + + + + +  +  E + L G   
Sbjct: 184 PEVCFRFMHNGRMLWEVN---RQKSLVERAAELLGREAVRDMLPVERQGPEGMRLHGLIS 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
            P  NR      + FINGR ++DK +   +   Y   +  GR+PV+VL LEIDP QVDVN
Sbjct: 241 SPRLNRSGLGGMFTFINGRFIRDKVVQHALADGYRNLLAKGRHPVLVLFLEIDPSQVDVN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHP K  +RFR   ++ +FI+++++  + +   S          +   ++NA      + 
Sbjct: 301 VHPTKHEVRFRQQALVHDFIVKALRDHLQQVPTSAMPAPGNSPFTVPARENAASVKPDET 360

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDP----------------------- 395
             +L +T       E    ++   PS        +                         
Sbjct: 361 KPALADTPAAFSAGEGSSRSDVPYPSASQVTETTDSYDAHDSGVEGASTAPPLSEEGLFS 420

Query: 396 --------VEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDF 447
                    +   +  +       Q   +Y++ Q+   L+++DQHAAHER+ FE +R+ +
Sbjct: 421 VTADVRPSEQTENSGFFASLRLIGQYQNSYLVCQSEKDLILIDQHAAHERIGFEHLRKQY 480

Query: 448 NSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKK 507
            +  I  Q LL P +++       ++ E  + L RLG   E FG NA A++E+P +L + 
Sbjct: 481 LAGSIERQLLLFPLVLEFDFRLGRIVEEQRDSLFRLGFALENFGGNAFALKELPRMLKEA 540

Query: 508 NIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKN 567
           +  +L+RD++DE      +  ++  +E IL  MAC+  +R+ +++   EM  LL E++K 
Sbjct: 541 DAERLVRDVVDEFAAIGRSQAVEIELERILLKMACHAMVRAHQRLSFDEMQALLDELDKT 600

Query: 568 PNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           P SS C HGRPTF++  L ++E+LF R
Sbjct: 601 PFSSNCPHGRPTFLRWSLGELERLFKR 627


>gi|329904231|ref|ZP_08273710.1| DNA mismatch repair protein MutL [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327548094|gb|EGF32819.1| DNA mismatch repair protein MutL [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 612

 Score =  529 bits (1363), Expect = e-148,   Method: Composition-based stats.
 Identities = 203/608 (33%), Positives = 330/608 (54%), Gaps = 22/608 (3%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            I  L +++I+QIAAGE++ERPS  +KEL+EN+LDA ++++   +  GG     ITDNG 
Sbjct: 10  SIAALPDQLISQIAAGEVVERPSAVVKELLENALDAGATQITIRLEQGGIKRIAITDNGR 69

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ ++EIP+A+ RH TSKI+   D  N+ T GFRGEAL SI +++ LTL +R        
Sbjct: 70  GIPADEIPLALARHATSKIASLSDLENVATLGFRGEALASIASIAQLTLTTRTATAAHAW 129

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +++ S     +  P +  PGT ++V+DL++  PAR  FLKS+Q E     +V+RR+A++ 
Sbjct: 130 EMSGSQ---PAPVPSSGAPGTTIDVQDLYYNTPARRKFLKSDQTEYGHCAEVVRRIALSR 186

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V+F+ +             T  +   R + ++G DF    + L+E +  + L GY G+
Sbjct: 187 PDVAFSLTHNGKTVDHW----TLADMDRRSAHILGSDFSAARLSLDEAAGPLRLHGYAGL 242

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT +RG A+  Y ++NGR V+DK +   +R+AY + +   RYP  VL L++DP  VDVNV
Sbjct: 243 PTASRGRADAQYFYVNGRFVRDKLLTHAVRSAYQDVLHGDRYPSYVLALDLDPALVDVNV 302

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMIS---SFHQDNAPKTHLP 356
           HP+K  +RFR+   +  F+  ++ +A+++   +   ++     +    +H          
Sbjct: 303 HPSKIEVRFRDSRAVHQFVFHAVTRALSQTSATADGMVPAPQAAGAMPWHSTQQTPAQPY 362

Query: 357 KYATSLTNTQEKLFLQ----------ENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQL 406
               S +   E    Q          E    +N+          + +  V  S    + L
Sbjct: 363 TRQGSFSQQAEPGIAQNSARYGALFGEKSGDSNEAFEQVAVAGWQPSPAVAPSGTAEFPL 422

Query: 407 GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLL 466
           G A AQ+   YI++Q   GLV+VD HAAHER+++E+ +   ++  +  Q LL P      
Sbjct: 423 GFALAQLQGIYILAQNLTGLVLVDMHAAHERILYEQFKTALDTDAVVVQPLLIPVTFHAD 482

Query: 467 EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTT 526
             E     E+   L  LG       P  +A+R IPA+L   +   L RD++ ++ +   +
Sbjct: 483 AVEVGTTAENQATLAALGFDIAALSPTTLAVRAIPALLKNADAQSLARDVLRDVREFGGS 542

Query: 527 YTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLS 586
             L +R   +L T+AC+ ++R+ R +   EMN LLR+ME    + QCNHGRPT++++ LS
Sbjct: 543 RVLMERRNELLGTLACHTAVRANRILTLPEMNALLRQMEATERADQCNHGRPTWVQMALS 602

Query: 587 DIEKLFGR 594
           D+++LF R
Sbjct: 603 DLDRLFQR 610


>gi|260574506|ref|ZP_05842510.1| DNA mismatch repair protein MutL [Rhodobacter sp. SW2]
 gi|259023402|gb|EEW26694.1| DNA mismatch repair protein MutL [Rhodobacter sp. SW2]
          Length = 605

 Score =  529 bits (1363), Expect = e-148,   Method: Composition-based stats.
 Identities = 248/599 (41%), Positives = 384/599 (64%), Gaps = 19/599 (3%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR+L E  IN+IAAGE++ERP+ A+KEL+EN+LDA + R+   +A GGK+  +++D+G G
Sbjct: 18  IRQLDEAAINRIAAGEVVERPASAVKELVENALDAGALRIGIDVADGGKTLIRVSDDGCG 77

Query: 63  MTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQI 121
           MT+ ++P+A+ RH TSKI   D  NIH+FGFRGEALPS+GAV  LTL SR          
Sbjct: 78  MTAADLPLALSRHATSKIDGSDLLNIHSFGFRGEALPSLGAVGRLTLTSRAAGAEAATLS 137

Query: 122 AISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPK 181
              G ++++VRP A+  GT+VE+RDLFF  PARL F+++++ E   I DV++R+A+A P+
Sbjct: 138 V-EGGRMAAVRPAALTRGTVVELRDLFFATPARLKFMRTDRAEMQAIADVVKRLALAQPQ 196

Query: 182 VSFTFS--TIKSNRYKMNFQSTNGNFPE----RISQVIGEDFINNAVELNEKSNEITLQG 235
           V FT    +    R         G+F +    R+++V+G DF  NA+ ++   + + L G
Sbjct: 197 VGFTLRDVSGGEGRLLFRADPEPGDFFDALHGRVARVLGADFAENALRIDVAHDGLRLLG 256

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y  +PT++RG++   ++F+N R V D+ +   +R  Y + +   R+P  VL L+ DP+QV
Sbjct: 257 YAALPTYSRGSSVAQFLFVNSRPVLDRQLFGALRAGYMDVLSRDRHPAAVLNLQCDPQQV 316

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHL 355
           DVNVHPAK+ +RFR P ++R  ++  +++A+   G   S+ ++ + +++F  +  P+ + 
Sbjct: 317 DVNVHPAKAEVRFREPALVRGLVVSGLRQALAAAGHRASTTVAGETLTAFRPE--PRIYQ 374

Query: 356 PKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQ 415
               +  T  Q  L  Q    +            +   +    S+     LG A AQ+H+
Sbjct: 375 MDRPSQPTLAQ-ALHWQAPGFAEA--------PQARFEEQAPASDEPPRPLGAAKAQLHE 425

Query: 416 NYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIME 475
           NYII+QT  G+VIVDQHAAHERL++++++   +S+ I +Q LL PEI+ L   + + +++
Sbjct: 426 NYIIAQTASGMVIVDQHAAHERLVYQRLKAQRDSSGIAAQALLIPEIVSLSPADASRLLD 485

Query: 476 HDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIEN 535
              DL  LG+  E FG NA+A+RE PAIL + +   LLRDI+D++ D   +  +Q R++ 
Sbjct: 486 AAADLAALGLVIEPFGGNAVAVRETPAILGRVDAQALLRDILDDLADLGDSTRVQARMDA 545

Query: 536 ILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +L+ MAC+GS+RSGR+M++ EMN LLREME  P S QCNHGRPT+++LKL+DIE+LFGR
Sbjct: 546 VLSRMACHGSVRSGRQMRAEEMNALLREMEATPLSGQCNHGRPTYVELKLADIERLFGR 604


>gi|158424017|ref|YP_001525309.1| DNA mismatch repair protein [Azorhizobium caulinodans ORS 571]
 gi|172047960|sp|A8I6D2|MUTL_AZOC5 RecName: Full=DNA mismatch repair protein mutL
 gi|158330906|dbj|BAF88391.1| DNA mismatch repair protein [Azorhizobium caulinodans ORS 571]
          Length = 625

 Score =  529 bits (1362), Expect = e-148,   Method: Composition-based stats.
 Identities = 238/624 (38%), Positives = 381/624 (61%), Gaps = 30/624 (4%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L   +I++IAAGE++ERP+ A+KEL+EN++DA ++ +E ++ GGG+   +I+DNG
Sbjct: 1   MTIRRLPPVLIDRIAAGEVVERPAAAVKELVENAIDAGATEIEVLVVGGGREMIRISDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM+++E+ +AV+RH TSK+ ++D   I T GFRGEALPSIGAV+ L++ SRP       
Sbjct: 61  SGMSADELSLAVERHATSKLPTEDLLAISTLGFRGEALPSIGAVARLSIASRPKSAPHAF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +I + G  ++  RP A+N GT VEVRDLFF  PARL FLKS++ E     DV+RR+A+A 
Sbjct: 121 EIRVEGGVVTPPRPAALNGGTRVEVRDLFFATPARLKFLKSDRAEAAAAADVVRRLALAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTN-GNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           P V+FT  T          +S +      R++ V+G +   N + +  +   + L G  G
Sbjct: 181 PDVAFTLMTDDRQPLTWVARSMDEAGRAARVADVLGAEAGRNLIPVVGERGGVRLVGLAG 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PT+++ N+   ++F+NGR V+DK ++  +R AY++ +P  RYPV+ L L +DPR+VDVN
Sbjct: 241 LPTYSKANSLSQFLFVNGRPVRDKLLMGALRAAYSDLLPSDRYPVLALFLSLDPREVDVN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMI----SSFHQDNAPKTH 354
           VHPAK+ +RFR+   +R  +++++  A+  +  ST+  ++ +++    +   +   P   
Sbjct: 301 VHPAKTEVRFRDGGNVRALLVRTLTDALAARVPSTAGTIADRLVELARTPELEPARPAAA 360

Query: 355 LPKYATSLTNT--------QEKLFLQENRLSTNDLLPSDDPTYSE--------------- 391
           +P++               +       N    +  L ++  +++E               
Sbjct: 361 IPEFRPYRAEPMPAGGYDWRASPARPLNVAEPDGALEAEMESFAEAVQASFDVGMPAADA 420

Query: 392 -DNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST 450
             +  V E+      LG A AQ+H+ YI++QT +G+V+VDQHAAHERL++EK++      
Sbjct: 421 RADAAVPETGDLDRPLGAARAQLHETYIVAQTREGMVLVDQHAAHERLVYEKLKAALERD 480

Query: 451 KITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIP 510
            +  Q LL P ++DL   E   + E   DL  LG+  E FG  A+ +RE+PA+L+K ++ 
Sbjct: 481 GVARQGLLVPAVVDLDPAEADRLAERAGDLAALGLVIEPFGIGAVLVREVPALLAKADVT 540

Query: 511 QLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNS 570
           +L+RD+ +   +      L+ R+ ++ ATMAC+GS+R+GR+++  EMN LLREME+ PN+
Sbjct: 541 KLVRDVAEHSAEWDDALPLERRLLHVAATMACHGSVRAGRRLRVEEMNALLREMEETPNA 600

Query: 571 SQCNHGRPTFIKLKLSDIEKLFGR 594
            +CNHGRPTFI L L D+EKLF R
Sbjct: 601 GECNHGRPTFITLSLKDVEKLFAR 624


>gi|319898390|ref|YP_004158483.1| DNA mismatch repair protein MutL [Bartonella clarridgeiae 73]
 gi|319402354|emb|CBI75893.1| DNA mismatch repair protein MutL [Bartonella clarridgeiae 73]
          Length = 612

 Score =  529 bits (1362), Expect = e-148,   Method: Composition-based stats.
 Identities = 266/611 (43%), Positives = 390/611 (63%), Gaps = 17/611 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR LSE IINQIAAGE+IERP+  +KELIEN++DA ++R+E VIA GGK+  +++DNG
Sbjct: 1   MIIRHLSETIINQIAAGEVIERPTNVVKELIENAIDAGANRIEIVIANGGKNLIKVSDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
            G+  +++ +A+ RHCTSKI+DD  NI   GFRGEALPSIG+VS L L SR   +++ A+
Sbjct: 61  CGIPEDQLTLAISRHCTSKITDDVHNICFLGFRGEALPSIGSVSKLKLTSRTQNSDSAAE 120

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ++  KI   +P A NPGTIVEVRDLFF  PARL F+KS++ ET+ I D I+R+AIA+P
Sbjct: 121 IIVTAGKIEGPKPSAANPGTIVEVRDLFFVTPARLKFMKSDRAETSSIIDTIKRIAIAFP 180

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGN-FPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
            + F+ + I     +      N     +RI+Q++G++F +N++ L+ K   + L G+ G+
Sbjct: 181 HIRFSLAGIDRASMEFPAMEQNTQGQLQRITQIMGKEFASNSLILDAKRESVHLTGFAGL 240

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P+FNR N+   + ++NGR V+DK +   IR AYA+ I   R+ + +L + + P  VDVNV
Sbjct: 241 PSFNRSNSLHQFAYVNGRPVRDKLLWGAIRGAYADVIARDRHAIAILFINLPPTDVDVNV 300

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQD------NAPKT 353
           HPAK  +RFR+P++IR  II +I++A+++ G+  +S  S+ M+++F             +
Sbjct: 301 HPAKMDVRFRDPSLIRGLIIGAIREALHQTGVRPTSTGSEAMLAAFRTQSLETVKTHQTS 360

Query: 354 HLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDND----------PVEESEATH 403
                   L      +F +   ++++  L  D     E              V  SE  H
Sbjct: 361 SYGARPCHLEPELTSIFHKPLNINSSIDLQEDTIPIMECLSRPSGDTRATINVSTSEELH 420

Query: 404 YQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEII 463
           Y LG A AQIH+NYI+SQT + L+IVDQHAAHERL++E ++    S  + SQ LL PEI+
Sbjct: 421 YPLGAARAQIHKNYIVSQTQNSLIIVDQHAAHERLVYEALKNALYSKPLPSQLLLIPEIV 480

Query: 464 DLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDS 523
           +L E +   ++ H + L + G+  E FG  AIA+ E P++L + NI  L++D+ DE  + 
Sbjct: 481 ELSEEDATCLLSHKDALKKFGLGIESFGIGAIAVHETPSMLGEINIQALIKDLADEAAEY 540

Query: 524 STTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKL 583
            T   L+  ++ + ATMAC+ SI SGR +   EMN LLR++E  PNS  CNHGRPT+I+L
Sbjct: 541 DTIDNLKGMLDYVAATMACHSSICSGRLLHPEEMNALLRQIEATPNSGTCNHGRPTYIEL 600

Query: 584 KLSDIEKLFGR 594
           KL+DIE+LFGR
Sbjct: 601 KLADIERLFGR 611


>gi|298290347|ref|YP_003692286.1| DNA mismatch repair protein MutL [Starkeya novella DSM 506]
 gi|296926858|gb|ADH87667.1| DNA mismatch repair protein MutL [Starkeya novella DSM 506]
          Length = 611

 Score =  528 bits (1361), Expect = e-148,   Method: Composition-based stats.
 Identities = 236/610 (38%), Positives = 369/610 (60%), Gaps = 16/610 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M +R L   ++++IAAGE++ERP+ A+KE++EN+LDA ++R+E VI GGG+   ++TD+G
Sbjct: 1   MPLRLLPSTLVDRIAAGEVVERPAAALKEIVENALDAGATRIEVVIDGGGRRLMRVTDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKI-SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM+++E+ +AV+RH TSK+ ++D  +I T GFRGEALPSIGAV+ L++ SRP  ++T  
Sbjct: 61  CGMSADELALAVERHATSKLDTEDLLSIATLGFRGEALPSIGAVARLSITSRPRGSDTAH 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +I + G   S+V+P A+  GT VEVRDLFF  PARL FLKSE+ ET    D ++R+A+A 
Sbjct: 121 EIRVEGGAKSAVKPAALGFGTRVEVRDLFFATPARLKFLKSERAETAAAVDAVKRLALAR 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGN-FPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           P V F   T          +S +      RI+ V+G +   NA++++       L G  G
Sbjct: 181 PDVGFILVTDDRPPVTWPARSADAAGRRARIADVLGHEVGANALDIDGLREGARLSGLAG 240

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PT+ + N+   Y+F+NGR V+DK ++  IR AYA+ +P  R+PV  L L++DP +VDVN
Sbjct: 241 LPTYAKANSLSQYLFVNGRPVRDKVLIGAIRAAYADLLPSDRHPVTALFLDLDPHEVDVN 300

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHPAK+ +RFR+   +R  I++++  A+      T+S  ++K+      +       P  
Sbjct: 301 VHPAKTEVRFRDAGNVRALIVRTLTDALALGVPRTASTAAEKLAQFARPEFRQGAGNPPR 360

Query: 359 ATS--LTNTQEKLFLQENRLSTNDLLPSDD------------PTYSEDNDPVEESEATHY 404
             +   T +     +     S                        +  N      +    
Sbjct: 361 PGNYDWTRSWAAPDVAPREASPAGFREEAAGFDFGLGLALAPSADARANAAPPAPDLMER 420

Query: 405 QLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIID 464
            LG A AQ+H+ YII+QT DG+V++DQHAAHER+++EK++       +  Q LL P +++
Sbjct: 421 PLGAARAQLHETYIIAQTKDGVVVIDQHAAHERIVYEKLKAAMERDGLARQMLLVPLVVE 480

Query: 465 LLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSS 524
           L   + A + E    L +LG+  E FGP A+ +RE+P++L   ++  L+ ++ +   +  
Sbjct: 481 LDPSDAARLAERAAALEKLGLVLEPFGPGAVLVREVPSLLGDADVCALVTELAEHAAEWD 540

Query: 525 TTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLK 584
               L+ R+ +I ATMAC+GS+R+GR+++  EMN LLREME+ PN++QCNHGRPTF+ L 
Sbjct: 541 DALPLERRLLHIAATMACHGSVRAGRRLRVEEMNALLREMEETPNAAQCNHGRPTFVTLA 600

Query: 585 LSDIEKLFGR 594
           L+DIE+LF R
Sbjct: 601 LADIERLFAR 610


>gi|157965005|ref|YP_001499829.1| DNA mismatch repair protein [Rickettsia massiliae MTU5]
 gi|157844781|gb|ABV85282.1| DNA mismatch repair protein MutL [Rickettsia massiliae MTU5]
          Length = 615

 Score =  528 bits (1360), Expect = e-147,   Method: Composition-based stats.
 Identities = 248/611 (40%), Positives = 369/611 (60%), Gaps = 17/611 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LSE  INQIAAGE+IERP+  +KEL+EN++DA S++++ ++   GK+   I+D+G
Sbjct: 5   MTIKFLSESTINQIAAGEVIERPASVVKELVENAVDASSTKIDIILERAGKNLIIISDDG 64

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +E+ +AV+RH TSK  + DF NIHTFGFRGEALPSI A+S + + S+    +   
Sbjct: 65  IGMTDKELEIAVERHTTSKFDESDFLNIHTFGFRGEALPSIAAISKMLITSKKRDADKAF 124

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G     V     N GT +E+RDLFF  PARL FL++++ E     DV++++A+A+
Sbjct: 125 QIKLIGGNEKQVTISVHNEGTKIEIRDLFFATPARLKFLRADKTELAATVDVVKKIALAH 184

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           P+ SF+ +    N  K+  Q+ +   N  +RI  VIG+DFI NA  ++ K+   ++ GYT
Sbjct: 185 PETSFSLTHDGKNLLKLKGQNKDAKTNLKQRIIDVIGDDFIKNAAYIDFKTPNFSICGYT 244

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
             PT+NR ++   ++FIN R V+DK +   +R AY + +   RYP+  + L+IDP+ VDV
Sbjct: 245 SSPTYNRASSEDQFLFINNRPVKDKLLQVALRVAYQDYLARDRYPLCAIFLQIDPQLVDV 304

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPK 357
           NVHPAK+ +RF +P  +RN +I++I+ A+  K   TSS           ++       P 
Sbjct: 305 NVHPAKAEVRFHDPNYVRNLLIEAIKNALTNKSHVTSSTTIASDALELFKNPLVNKQSPV 364

Query: 358 YATSLTNTQEKLFLQENRLSTNDLLPSDDPT-----------YSEDNDPVEESEATHYQL 406
                 N++   +      + N +  +                 E  + +E  + T  Q 
Sbjct: 365 SKVIKVNSKSADYRPTTHSTLNTVPQNHVCQKLIDTLSHAKIEQEVENRIEHEQQTRKQY 424

Query: 407 --GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIID 464
             G A AQ H  YIISQT D +VI DQHAAHERL +EK++    + ++  Q LL PEI++
Sbjct: 425 KLGAAKAQFHTTYIISQTEDSIVITDQHAAHERLGYEKIKDYLKTEELIKQRLLIPEIVE 484

Query: 465 LL-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDS 523
           L  E +   + +H E L++LG+  E+FG  +I + EIP IL   N+ +L++D+ D + D 
Sbjct: 485 LPNEKKADCLYDHREKLYKLGLTLEKFGEKSIIVTEIPNILGDVNVQKLIQDLADHLSDF 544

Query: 524 STTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKL 583
                L + IE++  T AC+ SIR+GRK+ + EMN LLR+ME  P S QCNHGRPT+I+L
Sbjct: 545 GKNIALTELIEHVTKTYACHYSIRAGRKLSADEMNALLRQMENTPLSGQCNHGRPTYIEL 604

Query: 584 KLSDIEKLFGR 594
           KL DIE+LFGR
Sbjct: 605 KLKDIERLFGR 615


>gi|88810490|ref|ZP_01125747.1| DNA mismatch repair protein [Nitrococcus mobilis Nb-231]
 gi|88792120|gb|EAR23230.1| DNA mismatch repair protein [Nitrococcus mobilis Nb-231]
          Length = 632

 Score =  528 bits (1360), Expect = e-147,   Method: Composition-based stats.
 Identities = 209/617 (33%), Positives = 350/617 (56%), Gaps = 24/617 (3%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           ++++L  +++NQIAAGE+IERP+  +KEL+EN+LDA++ R+E V+ GGGK   ++ D+G 
Sbjct: 14  RVQRLPPQLVNQIAAGEVIERPAAVVKELVENALDADAGRIEIVVEGGGKRLIRVRDDGV 73

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           GM  E++  AV RH TSKI D  D   I + GFRGEALPSI +V+ LTL +R    + G 
Sbjct: 74  GMGREDLRSAVGRHATSKIRDLIDLERIASLGFRGEALPSIASVARLTLTTRSRAEDHGW 133

Query: 120 QIAISGEKI-SSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           ++ ++G ++   V P    PGT V VRDLF  IPAR  FL+++Q E   I  +++R+A++
Sbjct: 134 RLELNGGELLDEVAPAPHPPGTSVVVRDLFHNIPARRKFLRTDQTELRHIQGLVKRIALS 193

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
            P V F  +      Y++    T+     R+++++G +F+  ++ L+ ++  + L G+ G
Sbjct: 194 RPDVGFELNCHGRCNYRLAPTGTSVEQEARLAELLGREFVGQSLVLDAEAAGLRLHGWIG 253

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +P+  R   +  Y+++NGR ++D+     IR AYA+ +   ++PV VL L +DP +VDVN
Sbjct: 254 LPSAARAQTDLQYLYLNGRMIRDRLAGHAIRRAYADLLYKEKHPVYVLYLGMDPAEVDVN 313

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMIS----SFHQDNAPKTH 354
           VHP+K  +RFR P ++ +F+   + +A+     +      +           Q+  P  H
Sbjct: 314 VHPSKYEVRFREPRLVYDFLFHQLHRALAHPNGAAEGRRYRAAPKRTCVDSPQEQQPTCH 373

Query: 355 LPKYATSLTNTQEKLFL---QENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQL----- 406
            P  ++      E   L        S  + + + + T+  + D +  S A          
Sbjct: 374 SPWQSSIAFPVAEATQLYAAAGEARSAGEPIGNGESTWGSEGDSLALSRALPQHPVPAAG 433

Query: 407 ---------GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTL 457
                    G A AQ+H  Y++S+   GL++VD HAAHER+++E+++ + +   +  Q L
Sbjct: 434 RGEEATPPLGYAVAQLHGVYVLSEDAAGLILVDMHAAHERIVYERLKDELDREGLAGQAL 493

Query: 458 LTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDII 517
           L P  + +   E     +      RL  + +R  P+ + +R IPA+L + +I  LLRD++
Sbjct: 494 LVPLRVGVTPAEADAAEDCAALFRRLEFEVDRAAPDVLVVRRIPALLGQIDITALLRDVL 553

Query: 518 DEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGR 577
             ++       L+  I  +LATMAC+GS+R+ R++   EMN LLR+ME+  N  QCNHGR
Sbjct: 554 SGLLIQGVGGQLEAVINQVLATMACHGSVRAQRRLTITEMNALLRDMERTRNIGQCNHGR 613

Query: 578 PTFIKLKLSDIEKLFGR 594
           PT+ +L L+++++LF R
Sbjct: 614 PTWTRLTLAELDRLFLR 630


>gi|20807805|ref|NP_622976.1| DNA mismatch repair ATPase [Thermoanaerobacter tengcongensis MB4]
 gi|25090753|sp|Q8RA70|MUTL_THETN RecName: Full=DNA mismatch repair protein mutL
 gi|20516363|gb|AAM24580.1| DNA mismatch repair enzyme (predicted ATPase) [Thermoanaerobacter
           tengcongensis MB4]
          Length = 590

 Score =  528 bits (1359), Expect = e-147,   Method: Composition-based stats.
 Identities = 181/596 (30%), Positives = 315/596 (52%), Gaps = 13/596 (2%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI  L EK +N+IAAGE++ERP+  +KEL+ENS+DA S  +   I  GG  + ++TD+G 
Sbjct: 3   KIHLLDEKTVNKIAAGEVVERPASIVKELVENSIDAGSKNITVEILEGGIPYIKVTDDGC 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           GM   +  +A +RH TSKI   +D  NI T GFRGEAL SI AVS + L ++      G 
Sbjct: 63  GMNEIDAVLAFERHATSKIRSDEDLFNITTLGFRGEALASIAAVSKVVLQTKEENETFGT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           ++ + G KI          GT VEV+D+FF  PAR  FLK    E   +T+V+ R+ ++ 
Sbjct: 123 RLVVEGGKILEKTRCGCQKGTSVEVKDVFFNTPARRKFLKRPSTEAMYVTEVVTRLCLSN 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P +SF +   K  ++     S NG+  + I ++ G++  +  +    ++ ++ ++ +   
Sbjct: 183 PGISFKYVKDKKVQF---ITSGNGSIEDVILRLFGKEVHSALIFSEFEAEDLKVKAFATK 239

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
              N  N N  + ++NGR V++K + + +  A+   +P  RYP V L LEI+PR +DVN+
Sbjct: 240 NFLNYSNRNMQFFYVNGRYVKNKTLSAAVDEAFKTYVPSDRYPGVFLYLEINPRFIDVNI 299

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ-DNAPKTHLPKY 358
           HP+K  ++F +   I   + ++I++A+ +  +     L K + +   Q     K  LP +
Sbjct: 300 HPSKLEVKFSDDRRIFESVYRTIREALRESNLIPEVKLEKDLKNEEGQIGEQVKLSLPLF 359

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYI 418
                     +F++E   +   +  +     S D+    E              +   Y+
Sbjct: 360 EVKEKTDDGAIFVREEVKTEEKIDKAPKHESSSDS----ERNVKRLSDIRIVGTLFSTYV 415

Query: 419 ISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDE 478
           I +  D   I+DQHAAHER+++EK+   +   ++ S+ +  P +++L  G+  ++ +  E
Sbjct: 416 IVEKGDVFYIIDQHAAHERILYEKLVSQYE--RVQSRQVTFPIVVELQPGDMEIVGQERE 473

Query: 479 DLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILA 538
            L++LG   E FG N++ +RE+P IL +    +L  +I++ + D   +  +  + E I A
Sbjct: 474 LLYKLGYVFEEFGNNSVVLREVPVILGQPEAKKLFVEIVERLRDKDFSSKVSFKEEEI-A 532

Query: 539 TMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           TMAC  ++++   +   E+ +L  +++   N   C HGRP  I +  + +EK+F R
Sbjct: 533 TMACKAAVKAMDTLSENEIYKLFEDLKIAENPYTCPHGRPVIISMTKTQLEKMFKR 588


>gi|254479236|ref|ZP_05092581.1| DNA mismatch repair protein MutL [Carboxydibrachium pacificum DSM
           12653]
 gi|214034837|gb|EEB75566.1| DNA mismatch repair protein MutL [Carboxydibrachium pacificum DSM
           12653]
          Length = 590

 Score =  528 bits (1359), Expect = e-147,   Method: Composition-based stats.
 Identities = 181/596 (30%), Positives = 315/596 (52%), Gaps = 13/596 (2%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI  L EK +N+IAAGE++ERP+  +KEL+ENS+DA S  +   I  GG  + ++TD+G 
Sbjct: 3   KIHLLDEKTVNKIAAGEVVERPASIVKELVENSIDAGSKNITVEILEGGIPYIKVTDDGC 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           GM   +  +A +RH TSKI   +D  NI T GFRGEAL SI AVS + L ++      G 
Sbjct: 63  GMNEIDAVLAFERHATSKIKSDEDLFNITTLGFRGEALASIAAVSKVVLQTKEENETFGT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           ++ + G KI          GT VEV+D+FF  PAR  FLK    E   +T+V+ R+ ++ 
Sbjct: 123 RLVVEGGKILEKTRCGCQKGTSVEVKDVFFNTPARRKFLKRPSTEAMYVTEVVTRLCLSN 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P +SF +   K  ++     S NG+  + I ++ G++  +  +    ++ ++ ++ +   
Sbjct: 183 PGISFKYVKDKKVQF---ITSGNGSIEDVILRLFGKEIHSALIFSEFEAEDLKVKAFATK 239

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
              N  N N  + ++NGR V++K + + +  A+   +P  RYP V L LEI+PR +DVN+
Sbjct: 240 NFLNYSNRNMQFFYVNGRYVKNKTLSAAVDEAFKTYVPSDRYPGVFLYLEINPRFIDVNI 299

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ-DNAPKTHLPKY 358
           HP+K  ++F +   I   + ++I++A+ +  +     L K + +   Q     K  LP +
Sbjct: 300 HPSKLEVKFSDDRRIFESVYRTIREALRESNLIPEVKLEKDLKNEEGQIGEQVKLSLPLF 359

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYI 418
                     +F++E   +   +  +     S D+    E              +   Y+
Sbjct: 360 EVKEKTDDGAIFVREEVKTEEKIDKAPKHESSSDS----ERNVKRLSDIRIVGTLFSTYV 415

Query: 419 ISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDE 478
           I +  D   I+DQHAAHER+++EK+   +   ++ S+ +  P +++L  G+  ++ +  E
Sbjct: 416 IVEKGDVFYIIDQHAAHERILYEKLVSQYE--RVQSRQVTFPIVVELQPGDMEIVGQERE 473

Query: 479 DLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILA 538
            L++LG   E FG N++ +RE+P IL +    +L  +I++ + D   +  +  + E I A
Sbjct: 474 LLYKLGYVFEEFGNNSVVLREVPVILGQPEAKKLFVEIVERLRDKDFSSKVSFKEEEI-A 532

Query: 539 TMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           TMAC  ++++   +   E+ +L  +++   N   C HGRP  I +  + +EK+F R
Sbjct: 533 TMACKAAVKAMDTLSENEIYKLFEDLKIAENPYTCPHGRPVIISMTKTQLEKMFKR 588


>gi|159899518|ref|YP_001545765.1| DNA mismatch repair protein MutL [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159892557|gb|ABX05637.1| DNA mismatch repair protein MutL [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 631

 Score =  528 bits (1359), Expect = e-147,   Method: Composition-based stats.
 Identities = 182/633 (28%), Positives = 319/633 (50%), Gaps = 43/633 (6%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR L   +  QIAAGE++ERP+  +KELIENS+DA ++ +      GGK   +I DNG
Sbjct: 1   MPIRVLDPTLAAQIAAGEVVERPASVVKELIENSVDAGATEIRVEAREGGKRELRIQDNG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+ S+E+  A  RH TSK+++  D  +I T GFRGEALPSI +V+ +T ++R   +  G
Sbjct: 61  CGIASDEVETAFLRHATSKVTEIEDLFSIRTLGFRGEALPSIASVAQVTCLTRTAADEVG 120

Query: 119 AQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
            ++ I+G +I +  P   + GT   +R+LF+  PARL F++S+  E + I+ ++ + A+A
Sbjct: 121 TELRIAGGEIQAKTPRGCSVGTTFTIRNLFYNTPARLKFMRSDATEMSQISTIVTQYALA 180

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNE----KSNEITLQ 234
           YP + +T         +      NG   + + ++ G D     + ++     +   + + 
Sbjct: 181 YPNIRWTLLLDGKLALQ---TPGNGRLLDALIELYGIDVGREMISVDRTSEAEDETVRVH 237

Query: 235 GYTGIPTFNRGNANQFYVFINGRTVQDK-FILSTIRTAYAETIPLGRYPVVVLLLEIDPR 293
           G+   P+  R   +  ++F+N R ++ +  ++  I  AY   +  GR+P+V L +E++P 
Sbjct: 238 GFVSQPSTFRAARSYMHLFVNQRWIKPQGNLVYMIEEAYHTLLMKGRHPIVALNIELEPE 297

Query: 294 QVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQ------ 347
            VDVNVHP KS ++FRN + +   + +++++A+  +    +        S   +      
Sbjct: 298 AVDVNVHPTKSEVKFRNQSHVYGALTKAVREALAAQSTIRAWTGFGANESVNRRVELRSP 357

Query: 348 --------------DNAPKTHLPKYAT------------SLTNTQEKLFLQENRLSTNDL 381
                         D+AP    P+                    Q +        +++ L
Sbjct: 358 NGERRGSSNDAPLFDDAPAAPRPQVNNYPDDDFDSTVNLPPIAKQARFETPTTSQTSSFL 417

Query: 382 LPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFE 441
            P            +         +     Q+++ YI+++++DG+ +VDQHAAHER+++E
Sbjct: 418 PPQQQAFDPAYAPSMPAPGEAKLPMLRVVGQVNETYIVAESSDGMYLVDQHAAHERVVYE 477

Query: 442 KMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIP 501
           ++  +     I  QTL+  + I+L      L+  H  DL + G +AE FG   + +R +P
Sbjct: 478 RLMAEHQDVPIERQTLMLAQPIELPPAVTRLLSAHLADLEQWGFEAEEFGEGTLMLRAVP 537

Query: 502 AILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLL 561
           + L    I   L +I D +       +  DR E +L T+AC+ SIR+G+ +   EM +LL
Sbjct: 538 SGLHVGQIATALMEIADHLSYEGGATS-DDRREKMLTTIACHSSIRAGKTLTHEEMRQLL 596

Query: 562 REMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           +++E+      C HGRPT +++    IE+ FGR
Sbjct: 597 QQLERCEMPRTCPHGRPTMLQITQGQIERQFGR 629


>gi|157826372|ref|YP_001494092.1| DNA mismatch repair protein [Rickettsia akari str. Hartford]
 gi|166232102|sp|A8GQA9|MUTL_RICAH RecName: Full=DNA mismatch repair protein mutL
 gi|157800330|gb|ABV75584.1| DNA mismatch repair protein [Rickettsia akari str. Hartford]
          Length = 609

 Score =  527 bits (1358), Expect = e-147,   Method: Composition-based stats.
 Identities = 251/609 (41%), Positives = 373/609 (61%), Gaps = 15/609 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LSE  IN+IAAGE+IERP+  +KEL+EN++DA S++++ ++   GK+   I+D+G
Sbjct: 1   MTIKFLSENTINRIAAGEVIERPASVVKELVENAVDAGSTKIDIILERAGKNLIIISDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +E+ +AV+RH TSK+ + DF NIHTFGFRGEALPSI A+S + + S+    +   
Sbjct: 61  IGMTDKELEIAVERHTTSKLDESDFLNIHTFGFRGEALPSIAAISKMLITSKKQGYDKAF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G     V     N GT +E+RDLFF  PARL FL+S++ E     DV++++A+A+
Sbjct: 121 QIKLIGGNEKQVTISVHNEGTKIEIRDLFFATPARLKFLRSDKTELVATVDVVKKIALAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTN--GNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           PK+SF+ +    N  K    + +   N  +RI  VIG+DFI NA  ++ K+ + ++ GYT
Sbjct: 181 PKISFSLTHDDRNLLKFKGHNKDVETNLKQRIIDVIGDDFIKNAAYIDFKTPDFSICGYT 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
            IPT+NR ++   ++FIN R V+DK +   +R AY + +   RYP+  + L+IDP+ VDV
Sbjct: 241 SIPTYNRASSEDQFLFINNRPVKDKLLQVALRVAYQDYLARDRYPLCAIFLQIDPQLVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPK 357
           NVHPAK+ +RF +P  +RN +I++I+ A+      TS+ ++   +  F      K     
Sbjct: 301 NVHPAKAEVRFHDPNYVRNLLIEAIKNALTNTSHVTSTTIASDALQLFKNHLVNKQPSVS 360

Query: 358 YATSLTN--TQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESE---------ATHYQL 406
            A S+ +  T  +  +  +  ST +                +E E            Y+L
Sbjct: 361 KAVSVNSKPTDYRPAMSPSFKSTPNTDCQKLIDTLPHAKIEQEVERRIEREQQAHKQYKL 420

Query: 407 GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLL 466
           G A AQ+H  YIISQT D +VI DQHAAHERL +EK++    + ++  Q LL PEI++L 
Sbjct: 421 GAAKAQLHTTYIISQTEDSIVITDQHAAHERLGYEKIKDYLKTEELIRQRLLIPEIVELP 480

Query: 467 -EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSST 525
            E     + E+ E L++LG+  E+FG  +I + EIP IL   N+ +L+ D+ D + D   
Sbjct: 481 NERNADSLYENREKLYKLGLTLEKFGEKSIIVTEIPNILGDVNVQKLIHDLADHLSDFGE 540

Query: 526 TYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKL 585
              L + IE++  T AC+ SIR+GRK+ + EMN LLR+ME  P S QCNHGRPT+I+LKL
Sbjct: 541 NIALTELIEHVTETYACHYSIRAGRKLSADEMNALLRQMENTPFSGQCNHGRPTYIELKL 600

Query: 586 SDIEKLFGR 594
            DIE+LFGR
Sbjct: 601 KDIERLFGR 609


>gi|90416479|ref|ZP_01224410.1| DNA mismatch repair protein [marine gamma proteobacterium HTCC2207]
 gi|90331678|gb|EAS46906.1| DNA mismatch repair protein [marine gamma proteobacterium HTCC2207]
          Length = 625

 Score =  527 bits (1358), Expect = e-147,   Method: Composition-based stats.
 Identities = 213/623 (34%), Positives = 331/623 (53%), Gaps = 34/623 (5%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           I+ LS ++ NQIAAGE++ERP+  +KEL+ENSLDA +  +E  I  GG    +I D+G G
Sbjct: 4   IKILSPQLANQIAAGEVVERPASVLKELVENSLDAGAQSIEIDIEQGGVKLIRIRDDGGG 63

Query: 63  MTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           +  +++ +A+ RH TSKI D  D   + T GFRGEAL SI +VS L+L S     ++  +
Sbjct: 64  IDHDDLALALSRHATSKIDDLEDLEAVATLGFRGEALASIASVSRLSLTSN-NGGSSAWR 122

Query: 121 IAISGEKISSV-RPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
               G  +     P +   GT VEVRDLFF  PAR  FL++E+ E N I D I+++A++ 
Sbjct: 123 AISEGRDMQVEVTPASHPQGTSVEVRDLFFNTPARRKFLRTEKTEYNRIDDSIKKLALSR 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
             V+F     +  +  +    T     +R++ + G  F+  A+ ++     + L G+ G+
Sbjct: 183 FDVAFNLRHNQRAQLSLRPAKTQLEQEKRVADICGTTFMEQALYVDNTRPGLRLWGWIGL 242

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF+R  A+  + F+NGR ++DK +   +R AY + +  GR+P  VL LEI P  VDVNV
Sbjct: 243 PTFSRSQADLQHFFVNGRCIRDKVVSHAVRQAYQDVLYHGRHPAFVLFLEITPADVDVNV 302

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPK------- 352
           HP K  +RFR    I +FI  +++KA+ +        L       F  D + +       
Sbjct: 303 HPTKHEVRFRESGSIHSFISSTLKKALAED--RPQDHLQSNSTGEFPSDGSAQHTGGGGQ 360

Query: 353 ----THLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE---------- 398
                + P          +      +R +  +         +      +           
Sbjct: 361 FSGMVNQPDPNWQAAPQSQPAMQFSSRPNFGNSSSGAMSGSAGSMQNYQSLYSTSGINLP 420

Query: 399 -------SEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK 451
                   +     LG A AQ+   YI+++  +GL+IVD HAAHER+ +E+M+  F+   
Sbjct: 421 ESGSELGDQQDIPPLGYAIAQLKGIYILAENREGLIIVDMHAAHERITYERMKSAFDDQG 480

Query: 452 ITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQ 511
           + SQ LL PE + + + E     +H+E   +LG   ER    ++ +REIPAIL    +  
Sbjct: 481 LISQPLLVPESLAVSQREADAAEQHNEVFAKLGFVVERAAAESVIVREIPAILRGSEVEA 540

Query: 512 LLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSS 571
           LLRD++ ++++   +  ++D I  IL+TMAC+GS+R+ RK+   EMN LLR+ME    S 
Sbjct: 541 LLRDVLSDLLEHGNSERIRDHINEILSTMACHGSVRANRKLSVTEMNALLRDMEATERSG 600

Query: 572 QCNHGRPTFIKLKLSDIEKLFGR 594
           QCNHGRPT+ +L L  ++KLF R
Sbjct: 601 QCNHGRPTWSQLTLDQLDKLFLR 623


>gi|194290629|ref|YP_002006536.1| DNA mismatch repair protein [Cupriavidus taiwanensis LMG 19424]
 gi|193224464|emb|CAQ70475.1| methyl-directed mismatch repair protein [Cupriavidus taiwanensis
           LMG 19424]
          Length = 660

 Score =  527 bits (1357), Expect = e-147,   Method: Composition-based stats.
 Identities = 193/648 (29%), Positives = 325/648 (50%), Gaps = 62/648 (9%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            IR L +++I+QIAAGE++ERP+  +KEL+EN+LDA ++++   +  GG     ITDNG 
Sbjct: 18  PIRPLPDQLISQIAAGEVVERPASVVKELLENALDAGATQLGIRLEEGGVRRIVITDNGC 77

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+ + E+P+A+ RH TSKI+  D+  ++ T GFRGEAL SI +VS +TL SR   +    
Sbjct: 78  GIPAAELPVALMRHATSKIASLDELESVLTLGFRGEALASIASVSQMTLTSRTAADAHAT 137

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q++       +++P +   GT V+V+ L+F  PAR  FLK+EQ E     +++RR+A+A 
Sbjct: 138 QVSADS---GALQPASGGVGTTVDVQHLYFNTPARRKFLKTEQTELGHCLEMVRRVALAR 194

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V+ +           N     G+   R +QV+G DF    + L+E ++ ++L G+ G+
Sbjct: 195 PDVTISVHHNGKPLEHWNA----GDVATRTAQVLGNDFARARLALDEHADTLSLYGFAGL 250

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT +RG  +Q Y F+NGR V+DK +   +R+AY + +   R+P  VL L++ P  VDVNV
Sbjct: 251 PTASRGRPDQQYFFVNGRFVRDKLLNHAVRSAYQDVLHGDRFPSYVLCLDLPPEMVDVNV 310

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFH-QDNAPKTHLPKY 358
           HP+K  +RFR    +  F+  ++Q+ + ++  +    L             A     P  
Sbjct: 311 HPSKIEVRFRESRAVHQFVYHAVQRCLARQAGANGDSLHTDADGEITLPPGAATPAGPAR 370

Query: 359 ATSLTNTQ-------------------------EKLFLQENRLSTNDLLPSDDPTYSEDN 393
             + T  Q                          +      R        +     +   
Sbjct: 371 PGAGTPAQWINYSAARQTELGIAQPRQAYLGMVREATAPAPRPYGAPASGAGGWAGASAQ 430

Query: 394 DPVEESEATHYQLGIACAQIHQ------------------NYIISQTTDGLVIVDQHA-- 433
            P   ++    + G     + +                   Y I+Q     V+       
Sbjct: 431 PPAWLADVQAARAGDPPGLLDRLPPAPAPDETGAADEHPLGYAIAQLHGIYVLAQNARGL 490

Query: 434 -------AHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIK 486
                  AHER+++E+++   ++ ++  Q LL P  +     E  +  EH E L  LG  
Sbjct: 491 VLVDMHAAHERILYEQIKAALDARELAVQPLLIPVTLPASPVEIGVAEEHQETLTLLGFD 550

Query: 487 AERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSI 546
                P  +A+R +PA+L + +   L RD++ ++     +  L +R   +LAT+AC+ ++
Sbjct: 551 IAPVSPTTLAVRAVPALLQQADAEALARDVLRDLHAYGGSRVLAERRNELLATLACHSAV 610

Query: 547 RSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           R+ RK+   EMN LLR+ME+   + QCNHGRPT+++L ++++++LF R
Sbjct: 611 RANRKLTVEEMNALLRQMEQTERADQCNHGRPTWVQLTVTELDRLFLR 658


>gi|261392296|emb|CAX49822.1| DNA mismatch repair protein MutL [Neisseria meningitidis 8013]
          Length = 658

 Score =  526 bits (1356), Expect = e-147,   Method: Composition-based stats.
 Identities = 211/658 (32%), Positives = 342/658 (51%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  +AGGG    +++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELAGGGIRLIRVSDNGS 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIKLALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS    A   GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAAAHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  +  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGDDFQTASLEIDSGNGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRADLTESVSNAGEVLHDITGVTPAPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLP 383
                   +++     K  +      + KT    Y ++    Q  L L+E+R + N    
Sbjct: 359 DSENLFDRASNYPTGNKPDTRNAFGASGKTAPMPYQSAYAPQQRSLSLRESRAAMNTYAE 418

Query: 384 SDDPT-----------YSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
               T            +   +   E+ A                    G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSRFEQARFGNMPSETPAPQTDTPLSDGIPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++       + SQ LL P        ECA + +H
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGRLQSQRLLIPVTFAASHEECAALADH 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            + L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++    I
Sbjct: 539 ADALAGFGLELSDMGGNTLAVRTVPAMLGKADVVSLAKDVLGELAQVGSSQTIEEHENRI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSVRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|239501497|ref|ZP_04660807.1| DNA mismatch repair ATPase [Acinetobacter baumannii AB900]
          Length = 650

 Score =  526 bits (1356), Expect = e-147,   Method: Composition-based stats.
 Identities = 207/639 (32%), Positives = 342/639 (53%), Gaps = 46/639 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L   + NQIAAGE+IERPS  +KEL+ENS+DA ++ +   IA GG +  +I DNG 
Sbjct: 10  RIHTLDAALANQIAAGEVIERPSSVVKELLENSIDAGATELIVRIAQGGSTLIEIIDNGH 69

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+AV RH TSKI  ++D   I + GFRGEAL SI AVS LTL S   ++  G 
Sbjct: 70  GIHPDDLPLAVMRHATSKIKTAEDLHAIVSLGFRGEALASIAAVSRLTLTSSQDESGIGH 129

Query: 120 QIAIS--GEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           Q+ ++        V+ VA   GT + V+DLFF +PAR  FLK    E   I +++RR+A+
Sbjct: 130 QVEVNGTAFDHQQVQAVAAQKGTHIRVQDLFFNVPARRKFLKKPTTEFGHIEEIVRRLAL 189

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            +  + F      + R  +    +     +R+ Q++G+ F+ NA  ++ +S  + L G+ 
Sbjct: 190 THFDIRFVLEHNDNIRINLPIADSGELRFQRVQQLLGQQFVQNAYWIDAESINMRLSGWL 249

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G P+  R  A+  YV++NGR V+DK I   +R AY   +   ++   +L LE+DP  +DV
Sbjct: 250 GHPSDARAQADLQYVYVNGRIVKDKTISHALRMAYDGILHGHQHSSYLLFLEVDPENIDV 309

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSS---------------------- 335
           NVHP K  IRF N   +  F+    ++ + +   +++                       
Sbjct: 310 NVHPTKHEIRFLNQREVHEFVRHYAKETLAQFQTASADLAQAMKVDDTQNLSVQPQPKYQ 369

Query: 336 ---VLSKKMISSFHQDNAPKTHLPKYA--TSLTNTQEKLFLQENRLSTND---------- 380
               L +   ++    + P  + P     T   N++ +      +    +          
Sbjct: 370 EQFTLHRTAQAADTAVDKPNGYQPSTELLTDFNNSRPQAVHYAEQTPKYNGSAQLNNALK 429

Query: 381 ----LLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHE 436
                L      +S D +    ++   + LGIA AQ+H  YI++Q T+GL+IVD HAAHE
Sbjct: 430 TYLAPLRDQPTNFSVDENIEPVAKVDEFPLGIAIAQLHGIYILAQNTEGLIIVDMHAAHE 489

Query: 437 RLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAI 495
           R++ ++M+  ++  +  TSQ LL P++I +   +   + +    L RLG++ + +G   +
Sbjct: 490 RILLQQMKNAWDKPEFWTSQQLLIPKVISISRMQAVRVEDLKPQLERLGLEIDLYGDEQV 549

Query: 496 AIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSI 555
            +R +PAIL K +   L+ ++++++  +     L  + + +LA MAC+G++R+ R++   
Sbjct: 550 IVRGVPAILQKADFENLIPELLNDLDPNDEAQGLLQKRDELLAGMACHGAVRAHRQLSLS 609

Query: 556 EMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           EMN LLR+ME+   +SQCNHGRPT+    LS ++KLF R
Sbjct: 610 EMNALLRQMEQTEFASQCNHGRPTWRAFPLSQLDKLFAR 648


>gi|268316526|ref|YP_003290245.1| DNA mismatch repair protein MutL [Rhodothermus marinus DSM 4252]
 gi|262334060|gb|ACY47857.1| DNA mismatch repair protein MutL [Rhodothermus marinus DSM 4252]
          Length = 608

 Score =  526 bits (1356), Expect = e-147,   Method: Composition-based stats.
 Identities = 176/600 (29%), Positives = 308/600 (51%), Gaps = 12/600 (2%)

Query: 3   IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFG 62
           IR + E + N+IAAGE+++RP+  +KEL+EN+LDA +  +  ++   GK+  Q+ D+G G
Sbjct: 12  IRIMPESLANKIAAGEVVQRPASVVKELVENALDAGARHITVILKDAGKTLVQVVDDGCG 71

Query: 63  MTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           M+  +  +  QRH TSKI   DD   IHT GFRGEAL SI AV+ + L ++  Q+  G +
Sbjct: 72  MSPADARLCFQRHATSKIRTIDDLERIHTLGFRGEALASIAAVARVELKTKRAQDAAGYR 131

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           + I G ++ +  P A   GT V VR+LF+ +PAR NFLK+   E   I +  + +A+++P
Sbjct: 132 VQIEGGQLIAAEPCATANGTSVAVRNLFYNVPARRNFLKTPATEFKHIIETFQVLALSHP 191

Query: 181 KVSFTFSTIKSNRYKMNF---QSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           +V FT        Y++      S       RI  + G ++    + + E ++ ++++G+ 
Sbjct: 192 EVGFTLIHDDVEIYRLVPETDPSPAERLRRRIGTLFGPEYALQTIPVEETTSYLSVRGFL 251

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G P  +R +  + + F+N R V+ +++   + ++Y   IP G +P  VL LE+DP+ VDV
Sbjct: 252 GRPELHRKSRGEQFFFVNRRYVRHRYLEHAVTSSYEHLIPEGAHPFFVLFLELDPKHVDV 311

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPK 357
           NVHP K+ ++F +   I   +   +++A+    +     L      +   D A     P+
Sbjct: 312 NVHPTKAEVKFDDERGIYGVLRAIVRRALGMADLVPQ--LESAAAVTVPSDVAQTAAAPR 369

Query: 358 YATSLTNTQEKLFLQENR---LSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIH 414
              S          + +R       +++          +    ES+    +      Q+H
Sbjct: 370 TEVSGATPLRMPPGEVSRRLYAVEPEMVEPIPQQTVLPSSVRPESDEETPEHDTLIWQVH 429

Query: 415 QNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIM 474
             YI++Q   GL+++DQ+AAHER+++E+  ++  S    SQ LL P+ ++    + ALI 
Sbjct: 430 DRYILTQIRSGLLLIDQNAAHERILYERALRNLESGFGLSQQLLFPQTLEFSPADFALIE 489

Query: 475 EHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIE 534
           E   +L  LG   E F    + +R +P  +   +   +L D++ +   +     L  R E
Sbjct: 490 ELMPELRALGFDLELFSGRTVVVRGVPDDIRPGDERTMLEDLLAQYKAN-LPLRLPSR-E 547

Query: 535 NILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           N+  ++A   +IR G ++   +M  L+ ++           GRPT I+L L ++E+ FGR
Sbjct: 548 NLARSVARRNAIRPGTRLTEKQMRTLIDQLFLCETPYVSPTGRPTMIRLTLEELERRFGR 607


>gi|291524850|emb|CBK90437.1| DNA mismatch repair protein MutL [Eubacterium rectale DSM 17629]
          Length = 618

 Score =  526 bits (1355), Expect = e-147,   Method: Composition-based stats.
 Identities = 185/629 (29%), Positives = 302/629 (48%), Gaps = 48/629 (7%)

Query: 1   MK-IRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDN 59
           M  I  L+++ I++IAAGE++ERP   +KEL+EN++DA S+ +   I  GG SF +ITDN
Sbjct: 1   MPNIAILNQETIDKIAAGEVVERPCSVVKELVENAIDAGSTAITVEIKEGGISFIRITDN 60

Query: 60  GFGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNT 117
           G G+  +++ +A  RH TSKI   +D   + + GFRGEAL SI AV+ + L+++     T
Sbjct: 61  GCGIERDQVAVAFYRHSTSKIRSAEDLLTVKSLGFRGEALSSISAVARVELITKTYDELT 120

Query: 118 GAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           G +  I G K  S   +    GT   V+DLF+ +PAR  FLK+ Q E + I+D++ ++A+
Sbjct: 121 GTRYVIEGSKELSNEEIGAPDGTTFIVKDLFYNVPARRKFLKTAQTEGSYISDMVEKLAL 180

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           ++P +SF F      +      S NGN  + I  + G +  ++ +E+  +     ++G+ 
Sbjct: 181 SHPDISFKFINNNQTKLH---TSGNGNRKDIIYHIFGREISSSLLEVKHECEYFKVEGFI 237

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G P   RGN N    FINGR V+   +   I  AY   +   +YP  VL        +DV
Sbjct: 238 GKPVITRGNRNYENYFINGRYVKSNILSRAIEEAYKSFLMQHQYPFTVLYFTFFSE-LDV 296

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPK 357
           NVHP K  +RF N   I   +  +I   ++ K +     +            APK  + +
Sbjct: 297 NVHPTKMELRFDNNNEIYVELCDTIYAILSHKEMIPEVPVD--------STPAPKKIVHE 348

Query: 358 YATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGI--------- 408
           Y   +    EK  + E R + +  +     T +  N    E  A   +            
Sbjct: 349 YKEPIPEPFEKRRINEVRAAESRSVYGQSVTSTVKNYSATEPAAKAPETSTAYEPAQVVT 408

Query: 409 -----------------------ACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQ 445
                                     Q+ + Y + +  D L I+DQHAAHE++++EK   
Sbjct: 409 GTQQTLGDYDKVFLTESSKKQFSIIGQLFKTYWLIEFEDKLYIIDQHAAHEKVLYEKTMA 468

Query: 446 DFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILS 505
              +   TSQ +  P ++ L   EC ++ ++   + + G + E FG     I  IP  L 
Sbjct: 469 RLANKDFTSQRISPPIVMTLDARECEMLEKYRPQIEQFGYEVEHFGGKEYMISAIPDNLF 528

Query: 506 KKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREME 565
             ++  L  +++D+  + +T     D I   +A+M+C  +++   K+   E+N+L+ E+ 
Sbjct: 529 NIDMKDLFIEMLDDFSN-ATGRQTPDIITEKVASMSCKAAVKGNDKLTLPEINKLIDELL 587

Query: 566 KNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
              N   C HGRPT I +   +IEK F R
Sbjct: 588 SLDNPYNCPHGRPTIISMSKYEIEKKFKR 616


>gi|15614931|ref|NP_243234.1| DNA mismatch repair protein [Bacillus halodurans C-125]
 gi|20139217|sp|Q9KAC1|MUTL_BACHD RecName: Full=DNA mismatch repair protein mutL
 gi|10174988|dbj|BAB06087.1| DNA mismatch repair protein [Bacillus halodurans C-125]
          Length = 637

 Score =  526 bits (1355), Expect = e-147,   Method: Composition-based stats.
 Identities = 183/638 (28%), Positives = 312/638 (48%), Gaps = 50/638 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KI KL + + N+IAAGE++ERP+  +KEL+EN+LDA S ++   +  GG    ++ D+G 
Sbjct: 3   KIIKLDDHLSNKIAAGEVVERPASVVKELVENALDANSRKITIEVEAGGLDRIRVIDDGD 62

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  E++  A  RH TSKI    D   I T GFRGEALPSI +VSH+ + +     + G 
Sbjct: 63  GIEREDVETAFFRHATSKIKTDKDLFQIATLGFRGEALPSIASVSHVQIKTST-GGDGGT 121

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           ++ + G  I  +   AM  GT + V  LF+  PARL ++K+   E   I+DV+ R+A+A+
Sbjct: 122 EMVLEGGVIKKIGSTAMGKGTDLTVTQLFYNTPARLKYVKTVHTELGNISDVVNRLALAH 181

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P VSF       N  +    S NG+  + I+ + G       V L+ ++ + T+ G+   
Sbjct: 182 PYVSFQLFHNGKNVLR---TSGNGDQLQVIAAIYGRTVAKQMVPLSGETIDFTVSGFAAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P   R +     + +NGR +++  +   I+  +   +P+GRYP+ ++ +E+DP+ +DVNV
Sbjct: 239 PEVTRASRQYMSLLVNGRYIRNVALSKAIQQGFHTLLPIGRYPIAIVNIELDPQLIDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSV--------------LSKKMISSF 345
           HP+K  +R      +   + ++I++A  K+ +   +                     S+ 
Sbjct: 299 HPSKLEVRVSKEEELCRLVTETIERAFKKEQLIPEATKPTGGKQKSEQLSFTLDDFTSAK 358

Query: 346 HQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYS--------------- 390
             ++   T   +     ++  + +  QE R  +NDL   +    +               
Sbjct: 359 PSEDRGSTSSNEENEQRSSIDKNVLFQEERKLSNDLPSINMVREASASVEPALEKEPPAA 418

Query: 391 ----------EDNDPVEESE----ATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHE 436
                     E     EE+     A          Q+H  YI++Q   GL I+DQHAA E
Sbjct: 419 ELTAGAKGAMEQASMEEETSNSLPANRVPTMYPIGQMHGTYILAQNDQGLYIIDQHAAQE 478

Query: 437 RLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIA 496
           R+ +E  R+         Q L+ P  ++    E A I EH EDL ++G+  E FGP    
Sbjct: 479 RMKYEYFREKVGEVTNELQELIVPITVECTLQEAAYIEEHLEDLKQVGLFFEEFGPQTFM 538

Query: 497 IREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIE 556
           IR+ P    K    + +R++ID++++      ++   E +   M+C  +I++ R ++  E
Sbjct: 539 IRQHPTWFPKGLEEETIREMIDQLMEKRKVD-IKKLREEVAILMSCKAAIKANRHLRHDE 597

Query: 557 MNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           M  LL  + K+ +   C HGRP  +++   ++EK+F R
Sbjct: 598 MYALLEALRKSSDPFTCPHGRPIIVQITTYEMEKMFKR 635


>gi|260554622|ref|ZP_05826843.1| DNA mismatch repair ATPase [Acinetobacter baumannii ATCC 19606]
 gi|260411164|gb|EEX04461.1| DNA mismatch repair ATPase [Acinetobacter baumannii ATCC 19606]
          Length = 650

 Score =  526 bits (1355), Expect = e-147,   Method: Composition-based stats.
 Identities = 207/639 (32%), Positives = 342/639 (53%), Gaps = 46/639 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L   + NQIAAGE+IERPS  +KEL+ENS+DA ++ +   IA GG +  +I DNG 
Sbjct: 10  RIHTLDAALANQIAAGEVIERPSSVVKELLENSIDAGATELIVRIAQGGSTLIEIIDNGH 69

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+AV RH TSKI  ++D   I + GFRGEAL SI AVS LTL S   ++  G 
Sbjct: 70  GIHPDDLPLAVMRHATSKIKTAEDLHAIVSLGFRGEALASIAAVSRLTLTSSQDESGIGH 129

Query: 120 QIAIS--GEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           Q+ ++        V+ VA   GT + V+DLFF +PAR  FLK    E   I +++RR+A+
Sbjct: 130 QVEVNGTAFDHQQVQAVAAQKGTHIRVQDLFFNVPARRKFLKKPTTEFGHIEEIVRRLAL 189

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            +  + F      + R  +    +     +R+ Q++G+ F+ NA  ++ +S  + L G+ 
Sbjct: 190 THFDIRFVLEHNDNIRINLPIADSGELRFQRVQQLLGQQFVQNAYWIDAESINMRLSGWL 249

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G P+  R  A+  YV++NGR V+DK I   +R AY   +   ++   +L LE+DP  +DV
Sbjct: 250 GHPSDARAQADLQYVYVNGRIVKDKTISHALRMAYDGILHGHQHSSYLLFLEVDPENIDV 309

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSS---------------------- 335
           NVHP K  IRF N   +  F+    ++ + +   +++                       
Sbjct: 310 NVHPTKHEIRFLNQREVHEFVRHYAKETLAQFQTASADLAQAMKVDDIQNLSVQPQPKYQ 369

Query: 336 ---VLSKKMISSFHQDNAPKTHLPKYA--TSLTNTQEKLFLQENRLSTND---------- 380
               L +   ++    + P  + P     T   N++ +      +    +          
Sbjct: 370 EQFTLHRTAQAADTAVDKPNGYQPSTELLTDFNNSRPQAVHYAEQTPKYNGSAQLNNALK 429

Query: 381 ----LLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHE 436
                L      +S D +    ++   + LGIA AQ+H  YI++Q T+GL+IVD HAAHE
Sbjct: 430 TYLAPLRDQPANFSVDENIEPVAKVDEFPLGIAIAQLHGIYILAQNTEGLIIVDMHAAHE 489

Query: 437 RLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAI 495
           R++ ++M+  ++  +  TSQ LL P++I +   +   + +    L RLG++ + +G   +
Sbjct: 490 RILLQQMKNAWDKPEFWTSQQLLIPKVISISRMQAVRVEDLKPQLERLGLEIDLYGDEQV 549

Query: 496 AIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSI 555
            +R +PAIL K +   L+ ++++++  +     L  + + +LA MAC+G++R+ R++   
Sbjct: 550 IVRGVPAILQKADFENLIPELLNDLDPNDEAQGLLQKRDELLAGMACHGAVRAHRQLSLS 609

Query: 556 EMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           EMN LLR+ME+   +SQCNHGRPT+    LS ++KLF R
Sbjct: 610 EMNALLRQMEQTEFASQCNHGRPTWRAFPLSQLDKLFAR 648


>gi|154246983|ref|YP_001417941.1| DNA mismatch repair protein [Xanthobacter autotrophicus Py2]
 gi|154161068|gb|ABS68284.1| DNA mismatch repair protein MutL [Xanthobacter autotrophicus Py2]
          Length = 643

 Score =  526 bits (1354), Expect = e-147,   Method: Composition-based stats.
 Identities = 235/618 (38%), Positives = 367/618 (59%), Gaps = 24/618 (3%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L   +I++IAAGE++ERP+  +KEL+EN+LDA +  +E VI GGG+   +++D+G
Sbjct: 25  MLIRRLPPVLIDRIAAGEVVERPAAVVKELVENALDAGARAIEVVIQGGGRRLVRVSDDG 84

Query: 61  FGMTSEEIPMAVQRHCTSKIS-DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GM  +++ + V+RH TSK++ +D  +I T GFRGEALPSIG+V+HL + SRP       
Sbjct: 85  SGMGPDDLALCVERHATSKLAGEDLLSISTLGFRGEALPSIGSVAHLAIASRPRDAAHAF 144

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           ++ + G  ++  RP A+  GT VEVRDLF+  PARL FLKS++ E     DV+RR+A+A 
Sbjct: 145 EVRVDGGVVTPPRPAALGGGTRVEVRDLFYATPARLKFLKSDRAEGAAAADVVRRLALAR 204

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGN-FPERISQVIGEDFINNAVELNEKSNEITLQGYTG 238
           P V+FT  T +        ++ + +    R++ V+G +   N V +N   +++ L+G  G
Sbjct: 205 PDVAFTLVTDERAAVTFPARADDADGRAARLADVLGAEAGRNVVAVNGIRDDVVLEGLAG 264

Query: 239 IPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVN 298
           +PTF++ N+   Y+F+NGR V+DK ++  +R AYA+ +P  RYPV+ L + +DPR VDVN
Sbjct: 265 LPTFSKANSLSQYLFVNGRPVRDKLLMGAVRAAYADLLPSDRYPVLALFISLDPRDVDVN 324

Query: 299 VHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKY 358
           VHPAK+ +RFR+   +R  I++++  A+  +  ST+  ++ ++++               
Sbjct: 325 VHPAKTEVRFRDGGNVRALIVRTLSDALGARIPSTAGTMADRLVALARTPELGPRAAFAP 384

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEAT---------------- 402
           A          F         D      P     +   EE +A                 
Sbjct: 385 AAPFATPGGGAFAGFRPAPALDYDWRQSPARPMPSGLGEEEQARLDIAEPSADARADAAP 444

Query: 403 ------HYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQT 456
                    LG A AQ+H+ YI++QT +GLV+VDQHAAHERL++EK++       +  Q 
Sbjct: 445 VSAVDLDRPLGAARAQLHETYIVAQTREGLVLVDQHAAHERLVYEKLKAALARDGVGRQG 504

Query: 457 LLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDI 516
           LL P ++DL   +   + E   DL  LG+  E FGP A+ +RE+PA+L   ++ +L+ D+
Sbjct: 505 LLIPAVVDLDPADADRLTERAGDLAALGLVLESFGPGAVLVREVPALLKDADVTRLVTDL 564

Query: 517 IDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHG 576
            +   +      L+ R+ ++ ATMAC+GS+R+GR+++  EMN LLREME+ PN+ +CNHG
Sbjct: 565 AEHAAEWDDALPLERRLLHVAATMACHGSVRAGRRLKVEEMNALLREMEETPNAGECNHG 624

Query: 577 RPTFIKLKLSDIEKLFGR 594
           RPTF+ L L D+EKLF R
Sbjct: 625 RPTFVTLSLKDVEKLFAR 642


>gi|184158632|ref|YP_001846971.1| DNA mismatch repair ATPase [Acinetobacter baumannii ACICU]
 gi|332874328|ref|ZP_08442240.1| DNA mismatch repair protein [Acinetobacter baumannii 6014059]
 gi|183210226|gb|ACC57624.1| DNA mismatch repair enzyme (predicted ATPase) [Acinetobacter
           baumannii ACICU]
 gi|322507604|gb|ADX03058.1| mutL [Acinetobacter baumannii 1656-2]
 gi|323518550|gb|ADX92931.1| DNA mismatch repair ATPase [Acinetobacter baumannii TCDC-AB0715]
 gi|332737456|gb|EGJ68371.1| DNA mismatch repair protein [Acinetobacter baumannii 6014059]
          Length = 650

 Score =  526 bits (1354), Expect = e-147,   Method: Composition-based stats.
 Identities = 207/639 (32%), Positives = 341/639 (53%), Gaps = 46/639 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L   + NQIAAGE+IERPS  +KEL+ENS+DA ++ +   IA GG +  +I DNG 
Sbjct: 10  RIHTLDAALANQIAAGEVIERPSSVVKELLENSIDAGATELIVRIAQGGSTLIEIIDNGH 69

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+AV RH TSKI  ++D   I + GFRGEAL SI AVS LTL S   ++  G 
Sbjct: 70  GIHPDDLPLAVMRHATSKIKTAEDLHAIVSLGFRGEALASIAAVSRLTLTSSQDESGIGH 129

Query: 120 QIAIS--GEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           Q+ ++        V+ VA   GT + V+DLFF +PAR  FLK    E   I +++RR+A+
Sbjct: 130 QVEVNGTAFDHQQVQAVAAQKGTHIRVQDLFFNVPARRKFLKKPTTEFGHIEEIVRRLAL 189

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            +  + F      + R  +    +     +R+ Q++G+ F+ NA  ++ +S  + L G+ 
Sbjct: 190 THFDIRFVLEHNDNIRINLPIADSGELRFQRVQQLLGQQFVQNAYWIDAESINMRLSGWL 249

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G P+  R  A+  YV++NGR V+DK I   +R AY   +   ++   +L LE+DP  +DV
Sbjct: 250 GHPSDARAQADLQYVYVNGRIVKDKTISHALRMAYDGILHGHQHSSYLLFLEVDPENIDV 309

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSS---------------------- 335
           NVHP K  IRF N   +  F+    ++ + +   +++                       
Sbjct: 310 NVHPTKHEIRFLNQREVHEFVRHYAKETLAQFQTASADLAQAMKVDDTQNLSVQPQPKYQ 369

Query: 336 ---VLSKKMISSFHQDNAPKTHLPKYA--TSLTNTQEKLFLQENRLSTND---------- 380
               L +   ++    + P  + P     T   N++ +      +    +          
Sbjct: 370 EQFTLHRTAQAADTAVDKPNGYQPSTELLTDFNNSRPQSVHYAEQTPKYNGSAQLNNALK 429

Query: 381 ----LLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHE 436
                L      +S D      ++   + LGIA AQ+H  YI++Q T+GL+IVD HAAHE
Sbjct: 430 TYLAPLRDQPANFSVDESIEPVAKVDEFPLGIAIAQLHGIYILAQNTEGLIIVDMHAAHE 489

Query: 437 RLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAI 495
           R++ ++M+  ++  +  TSQ LL P++I +   +   + +    L RLG++ + +G   +
Sbjct: 490 RILLQQMKNAWDKPEFWTSQQLLIPKVISISRMQAVRVEDLKPQLERLGLEIDLYGDEQV 549

Query: 496 AIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSI 555
            +R +PAIL K +   L+ ++++++  +     L  + + +LA MAC+G++R+ R++   
Sbjct: 550 IVRGVPAILQKADFENLIPELLNDLDPNDEAQGLLQKRDELLAGMACHGAVRAHRQLSLS 609

Query: 556 EMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           EMN LLR+ME+   +SQCNHGRPT+    LS ++KLF R
Sbjct: 610 EMNALLRQMEQTEFASQCNHGRPTWRAFPLSQLDKLFAR 648


>gi|169633284|ref|YP_001707020.1| enzyme in methyl-directed mismatch repair, stimulates binding of
           Vsr and MutS to heteroduplex DNA [Acinetobacter
           baumannii SDF]
 gi|169152076|emb|CAP00963.1| enzyme in methyl-directed mismatch repair, stimulates binding of
           Vsr and MutS to heteroduplex DNA [Acinetobacter
           baumannii]
          Length = 650

 Score =  526 bits (1354), Expect = e-147,   Method: Composition-based stats.
 Identities = 207/639 (32%), Positives = 340/639 (53%), Gaps = 46/639 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L   + NQIAAGE+IERPS  +KEL+ENS+DA ++ +   IA GG +  +I DNG 
Sbjct: 10  RIHTLDAALANQIAAGEVIERPSSVVKELLENSIDAGATELIVRIAQGGSTLIEIIDNGH 69

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+AV RH TSKI  ++D   I + GFRGEAL SI AVS LTL S   ++  G 
Sbjct: 70  GIHPDDLPLAVMRHATSKIKTAEDLHAIVSLGFRGEALASIAAVSRLTLTSSQDESGIGH 129

Query: 120 QIAIS--GEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           Q+ ++        V+ VA   GT + V+DLFF +PAR  FLK    E   I +++RR+A+
Sbjct: 130 QVEVNGTAFDHQQVQAVAAQKGTHIRVQDLFFNVPARRKFLKKPTTEFGHIEEIVRRLAL 189

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            +  + F      + R  +    +     +R+ Q++G+ F+ NA  ++ +S  + L G+ 
Sbjct: 190 THFDIRFVLEHNDNIRINLPIADSGELRFQRVQQLLGQQFVQNAYWIDAESINMRLSGWL 249

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G P+  R  A+  YV++NGR V+DK I   +R AY   +   ++   +L LE+DP  +DV
Sbjct: 250 GHPSDARAQADLQYVYVNGRIVKDKTISHALRMAYDGILHGHQHSSYLLFLEVDPENIDV 309

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSS---------------------- 335
           NVHP K  IRF N   +  F+    ++ + +   +++                       
Sbjct: 310 NVHPTKHEIRFLNQREVHEFVRHYAKETLAQFQTASADLAQAMKVDDTQNLSVQPQPKYQ 369

Query: 336 ---VLSKKMISSFHQDNAPKTHLPKYA--TSLTNTQEKLFLQENRLSTND---------- 380
               L +   ++    + P  + P     T   N++ +      +    +          
Sbjct: 370 EQFTLHRTAQAADTAVDKPNGYQPSTELLTDFNNSRPQSVHYAEQTPKYNGSAQLNNALK 429

Query: 381 ----LLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHE 436
                L      +S D       +   + LGIA AQ+H  YI++Q T+GL+IVD HAAHE
Sbjct: 430 TYLAPLRDQPANFSVDESIEPVPKVDEFPLGIAIAQLHGIYILAQNTEGLIIVDMHAAHE 489

Query: 437 RLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAI 495
           R++ ++M+  ++  +  TSQ LL P++I +   +   + +    L RLG++ + +G   +
Sbjct: 490 RILLKQMKNAWDKPEFWTSQQLLIPKVISISRMQAVRVEDLKPQLERLGLEIDLYGDEQV 549

Query: 496 AIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSI 555
            +R +PAIL K +   L+ ++++++  +     L  + + +LA MAC+G++R+ R++   
Sbjct: 550 IVRGVPAILQKADFENLIPELLNDLDPNDEAQGLLQKRDELLAGMACHGAVRAHRQLSLS 609

Query: 556 EMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           EMN LLR+ME+   +SQCNHGRPT+    LS ++KLF R
Sbjct: 610 EMNALLRQMEQTEFASQCNHGRPTWRAFPLSQLDKLFAR 648


>gi|295399905|ref|ZP_06809886.1| DNA mismatch repair protein MutL [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312111576|ref|YP_003989892.1| DNA mismatch repair protein MutL [Geobacillus sp. Y4.1MC1]
 gi|294978308|gb|EFG53905.1| DNA mismatch repair protein MutL [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311216677|gb|ADP75281.1| DNA mismatch repair protein MutL [Geobacillus sp. Y4.1MC1]
          Length = 619

 Score =  525 bits (1353), Expect = e-147,   Method: Composition-based stats.
 Identities = 182/620 (29%), Positives = 297/620 (47%), Gaps = 32/620 (5%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KIRKL +++ N+IAAGE++ERP+  +KEL+EN++DA S+ +E  +   G    ++ DNG 
Sbjct: 3   KIRKLDDQLSNKIAAGEVVERPASVVKELVENAIDANSTIIEIELEEAGLMKIRVIDNGD 62

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           GM  ++  +A +RH TSKI D  D   I T GFRGEALPSI +VS + + +       G 
Sbjct: 63  GMEEDDCLIAFERHATSKIKDEHDLFRIRTLGFRGEALPSIASVSEVEMKTGTGDGP-GT 121

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+   G K+          GT + V +LFF  PARL ++K+   E   ITDV+ R+A+A+
Sbjct: 122 QVVFKGGKLVKRERTTSRKGTDITVSNLFFNTPARLKYMKTIHTELGHITDVVNRLAMAH 181

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P +SF          ++ + S NG+  + ++ + G D     V +  +S + T+ G+  +
Sbjct: 182 PDISFRLRHHGK---QLLYTSGNGDVRQVLAAIYGMDVAKKMVPIQAESLDFTVHGFISL 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P   R + N     +NGR V++  ++  I   Y   +P+GRYP+V L + +DP  VDVNV
Sbjct: 239 PEVTRASRNYISTIVNGRYVRNIPLMKAIEAGYHTLLPIGRYPIVFLSVAMDPILVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNA--------- 350
           HPAK  +RF     + + + +++++A+  + +     +  K       + A         
Sbjct: 299 HPAKLEVRFSKEAELNDLVTKAVRQALQAQTLIPEVTIKPKETPKPKAEQATWTFEHVVK 358

Query: 351 ------------PKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEE 398
                       PK             +E L L     +  +    +    S   +  E+
Sbjct: 359 EPMVSPLVRVEEPKPSSRMEEAKEEANEESLPLSPPAEAPQNSAADERERMSGQTESAEQ 418

Query: 399 SEATHYQ----LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITS 454
            +               Q+H  YI++Q   GL I+DQHAA ER+ +E  R+         
Sbjct: 419 EQVCVNNDRLPPLYPIGQMHGTYILAQNERGLYIIDQHAAQERIKYEYFREKVGEVTNEV 478

Query: 455 QTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLR 514
           Q LL P        E  LI  H E+L + G+  E FG N   +R  P+   K    +++ 
Sbjct: 479 QELLVPLTFHYPADEYVLIDAHREELAKCGVFLEPFGHNTFIVRSHPSWFPKGEEAEIIE 538

Query: 515 DIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCN 574
           ++I ++I+      ++   E     M+C  SI++   ++  E+  LL  + K  +   C 
Sbjct: 539 EMIQQVIEMKKVD-IKQLREKAAILMSCKRSIKANEYLRDDEIFALLESLRKTTDPFTCP 597

Query: 575 HGRPTFIKLKLSDIEKLFGR 594
           HGRP  I     ++EK+F R
Sbjct: 598 HGRPIIIHFSTYELEKMFKR 617


>gi|239946682|ref|ZP_04698435.1| DNA mismatch repair protein MutL [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239920958|gb|EER20982.1| DNA mismatch repair protein MutL [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 610

 Score =  525 bits (1352), Expect = e-147,   Method: Composition-based stats.
 Identities = 246/610 (40%), Positives = 370/610 (60%), Gaps = 16/610 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ LSE  IN+IAAGE+IERP+  +KEL+EN++DA S++++ ++   GK+   I+D+G
Sbjct: 1   MTIKFLSESTINRIAAGEVIERPASVVKELVENAVDAGSTKIDIILERAGKNLIIISDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISD-DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT +E+ +AV+RH TSK+ + DF NIHTFGFRGEALPSI  +S + + S+    +   
Sbjct: 61  IGMTDKELEIAVERHTTSKLDESDFLNIHTFGFRGEALPSIATISKMLITSKKQGADKAF 120

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI + G     V     N GT +E+RDLFF  PARL FL++++ E     DV++++ +A+
Sbjct: 121 QIKLIGGNEKQVTISVHNEGTKIEIRDLFFATPARLKFLRADKTELAATVDVVKKITLAH 180

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNG--NFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           PK+SF+ +    N  K+  Q+ +   N  +RI  VIG+DFI NA  ++ K+ + ++ GYT
Sbjct: 181 PKISFSLTHDGKNLLKLKRQNKDAETNLKQRIIDVIGDDFIKNAAYIDFKTPDFSICGYT 240

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
            IPT+NR ++   ++FIN R V+DK +   +R AY + +   RYP+  + L++DP+ VDV
Sbjct: 241 SIPTYNRASSEDQFLFINNRPVKDKLLQVALRVAYQDYLARDRYPLCAIFLQVDPQLVDV 300

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPK 357
           NVHPAK  +RF +P  +RN +I++I+ A+  K   TS+ ++   +  F      K     
Sbjct: 301 NVHPAKVEVRFHDPNYVRNLLIEAIKNALTNKSHVTSTTIATDALELFKNPLVNKQPQIS 360

Query: 358 YA----TSLTNTQEKLFLQENRLSTN-------DLLPSDDPTYSEDNDPVEESEATHYQL 406
            A    +   + +       N++  N       D LP        +N    E +      
Sbjct: 361 KAINVNSKSADYRPTTHSTLNKVPQNHVCQKLIDTLPHAKIEQEVENRIEHEQQTRKQYK 420

Query: 407 -GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDL 465
            G A  Q+H  YIISQT D +VI DQH AHERL +EK++    + ++  Q LL PEI++L
Sbjct: 421 LGAAKTQLHTTYIISQTEDSIVITDQHVAHERLGYEKIKDYLKTEELIKQRLLIPEIVEL 480

Query: 466 L-EGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSS 524
             E +   + EH E L++LG+  E+FG  +I + EIP IL   N+ +L++D+ D + D  
Sbjct: 481 PNEKKADCLYEHREKLYKLGLTLEKFGEKSIIVTEIPNILGDVNVQKLIQDLADHLSDFG 540

Query: 525 TTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLK 584
               L + IE++  T AC+ SIR+G+K+   EMN LLR+ME  P S QCNHGRPT+I+LK
Sbjct: 541 ENIALTELIEHVTETYACHYSIRAGQKLSVDEMNALLRQMENTPFSGQCNHGRPTYIELK 600

Query: 585 LSDIEKLFGR 594
           L DIE+LFGR
Sbjct: 601 LKDIERLFGR 610


>gi|222110664|ref|YP_002552928.1| DNA mismatch repair protein Mutl [Acidovorax ebreus TPSY]
 gi|221730108|gb|ACM32928.1| DNA mismatch repair protein MutL [Acidovorax ebreus TPSY]
          Length = 635

 Score =  525 bits (1352), Expect = e-147,   Method: Composition-based stats.
 Identities = 198/617 (32%), Positives = 320/617 (51%), Gaps = 27/617 (4%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            IR L +++I+QIAAGE++ERP+  ++EL++N+LD+ ++ +   +  GG     + D+G 
Sbjct: 20  PIRDLPDELISQIAAGEVVERPASVVRELVDNALDSGATAITVRLLAGGVRLISVEDDGC 79

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +E+P+A++RH TSKI++  D   + T GFRGEAL +I +VS   L+SRP    +  
Sbjct: 80  GIPQDELPVALRRHATSKITNLHDLETVATMGFRGEALAAIASVSETALLSRPQAQASAF 139

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            +     +I          GT VEV++LFF+ PAR  FLKS+  E     + +RR A+A 
Sbjct: 140 LLDARSGEIRPAARSH---GTTVEVKELFFSTPARRKFLKSDATELAHCVEAVRRHALAR 196

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGN------FPERISQVIGEDFINNAVELNEKSNEITL 233
           P V F          +       G          R++ V+GEDF+  +V +  ++  +T+
Sbjct: 197 PDVGFAIWHEGKLLEQWRATFVPGAGQAQDALARRLADVLGEDFVAQSVAVLHRAGPVTV 256

Query: 234 QGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPR 293
            G  G+P   R  A+  Y ++NGR V+DK +    R+AY + +   + PV  L +EIDP 
Sbjct: 257 TGRAGLPDAARARADHQYCYVNGRFVRDKVLTHAARSAYEDVLHGQKQPVYALYVEIDPA 316

Query: 294 QVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTS--SVLSKKMISSFHQDNAP 351
           +VDVNVHP K  +RFR+   +   +  +++ A+     +    S ++   +     D  P
Sbjct: 317 RVDVNVHPTKIEVRFRDSREVHQAVRHAVENALAAPRAAALAPSFVAASALPESDSDRKP 376

Query: 352 KTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQL----- 406
                + A +    +E+   + + L             +     V E     +       
Sbjct: 377 SEPFTRKAQAAIKFEERPGHKVSDLQALWQPTPSAAPTATPAQGVAEPPPRDWATPAPPA 436

Query: 407 --------GIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNST-KITSQTL 457
                   G A AQIH  YI+++   G+V+VD HAAHER+++E+++   +S  +I SQ L
Sbjct: 437 AEEPAWPLGRAVAQIHGVYILAENAQGMVVVDMHAAHERIVYERLKAQVDSGARIASQPL 496

Query: 458 LTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDII 517
           L P        E A   E  E L  LG++   F P  +A+R +P  L++ +  +L R ++
Sbjct: 497 LIPATFAATAQEVATAEECAEVLATLGLEVVPFSPKTLAVRAVPTSLAQGDAVELARSVL 556

Query: 518 DEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGR 577
            E+     T  +Q     ILATMAC+G++R+ RK+   EMN LLR+M     S QCNHGR
Sbjct: 557 AELAAHDATTVVQRARNEILATMACHGAVRANRKLTLDEMNALLRQMGTTDRSDQCNHGR 616

Query: 578 PTFIKLKLSDIEKLFGR 594
           PT+ +L + +++ LF R
Sbjct: 617 PTWRQLTMKELDALFLR 633


>gi|212639350|ref|YP_002315870.1| DNA mismatch repair protein [Anoxybacillus flavithermus WK1]
 gi|226723025|sp|B7GIA3|MUTL_ANOFW RecName: Full=DNA mismatch repair protein mutL
 gi|212560830|gb|ACJ33885.1| DNA mismatch repair enzyme (predicted ATPase) [Anoxybacillus
           flavithermus WK1]
          Length = 608

 Score =  525 bits (1351), Expect = e-146,   Method: Composition-based stats.
 Identities = 177/609 (29%), Positives = 305/609 (50%), Gaps = 21/609 (3%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           KIRKL + + N+IAAGE++ERP+  +KEL+EN++DA S+ +E  +   G +  ++ DNG 
Sbjct: 3   KIRKLDDALANKIAAGEVVERPASVVKELVENAIDAHSTIIEVELEEAGLAKIRVVDNGD 62

Query: 62  GMTSEEIPMAVQRHCTSKISD--DFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G   E+  +A +RH TSKI D  D   I T GFRGEALPSI +VSHL L +       G 
Sbjct: 63  GFEEEDCFLAFERHATSKIKDEADLFRIRTLGFRGEALPSIASVSHLELKTST-GEGPGT 121

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
            + + G ++      +   GT + V  LFF  PARL ++K+   E   + DVI R+A+A+
Sbjct: 122 WLVLKGGELVQHGRTSSRKGTDITVSHLFFNTPARLKYMKTIHTELGHVVDVINRLALAH 181

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P +SF  +       ++ + + NG+  + ++ + G D     + ++ ++ + T+ GY  +
Sbjct: 182 PHISFRLTHNGK---QLFYTNGNGDVRQVLAAIYGLDVAKKMIAIHAETLDFTIDGYVAL 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P   R + N     +NGR +++  +   I   Y   +P+GR+P+  L + +DP  +DVNV
Sbjct: 239 PEVTRASRNYMTTIVNGRYIKNYSLYKAIEEGYHTLLPIGRHPITFLNIMMDPLLIDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HPAK  +RF   T +   + Q+I+++  KK +       +   +   Q      H+ K +
Sbjct: 299 HPAKLEVRFSKETELNELVQQTIRQSFQKKTLIPEVTAPRVEKTKAEQQTFSFEHIVKES 358

Query: 360 TSLTN------------TQEKLFLQENRLS--TNDLLPSDDPTYSEDNDPVEESEATHYQ 405
            +++             T+E++ L+++       D+   D  +         E +     
Sbjct: 359 NTMSPRVTEIHRDQEKKTEERIVLEKSDEHVRDQDVTLLDVESVVPSEHVTGEMDQERIP 418

Query: 406 LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDL 465
                 Q+H  YI++Q  +GL I+DQHAA ER+ +E  R+   +     Q LL P  +  
Sbjct: 419 PLYPIGQMHGTYILAQNENGLYIIDQHAAQERIKYEYFREKLATVTNELQPLLIPLTLTY 478

Query: 466 LEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSST 525
              E  LI  + + L   G+  E FG N+  +R  P    K     ++ ++I ++++   
Sbjct: 479 SSSEYLLIESYRDQLAACGVFLEPFGHNSFIVRSHPQWFPKGEEVAIIEEMIKQVLEMKK 538

Query: 526 TYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKL 585
              ++   E     M+C  SI++ + +++ E+  LL  + K  +   C HGRP  I    
Sbjct: 539 VD-MKQLREKAAIMMSCKQSIKANQFLRNDEIFALLESLRKTSDPFTCPHGRPIIIHFST 597

Query: 586 SDIEKLFGR 594
            ++EK+F R
Sbjct: 598 YELEKMFKR 606


>gi|332867099|ref|ZP_08437396.1| DNA mismatch repair protein [Acinetobacter baumannii 6013113]
 gi|332734292|gb|EGJ65421.1| DNA mismatch repair protein [Acinetobacter baumannii 6013113]
          Length = 650

 Score =  525 bits (1351), Expect = e-146,   Method: Composition-based stats.
 Identities = 210/639 (32%), Positives = 343/639 (53%), Gaps = 46/639 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L   + NQIAAGE+IERPS  +KEL+ENS+DA ++ +   IA GG +  +I DNG 
Sbjct: 10  RIHTLDAALANQIAAGEVIERPSSVVKELLENSIDAGATELIVRIAQGGSTLIEIIDNGH 69

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+AV RH TSKI  ++D   I + GFRGEAL SI AVS LTL S   ++  G 
Sbjct: 70  GIHPDDLPLAVMRHATSKIKTAEDLHAIVSLGFRGEALASIAAVSRLTLTSSQDESGIGH 129

Query: 120 QIAIS--GEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           Q+ ++        V+ VA   GT + V+DLFF +PAR  FLK    E   I +++RR+A+
Sbjct: 130 QVEVNGTAFDHQQVQAVAAQKGTHIRVQDLFFNVPARRKFLKKPTTEFGHIKEIVRRLAL 189

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            +  + F      + R  +    +     +R+ Q++G+ F+ NA  ++ +S  + L G+ 
Sbjct: 190 THFDIRFVLEHNDNIRINLPIADSGELRFQRVQQLLGQQFVQNAYWIDAESINMRLSGWL 249

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G P+  R  A+  YV++NGR V+DK I   +R AY   +   ++   +L LE+DP  +DV
Sbjct: 250 GHPSDARAQADLQYVYVNGRIVKDKTISHALRMAYDGILHGHQHSSYLLFLEVDPENIDV 309

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLS----KKMISSFHQDNAP-- 351
           NVHP K  IRF N   +  F+    ++ + +   +++ +          +SF Q      
Sbjct: 310 NVHPTKHEIRFLNQREVHEFVRHYAKETLAQFQTASADLAQAMKADDTQASFVQSQPKYQ 369

Query: 352 -----------------KTHLPKYATSL-----TNTQEKLFLQENRLSTN---------- 379
                            K+   + +T L      +  + +   E     N          
Sbjct: 370 EQFTLHRTDQAVDTTLDKSSSYQPSTELLTDFNNSRPQAVHYAEQTPKYNGSAQLNNALK 429

Query: 380 ---DLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHE 436
                L      +S D +    ++   + LGIA AQ+H  YI++Q T+GL+IVD HAAHE
Sbjct: 430 TYLAPLRDQPTNFSVDENIESVAKVDEFPLGIAIAQLHGIYILAQNTEGLIIVDMHAAHE 489

Query: 437 RLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAI 495
           R++ ++M+  ++  +  TSQ LL P++I +   +   + +    L RLG++ + +G   +
Sbjct: 490 RILLQQMKNAWDKPEFWTSQQLLIPKVISISRMQAIRVEDLKPQLERLGLEIDLYGDEQV 549

Query: 496 AIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSI 555
            +R +PAIL K +   L+ ++++++  +     L  + + +LA MAC+G++R+ R++   
Sbjct: 550 IVRGVPAILQKADFENLIPELLNDLDPNDEAQGLLQKRDELLAGMACHGAVRAHRQLSLS 609

Query: 556 EMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           EMN LLR+ME+   +SQCNHGRPT+    LS ++KLF R
Sbjct: 610 EMNALLRQMEQTEFASQCNHGRPTWRAFPLSQLDKLFAR 648


>gi|254670262|emb|CBA05521.1| DNA mismatch repair protein MutL [Neisseria meningitidis alpha153]
          Length = 658

 Score =  525 bits (1351), Expect = e-146,   Method: Composition-based stats.
 Identities = 210/658 (31%), Positives = 339/658 (51%), Gaps = 69/658 (10%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L + ++NQIAAGE++ERP+ A+KE++ENS+DA ++ ++  + GGG     ++DNG 
Sbjct: 3   RIAALPDHLVNQIAAGEVVERPANALKEIVENSIDAGATAIDVELDGGGIRLIHVSDNGG 62

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  ++I +A+ RH TSKI   +D  ++ + GFRGE L SI +VS LTL SR   ++   
Sbjct: 63  GIHPDDIELALHRHATSKIKTLNDLEHVASMGFRGEGLASIASVSRLTLTSRQEDSSHAT 122

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           Q+     K+SS        GT +E  +LFF  PAR  FLKSE  E      ++ R+A+A+
Sbjct: 123 QVKAEDGKLSSPTAATHPVGTTIEAAELFFNTPARRKFLKSENTEYAHCATMLERLALAH 182

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P ++F+        +K+  QS      ERI+ ++G+DF   ++E++  S  + L G    
Sbjct: 183 PHIAFSLKRDGKQVFKLPAQS----LHERIAAIVGDDFQTASLEIDSGSGALRLYGAIAK 238

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PTF +G  ++ Y F+N R V+DK +L  ++ AY + +     P  VL L++ P  VDVNV
Sbjct: 239 PTFAKGKTDKQYCFVNHRFVRDKVMLHAVKQAYRDVLHNALTPAFVLFLDLPPEAVDVNV 298

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINK------------------------------- 328
           HP K+ IRFR+   +   +  ++ KA+                                 
Sbjct: 299 HPTKTEIRFRDSQQVHQLVFHTLNKALADTRANLTESVGNAGEVLHDITGVVSTPMPSEN 358

Query: 329 -----KGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLP 383
                    ++     K  +     ++ KT    Y ++    Q  L L+E+R + N    
Sbjct: 359 DSENLFDSVSNYPTGNKSDTHNAFGSSGKTAPMPYQSAYAPQQRSLSLRESRAAMNTYAE 418

Query: 384 SDDPT-----------YSEDNDPVEESEATHYQL---------------GIACAQIHQNY 417
               T            +   +   E+ A                    G A AQ+   Y
Sbjct: 419 LYKKTDDIDLELSRFEQARFGNMPSETPAPQTDTPLSDGIPSQSELPPLGFAIAQLLGIY 478

Query: 418 IISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEH 476
           I++Q  D L+++D HAA ER+ +EKM++       + SQ LL P        ECA + +H
Sbjct: 479 ILAQAEDSLLLIDMHAAAERVNYEKMKRQRQENGRLQSQRLLIPVTFAASHEECAALADH 538

Query: 477 DEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENI 536
            + L   G++    G N +A+R +PA+L K ++  L +D++ E+    ++ T+++    I
Sbjct: 539 ADALAGFGLELSDMGGNTLAVRTVPAMLGKADVVSLAKDVLGELAQVGSSQTIEEHENRI 598

Query: 537 LATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           LATM+C+GS+R+GR++   EMN LLR+ME  P S+QCNHGRPT++KL L +++ LF R
Sbjct: 599 LATMSCHGSVRAGRRLTLPEMNALLRDMENTPRSNQCNHGRPTWVKLTLKELDALFLR 656


>gi|169795562|ref|YP_001713355.1| enzyme in methyl-directed mismatch repair, stimulates binding of
           Vsr and MutS to heteroduplex DNA [Acinetobacter
           baumannii AYE]
 gi|213158497|ref|YP_002319795.1| DNA mismatch repair protein MutL [Acinetobacter baumannii AB0057]
 gi|215483049|ref|YP_002325254.1| DNA mismatch repair protein MutL family protein [Acinetobacter
           baumannii AB307-0294]
 gi|301347865|ref|ZP_07228606.1| DNA mismatch repair protein MutL family protein [Acinetobacter
           baumannii AB056]
 gi|301510580|ref|ZP_07235817.1| DNA mismatch repair protein MutL family protein [Acinetobacter
           baumannii AB058]
 gi|301596368|ref|ZP_07241376.1| DNA mismatch repair protein MutL family protein [Acinetobacter
           baumannii AB059]
 gi|332850620|ref|ZP_08432867.1| DNA mismatch repair protein [Acinetobacter baumannii 6013150]
 gi|169148489|emb|CAM86355.1| enzyme in methyl-directed mismatch repair, stimulates binding of
           Vsr and MutS to heteroduplex DNA [Acinetobacter
           baumannii AYE]
 gi|213057657|gb|ACJ42559.1| DNA mismatch repair protein MutL [Acinetobacter baumannii AB0057]
 gi|213988182|gb|ACJ58481.1| DNA mismatch repair protein MutL family protein [Acinetobacter
           baumannii AB307-0294]
 gi|332730457|gb|EGJ61773.1| DNA mismatch repair protein [Acinetobacter baumannii 6013150]
          Length = 650

 Score =  524 bits (1350), Expect = e-146,   Method: Composition-based stats.
 Identities = 210/639 (32%), Positives = 343/639 (53%), Gaps = 46/639 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L   + NQIAAGE+IERPS  +KEL+ENS+DA ++ +   IA GG +  +I DNG 
Sbjct: 10  RIHTLDAALANQIAAGEVIERPSSVVKELLENSIDAGATELIVRIAQGGSTLIEIIDNGH 69

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+AV RH TSKI  ++D   I + GFRGEAL SI AVS LTL S   ++  G 
Sbjct: 70  GIHPDDLPLAVMRHATSKIKTAEDLHAIVSLGFRGEALASIAAVSRLTLTSSQDESGIGH 129

Query: 120 QIAIS--GEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           Q+ ++        V+ VA   GT + V+DLFF +PAR  FLK    E   I +++RR+A+
Sbjct: 130 QVEVNGTAFDHQQVQAVAAQKGTHIRVQDLFFNVPARRKFLKKPTTEFGHIEEIVRRLAL 189

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            +  + F      + R  +    +     +R+ Q++G+ F+ NA  ++ +S  + L G+ 
Sbjct: 190 THFDIRFVLEHNDNIRINLPIADSGELRFQRVQQLLGQQFVQNAYWIDAESINMRLSGWL 249

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G P+  R  A+  YV++NGR V+DK I   +R AY   +   ++   +L LE+DP  +DV
Sbjct: 250 GHPSDARAQADLQYVYVNGRIVKDKTISHALRMAYDGILHGHQHSSYLLFLEVDPENIDV 309

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLS----KKMISSFHQDNAP-- 351
           NVHP K  IRF N   +  F+    ++ + +   +++ +          +SF Q      
Sbjct: 310 NVHPTKHEIRFLNQREVHEFVRHYAKETLAQFQTASADLAQAMKADDTQASFVQSQPKYQ 369

Query: 352 -----------------KTHLPKYATSL-----TNTQEKLFLQENRLSTN---------- 379
                            K+   + +T L      +  + +   E     N          
Sbjct: 370 EQFTLHRTDQAVDTTLDKSSSYQPSTELLTDFNNSRPQAVHYAEQTPKYNGSAQLNNALK 429

Query: 380 ---DLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHE 436
                L      +S D +    ++   + LGIA AQ+H  YI++Q T+GL+IVD HAAHE
Sbjct: 430 TYLAPLRDQPTNFSVDENIESVAKVDEFPLGIAIAQLHGIYILAQNTEGLIIVDMHAAHE 489

Query: 437 RLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAI 495
           R++ ++M+  ++  +  TSQ LL P++I +   +   + +    L RLG++ + +G   +
Sbjct: 490 RILLQQMKNAWDKPEFWTSQQLLIPKVISISRMQAIRVEDLKPQLERLGLEIDLYGDEQV 549

Query: 496 AIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSI 555
            +R +PAIL K +   L+ ++++++  +     L  + + +LA MAC+G++R+ R++   
Sbjct: 550 IVRGVPAILQKADFENLIPELLNDLDPNDEAQGLLQKRDELLAGMACHGAVRAHRQLSLS 609

Query: 556 EMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           EMN LLR+ME+   +SQCNHGRPT+    LS ++KLF R
Sbjct: 610 EMNALLRQMEQTEFASQCNHGRPTWRAFPLSQLDKLFAR 648


>gi|103487111|ref|YP_616672.1| DNA mismatch repair protein [Sphingopyxis alaskensis RB2256]
 gi|123078316|sp|Q1GSN3|MUTL_SPHAL RecName: Full=DNA mismatch repair protein mutL
 gi|98977188|gb|ABF53339.1| DNA mismatch repair protein MutL [Sphingopyxis alaskensis RB2256]
          Length = 603

 Score =  524 bits (1350), Expect = e-146,   Method: Composition-based stats.
 Identities = 228/606 (37%), Positives = 354/606 (58%), Gaps = 16/606 (2%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M IR+L E ++N+IAAGE++ERP+ A+KEL+EN++DA ++R+   IA GG +  ++ D+G
Sbjct: 1   MSIRRLPETLVNRIAAGEVVERPAAALKELVENAIDAGATRIAVRIAEGGIARLEVEDDG 60

Query: 61  FGMTSEEIPMAVQRHCTSKISDD-FSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
            GMT+ ++ +A++RH TSK+ DD    + T GFRGEALPSI +V+ LTL SR    + G 
Sbjct: 61  CGMTAADMVLALERHATSKLPDDAIEAVTTLGFRGEALPSIASVARLTLESRTAGGD-GW 119

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           +  +    + +  P A+  GT V V  LF  +PAR  FL+S + E     DV+RR+A+A 
Sbjct: 120 RRVVDNGAVVAEGPAALGQGTRVIVEHLFARVPARRKFLRSARSEYAACLDVVRRLAMAR 179

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
           P V FT          +       +   R++ +   D   N++ ++    E+ L G   +
Sbjct: 180 PDVGFTLEHDGRRVLDVQ---GGQDRVGRVAALTSRDLAANSIGVDLDRGEVHLGGVISL 236

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           PT+NRG A+  Y+F+NGR V+D+ ++  +R AYA+ +   R+PVV L L++   +VDVNV
Sbjct: 237 PTYNRGIADHQYLFVNGRPVKDRLLVGALRGAYADLLARDRHPVVALFLDVPTGEVDVNV 296

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDN-APKTHLPKY 358
           HPAK+ +RFR+P +IR  I+  +++A+++ G  +    ++  ++++ Q+  AP       
Sbjct: 297 HPAKTEVRFRDPQLIRGMIVGGLRRALDEHGFRSVQKPAEAALAAWQQEPVAPPPATGFL 356

Query: 359 ATSLTNTQEKLFLQENRLSTNDLLPSDDP----------TYSEDNDPVEESEATHYQLGI 408
                      F  E  L   D+    D               +        A  + LGI
Sbjct: 357 FDRRAGAAVHPFAAEVSLPAADVARVYDRLMPFTAPAPLAGRAEVAATPPPAAEAHPLGI 416

Query: 409 ACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEG 468
           A  QI + YI+++  DGLVIVDQHAAHERL+ E +++      + SQ LL PE+++L E 
Sbjct: 417 ARGQIAKTYIVAEAEDGLVIVDQHAAHERLVLETLKRGMAGQAVPSQGLLIPEVVELDEP 476

Query: 469 ECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYT 528
            C  +    + L  LG++ ERFGP A+ +R  PA+L   +  +L+ DI D++        
Sbjct: 477 ACDRLEAAADGLAALGVELERFGPGAVMVRATPAMLGAIDCHRLVTDIADDLAGYDAALG 536

Query: 529 LQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDI 588
           L +R+E + ATMAC+GS+R+GR +   EMN LLR+ME  P+S QCNHGRPT++KL + D+
Sbjct: 537 LNERLELVAATMACHGSVRAGRTLSVAEMNALLRQMEVTPHSGQCNHGRPTWVKLAMGDV 596

Query: 589 EKLFGR 594
           E+LFGR
Sbjct: 597 ERLFGR 602


>gi|260549350|ref|ZP_05823569.1| DNA mismatch repair ATPase [Acinetobacter sp. RUH2624]
 gi|260407459|gb|EEX00933.1| DNA mismatch repair ATPase [Acinetobacter sp. RUH2624]
          Length = 651

 Score =  524 bits (1349), Expect = e-146,   Method: Composition-based stats.
 Identities = 209/640 (32%), Positives = 343/640 (53%), Gaps = 47/640 (7%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I  L   + NQIAAGE+IERPS  +KEL+ENS+DA ++ +   IA GG +  +I DNG 
Sbjct: 10  RIHTLDAALANQIAAGEVIERPSSVVKELLENSIDAGATELIVRIAQGGSTLIEIIDNGH 69

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++P+AV RH TSKI  ++D   I + GFRGEAL SI AVS LTL S   ++  G 
Sbjct: 70  GIHPDDLPLAVMRHATSKIKTAEDLHAIVSLGFRGEALASIAAVSRLTLTSSQDESGIGH 129

Query: 120 QIAIS--GEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
           Q+ ++        V+ VA   GT + V+DLFF +PAR  FLK    E   I +++RR+A+
Sbjct: 130 QVEVNGTAFDHQQVQAVAAQKGTHIRVQDLFFNVPARRKFLKKPTTEFGHIEEIVRRLAL 189

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
            +  + F      + R  +    +     +R+ Q++G+ F+ NA  ++ +S  + L G+ 
Sbjct: 190 THFDIRFVLEHNDNIRINLPIADSGELRFQRVQQLLGQQFVQNAYWIDAESINMRLSGWL 249

Query: 238 GIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDV 297
           G P+  R  A+  YV++NGR V+DK I   +R AY   +   ++   +L LE+DP  +DV
Sbjct: 250 GHPSDARAQADLQYVYVNGRIVKDKTISHALRMAYDGILHGHQHSSYLLFLEVDPENIDV 309

Query: 298 NVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSS------------------VLSK 339
           NVHP K  IRF N   +  F+    ++ + +   +++                      +
Sbjct: 310 NVHPTKHEIRFLNQREVHEFVRHYAKETLAQFQTASADLAQAMKVDDTQNLSVQPQPKYQ 369

Query: 340 KMISSFHQDNAPKTHLPKYATSLTNTQ----------EKLFLQENRLSTNDLLP------ 383
           +  +    + A  T L K  +S  +T+          + +   E     N          
Sbjct: 370 EQFTLHRTEQAVDTTLDKPNSSQPSTELLTDFNNSRPQAVHYAEQTPKYNGSAQLNNALK 429

Query: 384 --------SDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAH 435
                        +S D +    ++   + LGIA AQ+H  YI++Q T+GL+IVD HAAH
Sbjct: 430 TYLAPLRDQPATNFSVDENVEPVAKIDEFPLGIAIAQLHGIYILAQNTEGLIIVDMHAAH 489

Query: 436 ERLIFEKMRQDFNSTK-ITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNA 494
           ER++ ++M+  ++  +  TSQ LL P++I +   +   + +    L RLG++ + +G   
Sbjct: 490 ERILLQQMKNAWDKPEFWTSQQLLIPKVISISRMQAVRVEDLKSQLERLGLEIDLYGDEQ 549

Query: 495 IAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQS 554
           + +R +PAIL K +   L+ ++++++  +     L  + + +LA MAC+G++R+ R++  
Sbjct: 550 VIVRGVPAILQKADFENLIPELLNDLDPNDEAQGLLQKRDELLAGMACHGAVRAHRQLSL 609

Query: 555 IEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
            EMN LLR+ME+   +SQCNHGRPT+    LS ++KLF R
Sbjct: 610 SEMNALLRQMEQTEFASQCNHGRPTWRAFPLSQLDKLFAR 649


>gi|167626478|ref|YP_001676978.1| DNA mismatch repair enzyme with ATPase activity [Francisella
           philomiragia subsp. philomiragia ATCC 25017]
 gi|167596479|gb|ABZ86477.1| DNA mismatch repair enzyme with ATPase activity [Francisella
           philomiragia subsp. philomiragia ATCC 25017]
          Length = 601

 Score =  524 bits (1349), Expect = e-146,   Method: Composition-based stats.
 Identities = 200/596 (33%), Positives = 325/596 (54%), Gaps = 8/596 (1%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR L E + NQIAAGE+IERPS  +KELIENS+DA ++ +   I  GGKS  +I DNG 
Sbjct: 9   QIRLLPEDLANQIAAGEVIERPSSVVKELIENSIDAGATAITIEIQEGGKSLIRIRDNGK 68

Query: 62  GMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  +++ +A+  H TSK+   ++  ++ + GFRGEAL SI +VS L ++S+    +   
Sbjct: 69  GIVYDDLRLALAPHATSKVYTLEELESVASMGFRGEALASIASVSKLKIISKHQDYDDAW 128

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAY 179
           QI     ++    P A   GT +EV +LF+  PAR  FLK +  E   I+D++++  + Y
Sbjct: 129 QINNETREV---TPAAHVTGTTIEVSELFYNTPARRKFLKKDNTEFLHISDLLKKYMLCY 185

Query: 180 PKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGI 239
             ++F           +           R+  +   DFI NA+ ++++  +  L G+   
Sbjct: 186 FGIAFRLIHNGKEVKDLLLAEDAQLKYNRVLDLYSRDFIENAIYIDKEVGDAHLWGWVAS 245

Query: 240 PTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNV 299
           P FNR  A+    +INGR ++DK +   I+ AY + +   RYP  +L L++D ++VDVNV
Sbjct: 246 PRFNRARADMQSFYINGRIIKDKIVTHAIKNAYKDVMYGNRYPAFLLYLDMDYKEVDVNV 305

Query: 300 HPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYA 359
           HPAKS +RFRN   I +F+  ++ KAI         + S    +++ +       L    
Sbjct: 306 HPAKSEVRFRNQKFIYDFLFGTVNKAITTSADIEIEISSFSENNTYQESKGTNNPLNIGN 365

Query: 360 TSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYII 419
            SL  + E    + +  S  D   S+  T  ++N+     +     LG A  QIH  YI+
Sbjct: 366 MSLDISIEDEKDESSNTSLLDKYFSNQTT--QENEIHISQKTKSSGLGQAICQIHGIYIL 423

Query: 420 SQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLL-TPEIIDLLEGECALIMEHDE 478
           SQ  DG+V+VD HAAHER+++E+M++ +++     +  L  P    L     A I E+ E
Sbjct: 424 SQVEDGIVLVDMHAAHERILYEEMKKTWHADTAKFKQNLLMPLTCRLSSNIVATIDENLE 483

Query: 479 DLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILA 538
              +LG +      +A+ +R  P  +  K++  L+ ++  E+  S  T +++  + +ILA
Sbjct: 484 VFEKLGFEISVVADDAVLVRSTPIYVKDKDVQNLISNVATELTSSGKTKSVEFYLNHILA 543

Query: 539 TMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           T++C+ ++R+  K+   EMN LLR+ME   NS QCNHGRPT++KL  + ++  F R
Sbjct: 544 TVSCHAAVRANDKLGIPEMNHLLRQMETVENSGQCNHGRPTWVKLNFAQLDNFFLR 599


>gi|241668914|ref|ZP_04756492.1| DNA mismatch repair enzyme with ATPase activity [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
 gi|254877446|ref|ZP_05250156.1| DNA mismatch repair protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254843467|gb|EET21881.1| DNA mismatch repair protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 601

 Score =  524 bits (1349), Expect = e-146,   Method: Composition-based stats.
 Identities = 198/596 (33%), Positives = 323/596 (54%), Gaps = 8/596 (1%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +IR L E + NQIAAGE+IERPS  +KELIENS+DA ++ +   I  GGKS  +I DNG 
Sbjct: 9   QIRLLPEDLANQIAAGEVIERPSSVVKELIENSIDAGATAITIEI