RPSBLAST alignment for GI: 254780399 and conserved domain: pfam08676

>gnl|CDD|149660 pfam08676, MutL_C, MutL C terminal dimerization domain. MutL and MutS are key components of the DNA repair machinery that corrects replication errors. MutS recognizes mispaired or unpaired bases in a DNA duplex and in the presence of ATP, recruits MutL to form a DNA signaling complex for repair. The N terminal region of MutL contains the ATPase domain and the C terminal is involved in dimerization. Length = 142
 Score =  172 bits (438), Expect = 3e-43
 Identities = 62/147 (42%), Positives = 101/147 (68%), Gaps = 6/147 (4%)

Query: 406 LGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDL 465
           LG A  Q+H  YI+++  DGL +VDQHAAHER+++EK++       + SQ LL P  ++L
Sbjct: 2   LGKALGQVHGTYILAENEDGLYLVDQHAAHERILYEKLKSKLKE-GLQSQPLLIPLTLEL 60

Query: 466 LEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSST 525
              E AL+ EH E L RLG + E FGPN++ +R +PA+L ++N+ +L+R+++DE+ +   
Sbjct: 61  SPEEAALLEEHKELLARLGFELEEFGPNSLIVRSVPALLRQQNLEELIRELLDELAEKG- 119

Query: 526 TYTLQDRIENILATMACYGSIRSGRKM 552
               ++ +E +LATMAC+ +IR+GR++
Sbjct: 120 ----EELLEELLATMACHSAIRAGRRL 142