RPSBLAST alignment of GI: 254780399 and protein with PDBid: 3h4l

>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Length = 367
 Score =  289 bits (740), Expect = 1e-78
 Identities = 87/361 (24%), Positives = 161/361 (44%), Gaps = 31/361 (8%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
           +I ++++  +++I +G++I   + A+KEL++NS+DA ++++E +    G    + +DNG 
Sbjct: 5   QIHQINDIDVHRITSGQVITDLTTAVKELVDNSIDANANQIEIIFKDYGLESIECSDNGD 64

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+          +H TSKI    D + + T GFRGEAL S+  ++ L++++         
Sbjct: 65  GIDPSNYEFLALKHYTSKIAKFQDVAKVQTLGFRGEALSSLCGIAKLSVITTTSPPKADK 124

Query: 120 QIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARL-NFLKSEQVETNLITDVIRRMAIA 178
                   I+S    + N GT V V  LF  +P R   F K+ + +      VI+  AI 
Sbjct: 125 LEYDMVGHITSKTTTSRNKGTTVLVSQLFHNLPVRQKEFSKTFKRQFTKCLTVIQGYAII 184

Query: 179 YPKVSFTFSTIKSNRYKMNFQSTNGNFP--ERISQVIGEDFINNAVELN----------- 225
              + F+   I     K    ST  N    + IS V G   +    E++           
Sbjct: 185 NAAIKFSVWNITPKGKKNLILSTMRNSSMRKNISSVFGAGGMRGLEEVDLVLDLNPFKNR 244

Query: 226 ------------EKSNEITLQGYTGIPTF--NRGNANQFYVFINGRTVQDKFILSTIRTA 271
                       +   +I ++GY    +F   R + ++ ++++N R V+   +L      
Sbjct: 245 MLGKYTDDPDFLDLDYKIRVKGYISQNSFGCGRNSKDRQFIYVNKRPVEYSTLLKCCNEV 304

Query: 272 YAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGI 331
           Y +T    ++P V L LE+    +DVNV P K  I   N   + +    ++    N++ +
Sbjct: 305 Y-KTFNNVQFPAVFLNLELPMSLIDVNVTPDKRVILLHNERAVIDIFKTTLSDYYNRQEL 363

Query: 332 S 332
           +
Sbjct: 364 A 364