RPSBLAST alignment for GI: 254780399 and conserved domain: KOG1978

>gnl|CDD|37189 KOG1978, KOG1978, KOG1978, DNA mismatch repair protein - MLH2/PMS1/Pms2 family [Replication, recombination and repair]. Length = 672
 Score = 73.1 bits (179), Expect = 2e-13
 Identities = 43/177 (24%), Positives = 85/177 (48%), Gaps = 11/177 (6%)

Query: 410 CAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGE 469
             Q +  +II +    L IVDQHA+ E+  FE+++    +T + +Q L+ P+ +DL    
Sbjct: 492 IGQFNLGFIIVKLEKDLFIVDQHASDEKRNFERLQS---TTVLKAQPLICPQALDLSAIN 548

Query: 470 CALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSK---KNI---PQLLRDIIDEIIDS 523
             +++++     + G K +    NA    +   +LS    KN       L+++I  + + 
Sbjct: 549 EMVLLDNLPLFEKNGFKVK-IDENAPDG-KRVRLLSVPVSKNQTFGVSDLKELISVLKNF 606

Query: 524 STTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTF 580
                   ++ +++A+ AC  S+  G  +   +M R++R + +  +   C HGRPT 
Sbjct: 607 PEETYRPSKVRSMIASKACRSSVMIGDPLSKDDMTRIVRSLAELEHPWNCPHGRPTM 663