RPSBLAST alignment for GI: 254780399 and conserved domain: pfam01119

>gnl|CDD|144638 pfam01119, DNA_mis_repair, DNA mismatch repair protein, C-terminal domain. This family represents the C-terminal domain of the mutL/hexB/PMS1 family. This domain has a ribosomal S5 domain 2-like fold. Length = 118
 Score =  148 bits (375), Expect = 6e-36
 Identities = 49/118 (41%), Positives = 76/118 (64%)

Query: 209 ISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTI 268
           I+ + G +F  N + ++ +   + L G+   P  +R N +  Y+F+NGR V+DK +   I
Sbjct: 1   IAAIYGREFAENLLPIDAEDEGLRLSGFISKPELSRSNRDYQYLFVNGRPVRDKLLSHAI 60

Query: 269 RTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAI 326
           R AY + +P GRYPV VL LEIDP  VDVNVHPAK  +RFR+   + +FI +++++A+
Sbjct: 61  REAYRDLLPKGRYPVAVLFLEIDPELVDVNVHPAKREVRFRDEREVHDFIEEAVREAL 118