BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780400|ref|YP_003064813.1| hypothetical protein CLIBASIA_01425 [Candidatus Liberibacter asiaticus str. psy62] (71 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254780400|ref|YP_003064813.1| hypothetical protein CLIBASIA_01425 [Candidatus Liberibacter asiaticus str. psy62] gi|254040077|gb|ACT56873.1| hypothetical protein CLIBASIA_01425 [Candidatus Liberibacter asiaticus str. psy62] Length = 71 Score = 112 bits (281), Expect = 2e-23, Method: Composition-based stats. Identities = 71/71 (100%), Positives = 71/71 (100%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF Sbjct: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 Query: 61 EAEKISGKIPY 71 EAEKISGKIPY Sbjct: 61 EAEKISGKIPY 71 >gi|116250683|ref|YP_766521.1| hypothetical protein RL0909 [Rhizobium leguminosarum bv. viciae 3841] gi|115255331|emb|CAK06406.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae 3841] Length = 126 Score = 111 bits (279), Expect = 3e-23, Method: Composition-based stats. Identities = 35/70 (50%), Positives = 51/70 (72%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 ++ EA IRY DG F+I+ PG+YVVCA+TG++IPL +L YWSV RQ PYA+ ++ Sbjct: 53 LFEGHGNREAKIRYLDGDFQILSPGSYVVCAMTGKQIPLDELRYWSVARQEPYADVISAI 112 Query: 61 EAEKISGKIP 70 +A+K +G +P Sbjct: 113 DADKRAGVLP 122 >gi|209548101|ref|YP_002280018.1| hypothetical protein Rleg2_0495 [Rhizobium leguminosarum bv. trifolii WSM2304] gi|209533857|gb|ACI53792.1| conserved hypothetical protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 76 Score = 111 bits (278), Expect = 4e-23, Method: Composition-based stats. Identities = 36/70 (51%), Positives = 51/70 (72%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 ++ EA IRY DG F+I+ PG+YVVCA+TG++IPL +L YWSV RQ PYA+ ++ Sbjct: 3 LFEGHGNREAKIRYLDGDFQILSPGSYVVCAMTGKQIPLDELRYWSVARQEPYADVISAI 62 Query: 61 EAEKISGKIP 70 EA+K +G +P Sbjct: 63 EADKRAGVLP 72 >gi|159184422|ref|NP_353723.2| hypothetical protein Atu0698 [Agrobacterium tumefaciens str. C58] gi|159139735|gb|AAK86508.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58] Length = 77 Score = 110 bits (277), Expect = 5e-23, Method: Composition-based stats. Identities = 32/69 (46%), Positives = 45/69 (65%) Query: 2 YNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFE 61 + A I Y DG F I++ G++V+CA+TG+ IPL +L YWSV RQ Y +A AS E Sbjct: 4 FEGGGNRLAVIEYLDGDFRIVQTGSHVLCAVTGKTIPLDELRYWSVARQEAYVDAAASLE 63 Query: 62 AEKISGKIP 70 AE+ +G +P Sbjct: 64 AERKAGDLP 72 >gi|227821007|ref|YP_002824977.1| hypothetical protein NGR_c04280 [Sinorhizobium fredii NGR234] gi|227340006|gb|ACP24224.1| hypothetical protein NGR_c04280 [Sinorhizobium fredii NGR234] Length = 77 Score = 110 bits (276), Expect = 6e-23, Method: Composition-based stats. Identities = 38/73 (52%), Positives = 52/73 (71%), Gaps = 3/73 (4%) Query: 1 MYNKVDE---NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAE 57 M N+ D EA IRY DG F+I+ G++VVCA+TG+ IP+ +L YWSV RQ PY +A+ Sbjct: 1 MMNRFDGNSSREAKIRYLDGDFQIVLAGSHVVCAMTGKAIPVDELRYWSVSRQEPYIDAD 60 Query: 58 ASFEAEKISGKIP 70 AS EAE+ +G +P Sbjct: 61 ASLEAERRAGALP 73 >gi|190890557|ref|YP_001977099.1| hypothetical protein RHECIAT_CH0000936 [Rhizobium etli CIAT 652] gi|190695836|gb|ACE89921.1| hypothetical conserved protein [Rhizobium etli CIAT 652] gi|327189787|gb|EGE56929.1| hypothetical protein RHECNPAF_543002 [Rhizobium etli CNPAF512] Length = 76 Score = 110 bits (276), Expect = 6e-23, Method: Composition-based stats. Identities = 36/70 (51%), Positives = 50/70 (71%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 ++ EA IRY DG F+I+ PG+YVVCA+TG+ IPL +L YWSV RQ PYA+ ++ Sbjct: 3 LFEGHGNREAKIRYLDGDFQIVSPGSYVVCAMTGKHIPLDELRYWSVARQEPYADVISAI 62 Query: 61 EAEKISGKIP 70 EA+K +G +P Sbjct: 63 EADKRAGVLP 72 >gi|241203285|ref|YP_002974381.1| hypothetical protein Rleg_0538 [Rhizobium leguminosarum bv. trifolii WSM1325] gi|240857175|gb|ACS54842.1| conserved hypothetical protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 76 Score = 110 bits (276), Expect = 7e-23, Method: Composition-based stats. Identities = 35/70 (50%), Positives = 51/70 (72%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 ++ EA IRY DG F+I+ PG+YVVCA+TG++IPL +L YWSV RQ PYA+ ++ Sbjct: 3 LFEGHGNREAKIRYLDGDFQILSPGSYVVCAMTGKQIPLDELRYWSVARQEPYADVISAI 62 Query: 61 EAEKISGKIP 70 +A+K +G +P Sbjct: 63 DADKRAGVLP 72 >gi|218663234|ref|ZP_03519164.1| hypothetical protein RetlI_29843 [Rhizobium etli IE4771] Length = 76 Score = 110 bits (276), Expect = 7e-23, Method: Composition-based stats. Identities = 35/70 (50%), Positives = 50/70 (71%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 ++ EA IRY DG F+I+ PG+YVVCA+TG+ IPL +L YWSV RQ PY++ ++ Sbjct: 3 LFEGHGNREAKIRYLDGDFQIVSPGSYVVCAMTGKHIPLDELRYWSVARQEPYSDVISAI 62 Query: 61 EAEKISGKIP 70 EA+K +G +P Sbjct: 63 EADKRAGVLP 72 >gi|218512335|ref|ZP_03509175.1| hypothetical protein Retl8_00919 [Rhizobium etli 8C-3] Length = 76 Score = 110 bits (275), Expect = 8e-23, Method: Composition-based stats. Identities = 36/70 (51%), Positives = 50/70 (71%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 ++ EA IRY DG F+I+ PG+YVVCA+TG+ IPL +L YWSV RQ PYA+ ++ Sbjct: 3 LFEGHGNREAKIRYLDGDFQILSPGSYVVCAMTGKNIPLDELRYWSVARQEPYADVISAI 62 Query: 61 EAEKISGKIP 70 EA+K +G +P Sbjct: 63 EADKRAGVLP 72 >gi|86356493|ref|YP_468385.1| hypothetical protein RHE_CH00847 [Rhizobium etli CFN 42] gi|86280595|gb|ABC89658.1| hypothetical conserved protein [Rhizobium etli CFN 42] Length = 76 Score = 109 bits (274), Expect = 1e-22, Method: Composition-based stats. Identities = 36/70 (51%), Positives = 50/70 (71%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 ++ EA IRY DG F+I+ PG+YVVCA+TG+ IPL +L YWSV RQ PYA+ ++ Sbjct: 3 LFEGHGNREAKIRYLDGDFQILSPGSYVVCAMTGKNIPLDELRYWSVARQEPYADVISAI 62 Query: 61 EAEKISGKIP 70 EA+K +G +P Sbjct: 63 EADKRAGMLP 72 >gi|15964568|ref|NP_384921.1| hypothetical protein SMc00933 [Sinorhizobium meliloti 1021] gi|307309314|ref|ZP_07588977.1| Protein of unknown function DUF2093 [Sinorhizobium meliloti BL225C] gi|307320050|ref|ZP_07599471.1| Protein of unknown function DUF2093 [Sinorhizobium meliloti AK83] gi|15073746|emb|CAC45387.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021] gi|306894265|gb|EFN25030.1| Protein of unknown function DUF2093 [Sinorhizobium meliloti AK83] gi|306900183|gb|EFN30801.1| Protein of unknown function DUF2093 [Sinorhizobium meliloti BL225C] Length = 77 Score = 109 bits (273), Expect = 1e-22, Method: Composition-based stats. Identities = 32/73 (43%), Positives = 50/73 (68%), Gaps = 3/73 (4%) Query: 1 MYNKVDE---NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAE 57 M N+ + EA IRY DG F+++ G++V+CA+TG+ +P+ +L YWSV RQ Y +A Sbjct: 1 MMNRFEGSSSREAKIRYLDGDFQVVLAGSHVICAVTGKPVPVDELRYWSVARQEAYVDAA 60 Query: 58 ASFEAEKISGKIP 70 AS EA++ +G +P Sbjct: 61 ASLEADRRAGVLP 73 >gi|218682548|ref|ZP_03530149.1| hypothetical protein RetlC8_27307 [Rhizobium etli CIAT 894] Length = 76 Score = 108 bits (272), Expect = 2e-22, Method: Composition-based stats. Identities = 35/70 (50%), Positives = 51/70 (72%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 ++ EA IRY DG F+I+ PG+YVVCA+TG+++PL +L YWSV RQ PYA+ ++ Sbjct: 3 LFEGHGNREAKIRYLDGDFQILSPGSYVVCAMTGKQVPLDELRYWSVARQEPYADVISAI 62 Query: 61 EAEKISGKIP 70 EA+K +G +P Sbjct: 63 EADKRAGVLP 72 >gi|260464404|ref|ZP_05812595.1| conserved hypothetical protein [Mesorhizobium opportunistum WSM2075] gi|259029874|gb|EEW31159.1| conserved hypothetical protein [Mesorhizobium opportunistum WSM2075] Length = 77 Score = 108 bits (271), Expect = 2e-22, Method: Composition-based stats. Identities = 34/66 (51%), Positives = 43/66 (65%), Gaps = 3/66 (4%) Query: 1 MYNKV---DENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAE 57 M N+ EA IRY DG F++ PG++V CA+TG+ IPL +L YWSV RQ PYA+A Sbjct: 1 MMNRFEGPGGKEARIRYLDGDFQVTSPGSFVRCAVTGESIPLDELKYWSVARQEPYASAT 60 Query: 58 ASFEAE 63 AS E Sbjct: 61 ASLRRE 66 >gi|298293950|ref|YP_003695889.1| hypothetical protein Snov_4000 [Starkeya novella DSM 506] gi|296930461|gb|ADH91270.1| Protein of unknown function DUF2093 [Starkeya novella DSM 506] Length = 74 Score = 108 bits (271), Expect = 3e-22, Method: Composition-based stats. Identities = 31/55 (56%), Positives = 38/55 (69%) Query: 8 NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEA 62 EA +RY DG F ++RPGT+V CA+TGQ IPL +L YWSVD Q YA+ EA Sbjct: 11 GEAELRYLDGDFRVVRPGTFVRCAVTGQPIPLDELRYWSVDLQEAYASPEAVLAR 65 >gi|71082858|ref|YP_265577.1| hypothetical protein SAR11_0152 [Candidatus Pelagibacter ubique HTCC1062] gi|91762719|ref|ZP_01264684.1| hypothetical protein PU1002_05601 [Candidatus Pelagibacter ubique HTCC1002] gi|71061971|gb|AAZ20974.1| Unknown protein [Candidatus Pelagibacter ubique HTCC1062] gi|91718521|gb|EAS85171.1| hypothetical protein PU1002_05601 [Candidatus Pelagibacter ubique HTCC1002] Length = 62 Score = 108 bits (270), Expect = 4e-22, Method: Composition-based stats. Identities = 21/60 (35%), Positives = 38/60 (63%) Query: 5 VDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEK 64 +++ A ++Y FEII G +VVCA++G+ I L+ L YW+V+ Q PY + + + ++ Sbjct: 1 MNKKLAKLKYLPNNFEIIENGDHVVCAVSGKSISLENLNYWNVELQEPYFSYVEAHKKKE 60 >gi|150395652|ref|YP_001326119.1| hypothetical protein Smed_0427 [Sinorhizobium medicae WSM419] gi|150027167|gb|ABR59284.1| conserved hypothetical protein [Sinorhizobium medicae WSM419] Length = 77 Score = 107 bits (269), Expect = 4e-22, Method: Composition-based stats. Identities = 35/73 (47%), Positives = 50/73 (68%), Gaps = 3/73 (4%) Query: 1 MYNKVDE---NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAE 57 M N+ + EA IRY DG F+++ G++VVCAITG+ +P+ +L YWSV RQ Y +A Sbjct: 1 MMNRFEGSSSREAKIRYLDGDFQVVLAGSHVVCAITGETVPVDELRYWSVARQEAYVDAA 60 Query: 58 ASFEAEKISGKIP 70 AS EAE+ +G +P Sbjct: 61 ASLEAERRTGDLP 73 >gi|158424008|ref|YP_001525300.1| hypothetical protein AZC_2384 [Azorhizobium caulinodans ORS 571] gi|158330897|dbj|BAF88382.1| hypothetical protein [Azorhizobium caulinodans ORS 571] Length = 92 Score = 107 bits (268), Expect = 5e-22, Method: Composition-based stats. Identities = 33/56 (58%), Positives = 40/56 (71%) Query: 7 ENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEA 62 + EA IRY DG F IIRPG+YV CA+TGQ+IPL +L YWSVD Q YA+ +A Sbjct: 23 QGEAEIRYLDGEFRIIRPGSYVRCAVTGQQIPLDELRYWSVDLQEAYADPQAVLTR 78 >gi|188582392|ref|YP_001925837.1| hypothetical protein Mpop_3150 [Methylobacterium populi BJ001] gi|179345890|gb|ACB81302.1| conserved hypothetical protein [Methylobacterium populi BJ001] Length = 74 Score = 107 bits (268), Expect = 5e-22, Method: Composition-based stats. Identities = 31/62 (50%), Positives = 40/62 (64%) Query: 6 DENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKI 65 EA + Y DGT +I+PGTYV CA+TG+ I L L YW+VDRQ YA EA+ + K Sbjct: 10 TNGEAKVEYGDGTMRVIKPGTYVRCAVTGEPIALDALRYWNVDRQEAYATPEAAMQRLKE 69 Query: 66 SG 67 +G Sbjct: 70 TG 71 >gi|154245361|ref|YP_001416319.1| hypothetical protein Xaut_1414 [Xanthobacter autotrophicus Py2] gi|154159446|gb|ABS66662.1| conserved hypothetical protein [Xanthobacter autotrophicus Py2] Length = 74 Score = 107 bits (268), Expect = 5e-22, Method: Composition-based stats. Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 5/70 (7%) Query: 1 MYNKVDE-----NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYAN 55 M N+ + EA +RY DG F I+RPG++V CA+TGQ IPL +L YWSVD Q Y+ Sbjct: 1 MMNRFERFPEPHGEAEVRYLDGEFRILRPGSFVRCAVTGQAIPLDELRYWSVDLQEAYSG 60 Query: 56 AEASFEAEKI 65 EA K Sbjct: 61 PEAVLTRVKE 70 >gi|218516328|ref|ZP_03513168.1| hypothetical protein Retl8_23039 [Rhizobium etli 8C-3] Length = 76 Score = 107 bits (268), Expect = 5e-22, Method: Composition-based stats. Identities = 35/70 (50%), Positives = 49/70 (70%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 ++ EA IRY DG F+I+ PG+YVVC +TG+ IPL +L YWSV RQ PYA+ ++ Sbjct: 3 LFEGHGNREAKIRYLDGDFQIVSPGSYVVCVMTGKHIPLDELRYWSVARQEPYADVISAI 62 Query: 61 EAEKISGKIP 70 EA+K +G +P Sbjct: 63 EADKRAGVLP 72 >gi|163852385|ref|YP_001640428.1| hypothetical protein Mext_2968 [Methylobacterium extorquens PA1] gi|218531144|ref|YP_002421960.1| hypothetical protein Mchl_3194 [Methylobacterium chloromethanicum CM4] gi|240139719|ref|YP_002964196.1| hypothetical protein MexAM1_META1p3172 [Methylobacterium extorquens AM1] gi|254562132|ref|YP_003069227.1| hypothetical protein METDI3737 [Methylobacterium extorquens DM4] gi|18075996|emb|CAD20228.1| hypothetical protein [Methylobacterium chloromethanicum] gi|163663990|gb|ABY31357.1| conserved hypothetical protein [Methylobacterium extorquens PA1] gi|218523447|gb|ACK84032.1| conserved hypothetical protein [Methylobacterium chloromethanicum CM4] gi|240009693|gb|ACS40919.1| conserved hypothetical protein [Methylobacterium extorquens AM1] gi|254269410|emb|CAX25376.1| conserved hypothetical protein [Methylobacterium extorquens DM4] Length = 74 Score = 107 bits (268), Expect = 5e-22, Method: Composition-based stats. Identities = 30/62 (48%), Positives = 40/62 (64%) Query: 6 DENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKI 65 EA + Y DGT +++PGTYV CA+TG+ I L L YW+VDRQ YA EA+ + K Sbjct: 10 TGGEAKVEYGDGTMRVVKPGTYVRCAVTGEPIALDALRYWNVDRQEAYATPEAAMQRLKE 69 Query: 66 SG 67 +G Sbjct: 70 TG 71 >gi|325292084|ref|YP_004277948.1| hypothetical protein AGROH133_04260 [Agrobacterium sp. H13-3] gi|325059937|gb|ADY63628.1| hypothetical protein AGROH133_04260 [Agrobacterium sp. H13-3] Length = 73 Score = 106 bits (266), Expect = 8e-22, Method: Composition-based stats. Identities = 32/69 (46%), Positives = 45/69 (65%) Query: 2 YNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFE 61 + A I Y DG F I++ G++V+CAITG+ IP+ +L YWSV RQ Y +A AS E Sbjct: 4 FEGGGNRIAVIEYLDGDFRIVQTGSHVICAITGKTIPVDELRYWSVARQEAYVDASASLE 63 Query: 62 AEKISGKIP 70 AE+ +G +P Sbjct: 64 AERKAGNLP 72 >gi|319784256|ref|YP_004143732.1| hypothetical protein Mesci_4573 [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317170144|gb|ADV13682.1| Protein of unknown function DUF2093 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 77 Score = 106 bits (265), Expect = 1e-21, Method: Composition-based stats. Identities = 33/66 (50%), Positives = 41/66 (62%), Gaps = 3/66 (4%) Query: 1 MYNKV---DENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAE 57 M N+ EA IRY DG F++ PG +V CA+TG+ IPL +L YWSV RQ PY +A Sbjct: 1 MMNRFEGPGGKEARIRYLDGDFQVTSPGAFVRCAVTGESIPLDELKYWSVARQEPYISAT 60 Query: 58 ASFEAE 63 AS E Sbjct: 61 ASLRRE 66 >gi|163758426|ref|ZP_02165514.1| hypothetical protein HPDFL43_02335 [Hoeflea phototrophica DFL-43] gi|162284715|gb|EDQ34998.1| hypothetical protein HPDFL43_02335 [Hoeflea phototrophica DFL-43] Length = 75 Score = 106 bits (265), Expect = 1e-21, Method: Composition-based stats. Identities = 34/72 (47%), Positives = 49/72 (68%), Gaps = 3/72 (4%) Query: 2 YNKVDE---NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEA 58 N+ + A IRY DG F+I+ PG++VVCA+TG+ IP+++L YWSV RQ PY + A Sbjct: 1 MNRFEGPGARPAKIRYLDGDFQILMPGSHVVCAVTGETIPIEELKYWSVARQEPYVDVTA 60 Query: 59 SFEAEKISGKIP 70 S AE+ +G +P Sbjct: 61 SVTAEQRAGALP 72 >gi|154251077|ref|YP_001411901.1| hypothetical protein Plav_0621 [Parvibaculum lavamentivorans DS-1] gi|154155027|gb|ABS62244.1| conserved hypothetical protein [Parvibaculum lavamentivorans DS-1] Length = 72 Score = 105 bits (264), Expect = 1e-21, Method: Composition-based stats. Identities = 29/61 (47%), Positives = 39/61 (63%) Query: 2 YNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFE 61 +K+ A + Y DG F ++R G YVVCA+TG RIP+ +L YW+VD Q YA EAS + Sbjct: 4 IDKMGGGPAELVYGDGEFHVVRAGAYVVCAVTGARIPVDELRYWNVDLQEAYATPEASLK 63 Query: 62 A 62 Sbjct: 64 R 64 >gi|222085024|ref|YP_002543553.1| hypothetical protein Arad_1093 [Agrobacterium radiobacter K84] gi|221722472|gb|ACM25628.1| conserved hypothetical protein [Agrobacterium radiobacter K84] Length = 76 Score = 105 bits (264), Expect = 2e-21, Method: Composition-based stats. Identities = 36/70 (51%), Positives = 49/70 (70%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 ++ EA +RY DG F+I+ PG+YVVCA+TGQ I L +L YWSV RQ PYA+ +S Sbjct: 3 LFEGHGNREAKVRYLDGDFQILMPGSYVVCAMTGQHIALDELRYWSVARQEPYADVMSSL 62 Query: 61 EAEKISGKIP 70 EA+K +G +P Sbjct: 63 EADKRAGVLP 72 >gi|316932704|ref|YP_004107686.1| hypothetical protein Rpdx1_1330 [Rhodopseudomonas palustris DX-1] gi|315600418|gb|ADU42953.1| Protein of unknown function DUF2093 [Rhodopseudomonas palustris DX-1] Length = 75 Score = 105 bits (263), Expect = 2e-21, Method: Composition-based stats. Identities = 33/66 (50%), Positives = 41/66 (62%), Gaps = 3/66 (4%) Query: 1 MYNKVD---ENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAE 57 M NK EA ++Y DG F +I PGTYV CA+TG +IPL +L YWSVD + PYA E Sbjct: 1 MLNKFGFSGSGEAQVQYLDGDFRVISPGTYVRCAVTGVQIPLDELKYWSVDLKEPYATPE 60 Query: 58 ASFEAE 63 A + Sbjct: 61 AVLKRH 66 >gi|326386126|ref|ZP_08207750.1| hypothetical protein Y88_2018 [Novosphingobium nitrogenifigens DSM 19370] gi|326209351|gb|EGD60144.1| hypothetical protein Y88_2018 [Novosphingobium nitrogenifigens DSM 19370] Length = 67 Score = 105 bits (263), Expect = 2e-21, Method: Composition-based stats. Identities = 27/62 (43%), Positives = 36/62 (58%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 M A + Y GTF + PG +V+CA+TG +IPL L YWS +RQ YA+AE S Sbjct: 1 MLTTPAGRLARLHYLPGTFRQLSPGDHVLCAVTGAKIPLDLLRYWSAERQEAYASAEIST 60 Query: 61 EA 62 + Sbjct: 61 KR 62 >gi|13476834|ref|NP_108403.1| hypothetical protein msl8272 [Mesorhizobium loti MAFF303099] gi|14027595|dbj|BAB53864.1| msl8272 [Mesorhizobium loti MAFF303099] Length = 77 Score = 105 bits (262), Expect = 2e-21, Method: Composition-based stats. Identities = 34/66 (51%), Positives = 42/66 (63%), Gaps = 3/66 (4%) Query: 1 MYNKV---DENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAE 57 M N+ EA IRY DG F++ PG++V CA+TG+ IPL +L YWSV RQ PY NA Sbjct: 1 MMNRFEGPGGKEARIRYLDGDFQVTSPGSFVRCAVTGENIPLDELKYWSVARQEPYVNAT 60 Query: 58 ASFEAE 63 AS E Sbjct: 61 ASLRRE 66 >gi|23009719|ref|ZP_00050664.1| hypothetical protein Magn03004578 [Magnetospirillum magnetotacticum MS-1] Length = 74 Score = 105 bits (262), Expect = 3e-21, Method: Composition-based stats. Identities = 29/61 (47%), Positives = 38/61 (62%) Query: 6 DENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKI 65 EA + Y DGT +I+PGT+V CA+TG+ I L L YW+VDRQ YA EA+ + K Sbjct: 10 TGGEAKVEYGDGTMRVIKPGTFVRCAVTGEPIALDALRYWNVDRQEAYATPEAAMQRLKE 69 Query: 66 S 66 Sbjct: 70 L 70 >gi|170747320|ref|YP_001753580.1| hypothetical protein Mrad2831_0887 [Methylobacterium radiotolerans JCM 2831] gi|170653842|gb|ACB22897.1| conserved hypothetical protein [Methylobacterium radiotolerans JCM 2831] Length = 72 Score = 104 bits (260), Expect = 5e-21, Method: Composition-based stats. Identities = 28/67 (41%), Positives = 42/67 (62%) Query: 2 YNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFE 61 Y + + EA + Y DGT +++PG++V CA+TG+ IPL L YWS RQ Y + EA + Sbjct: 5 YERANNGEAVVEYGDGTMRVVKPGSFVRCAVTGEPIPLDALRYWSAARQEAYVSPEAILK 64 Query: 62 AEKISGK 68 K +G+ Sbjct: 65 RLKETGR 71 >gi|27382621|ref|NP_774150.1| hypothetical protein bsr7510 [Bradyrhizobium japonicum USDA 110] gi|27355793|dbj|BAC52775.1| bsr7510 [Bradyrhizobium japonicum USDA 110] Length = 75 Score = 103 bits (259), Expect = 5e-21, Method: Composition-based stats. Identities = 33/66 (50%), Positives = 38/66 (57%), Gaps = 3/66 (4%) Query: 1 MYNKVD---ENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAE 57 M NK EA ++Y DG F +I PGTYV CAIT RIPL +L YWSVD Q YA Sbjct: 1 MLNKFGSSGNGEAQVQYLDGDFRVISPGTYVRCAITDTRIPLDELKYWSVDLQEAYATPA 60 Query: 58 ASFEAE 63 A + Sbjct: 61 AVLQRH 66 >gi|103488582|ref|YP_618143.1| hypothetical protein Sala_3106 [Sphingopyxis alaskensis RB2256] gi|98978659|gb|ABF54810.1| conserved hypothetical protein [Sphingopyxis alaskensis RB2256] Length = 70 Score = 103 bits (259), Expect = 5e-21, Method: Composition-based stats. Identities = 26/63 (41%), Positives = 35/63 (55%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 M A + Y F ++ PG +V+CA+TG I L +L YWSV RQ YA+A S Sbjct: 1 MLIASRNRLARLHYGPNGFRVLAPGDHVLCAVTGVPIGLDELRYWSVARQEAYASAAISV 60 Query: 61 EAE 63 +AE Sbjct: 61 QAE 63 >gi|149185201|ref|ZP_01863518.1| hypothetical protein ED21_19147 [Erythrobacter sp. SD-21] gi|148831312|gb|EDL49746.1| hypothetical protein ED21_19147 [Erythrobacter sp. SD-21] Length = 69 Score = 103 bits (259), Expect = 6e-21, Method: Composition-based stats. Identities = 27/67 (40%), Positives = 38/67 (56%), Gaps = 3/67 (4%) Query: 1 MYNKVDE---NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAE 57 + NK EA + Y F ++R G +V CA +G IPL++L YWSV+ Q YA+AE Sbjct: 2 LMNKNAGPPPGEAKLHYGPNGFRVLRTGNHVFCAASGVPIPLEELRYWSVEHQEAYASAE 61 Query: 58 ASFEAEK 64 + E K Sbjct: 62 LATERLK 68 >gi|192289761|ref|YP_001990366.1| hypothetical protein Rpal_1351 [Rhodopseudomonas palustris TIE-1] gi|192283510|gb|ACE99890.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1] Length = 75 Score = 103 bits (259), Expect = 7e-21, Method: Composition-based stats. Identities = 33/66 (50%), Positives = 41/66 (62%), Gaps = 3/66 (4%) Query: 1 MYNKVD---ENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAE 57 M NK EA ++Y DG F +I PGTYV CA+TG +IPL +L YWSVD + PYA E Sbjct: 1 MLNKFGFSGSGEAQVQYLDGDFRVISPGTYVRCAVTGVQIPLDELKYWSVDLKEPYATPE 60 Query: 58 ASFEAE 63 A + Sbjct: 61 AVLKRH 66 >gi|220927303|ref|YP_002502605.1| hypothetical protein Mnod_7566 [Methylobacterium nodulans ORS 2060] gi|219951910|gb|ACL62302.1| conserved hypothetical protein [Methylobacterium nodulans ORS 2060] Length = 72 Score = 103 bits (258), Expect = 9e-21, Method: Composition-based stats. Identities = 26/67 (38%), Positives = 39/67 (58%) Query: 2 YNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFE 61 + + EA + Y D ++RPG +V CA+TG IPL L YWSV RQ YA+ +A + Sbjct: 5 FERGGSGEAVVEYGDSNLRVVRPGRFVRCAVTGVEIPLDDLRYWSVARQEAYASPDAVMQ 64 Query: 62 AEKISGK 68 + +G+ Sbjct: 65 RLRETGR 71 >gi|39934235|ref|NP_946511.1| hypothetical protein RPA1160 [Rhodopseudomonas palustris CGA009] gi|39648083|emb|CAE26603.1| conserved unknown protein [Rhodopseudomonas palustris CGA009] Length = 111 Score = 103 bits (257), Expect = 9e-21, Method: Composition-based stats. Identities = 30/58 (51%), Positives = 38/58 (65%) Query: 6 DENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAE 63 EA ++Y DG F +I PGTYV CA+TG +IPL +L YWSVD + PYA EA + Sbjct: 45 GSGEAQVQYLDGDFRVISPGTYVRCAVTGVQIPLDELKYWSVDLKEPYATPEAVLKRH 102 >gi|92118642|ref|YP_578371.1| hypothetical protein Nham_3176 [Nitrobacter hamburgensis X14] gi|91801536|gb|ABE63911.1| conserved hypothetical protein [Nitrobacter hamburgensis X14] Length = 75 Score = 103 bits (257), Expect = 9e-21, Method: Composition-based stats. Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 3/66 (4%) Query: 1 MYNKVDE---NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAE 57 M NK + EA ++Y DG F +I PGTYV CA+T RIPL +L YWSVD Q YA Sbjct: 1 MLNKFGQSGQGEARVQYLDGDFRVISPGTYVRCAVTDARIPLDELKYWSVDLQEAYALPS 60 Query: 58 ASFEAE 63 A + Sbjct: 61 AVLQRH 66 >gi|296282928|ref|ZP_06860926.1| hypothetical protein CbatJ_04878 [Citromicrobium bathyomarinum JL354] Length = 67 Score = 103 bits (257), Expect = 1e-20, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 32/62 (51%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 M + A + Y +F +IR G +V CA+TG+ IPL L YWS + Q YA E + Sbjct: 1 MLTTSSDQPAKLHYGPNSFRVIRNGRFVPCAVTGEPIPLDTLRYWSAEHQEAYATCEIAT 60 Query: 61 EA 62 Sbjct: 61 RR 62 >gi|110632801|ref|YP_673009.1| hypothetical protein Meso_0440 [Mesorhizobium sp. BNC1] gi|110283785|gb|ABG61844.1| conserved hypothetical protein [Chelativorans sp. BNC1] Length = 75 Score = 103 bits (257), Expect = 1e-20, Method: Composition-based stats. Identities = 33/56 (58%), Positives = 42/56 (75%) Query: 8 NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAE 63 EA IRY DG F+++ PG +V CA+TG+ IPL++L YWSV RQ PY NAE SF+ E Sbjct: 10 REARIRYLDGDFQVLTPGAFVRCAVTGEPIPLEELKYWSVARQEPYLNAEISFQRE 65 >gi|86748980|ref|YP_485476.1| hypothetical protein RPB_1857 [Rhodopseudomonas palustris HaA2] gi|86572008|gb|ABD06565.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2] Length = 75 Score = 103 bits (257), Expect = 1e-20, Method: Composition-based stats. Identities = 31/66 (46%), Positives = 39/66 (59%), Gaps = 3/66 (4%) Query: 1 MYNKVDE---NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAE 57 M NK EA ++Y DG F +I PGTYV CA+TG +IPL +L YWSVD + YA Sbjct: 1 MLNKFGPSGSGEAQVQYLDGDFRVISPGTYVRCAVTGVQIPLDELKYWSVDLKEAYATPI 60 Query: 58 ASFEAE 63 A + Sbjct: 61 AVLQRH 66 >gi|170744854|ref|YP_001773509.1| hypothetical protein M446_6830 [Methylobacterium sp. 4-46] gi|168199128|gb|ACA21075.1| conserved hypothetical protein [Methylobacterium sp. 4-46] Length = 72 Score = 103 bits (257), Expect = 1e-20, Method: Composition-based stats. Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 3/71 (4%) Query: 1 MYNKVDEN---EASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAE 57 M ++D EA + Y D ++RPG +V CA+TG I L L YWSV RQ YA E Sbjct: 1 MLGRMDRGGTGEAVVEYGDSNLRVVRPGRFVRCAVTGAEIALDDLRYWSVARQEAYAGPE 60 Query: 58 ASFEAEKISGK 68 A + + +G+ Sbjct: 61 AVMQRLRETGR 71 >gi|299134216|ref|ZP_07027409.1| Protein of unknown function DUF2093 [Afipia sp. 1NLS2] gi|298590963|gb|EFI51165.1| Protein of unknown function DUF2093 [Afipia sp. 1NLS2] Length = 86 Score = 102 bits (256), Expect = 1e-20, Method: Composition-based stats. Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 3/65 (4%) Query: 1 MYNKVD---ENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAE 57 + NK EA + Y DG F I+ PG YVVCA+TG+ IPL++L WSVDRQ YA + Sbjct: 12 LLNKFGPSGRGEAKVEYLDGDFRILSPGAYVVCAVTGEHIPLEELSLWSVDRQEAYATPQ 71 Query: 58 ASFEA 62 A+ E Sbjct: 72 AAMER 76 >gi|222147679|ref|YP_002548636.1| hypothetical protein Avi_0896 [Agrobacterium vitis S4] gi|221734667|gb|ACM35630.1| conserved hypothetical protein [Agrobacterium vitis S4] Length = 76 Score = 102 bits (256), Expect = 1e-20, Method: Composition-based stats. Identities = 35/69 (50%), Positives = 47/69 (68%) Query: 2 YNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFE 61 + EA+++Y D F+I PG+YVVCAITG+ I + +L YWSVDRQ Y +A AS E Sbjct: 4 FESRGNREATVKYLDADFQITFPGSYVVCAITGRPITIDELKYWSVDRQEAYVDAAASLE 63 Query: 62 AEKISGKIP 70 AEK +G +P Sbjct: 64 AEKRAGNLP 72 >gi|304321663|ref|YP_003855306.1| hypothetical protein PB2503_10564 [Parvularcula bermudensis HTCC2503] gi|303300565|gb|ADM10164.1| hypothetical protein PB2503_10564 [Parvularcula bermudensis HTCC2503] Length = 75 Score = 102 bits (256), Expect = 1e-20, Method: Composition-based stats. Identities = 29/66 (43%), Positives = 44/66 (66%), Gaps = 2/66 (3%) Query: 8 NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEA--EKI 65 A +++ DG FEI+ PG +V+CA+T ++IPL L YWSVDRQ Y +A A+ +A E + Sbjct: 10 GAARLKFLDGDFEIVVPGAFVLCAVTQKQIPLDDLRYWSVDRQEAYFDAAAANQAYLEAL 69 Query: 66 SGKIPY 71 + P+ Sbjct: 70 AKGEPF 75 >gi|114705766|ref|ZP_01438669.1| hypothetical protein FP2506_14909 [Fulvimarina pelagi HTCC2506] gi|114538612|gb|EAU41733.1| hypothetical protein FP2506_14909 [Fulvimarina pelagi HTCC2506] Length = 67 Score = 102 bits (255), Expect = 2e-20, Method: Composition-based stats. Identities = 30/61 (49%), Positives = 41/61 (67%) Query: 5 VDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEK 64 +D EA ++Y F+++R G YV CA+TG+ IPL L YWSV+RQ Y +A+A FE EK Sbjct: 1 MDGGEAKLKYGTPDFQVVRSGAYVRCAVTGEPIPLDLLKYWSVERQEAYRDADAVFEREK 60 Query: 65 I 65 Sbjct: 61 Q 61 >gi|307296251|ref|ZP_07576078.1| Protein of unknown function DUF2093 [Sphingobium chlorophenolicum L-1] gi|306878053|gb|EFN09276.1| Protein of unknown function DUF2093 [Sphingobium chlorophenolicum L-1] Length = 69 Score = 102 bits (255), Expect = 2e-20, Method: Composition-based stats. Identities = 27/63 (42%), Positives = 41/63 (65%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 M + A + Y +F +++ G +VVCA++G++IPL L YWS+ RQ PYA+AE S Sbjct: 1 MLMSNRDRPARLHYMAYSFRVLQTGDHVVCAVSGRKIPLDDLRYWSIARQEPYASAEISA 60 Query: 61 EAE 63 +AE Sbjct: 61 QAE 63 >gi|148253223|ref|YP_001237808.1| hypothetical protein BBta_1693 [Bradyrhizobium sp. BTAi1] gi|146405396|gb|ABQ33902.1| hypothetical protein BBta_1693 [Bradyrhizobium sp. BTAi1] Length = 75 Score = 102 bits (254), Expect = 2e-20, Method: Composition-based stats. Identities = 31/66 (46%), Positives = 39/66 (59%), Gaps = 3/66 (4%) Query: 1 MYNKVD---ENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAE 57 M NK + EA ++Y DG F +I PG+YV CA+T RIPL +L YWSVD Q YA Sbjct: 1 MLNKFGPSGQGEAQVQYLDGDFRVISPGSYVRCAVTDARIPLDELKYWSVDLQEAYALPS 60 Query: 58 ASFEAE 63 A + Sbjct: 61 AVLQRH 66 >gi|85375368|ref|YP_459430.1| hypothetical protein ELI_12705 [Erythrobacter litoralis HTCC2594] gi|84788451|gb|ABC64633.1| hypothetical protein ELI_12705 [Erythrobacter litoralis HTCC2594] Length = 67 Score = 102 bits (254), Expect = 3e-20, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 34/62 (54%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 M A + Y F ++R G +V CA++G+ IPL+ L YWSV Q YA+AE + Sbjct: 1 MLMSSRNEPARLEYGPNGFRVLRTGRFVHCAVSGEEIPLEDLRYWSVHYQEAYASAELAT 60 Query: 61 EA 62 + Sbjct: 61 QR 62 >gi|115522907|ref|YP_779818.1| hypothetical protein RPE_0882 [Rhodopseudomonas palustris BisA53] gi|115516854|gb|ABJ04838.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53] Length = 73 Score = 101 bits (253), Expect = 3e-20, Method: Composition-based stats. Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 3/66 (4%) Query: 1 MYNKVDE---NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAE 57 M NK EA ++Y DG F + PGTYV CA+TG +IPL +L YWSVD + YA+ Sbjct: 1 MLNKFGPSGLGEAQVQYLDGDFRVTSPGTYVKCAVTGVQIPLDELKYWSVDLKEAYASPT 60 Query: 58 ASFEAE 63 A + Sbjct: 61 AVLQRH 66 >gi|209886362|ref|YP_002290219.1| hypothetical protein OCAR_7250 [Oligotropha carboxidovorans OM5] gi|209874558|gb|ACI94354.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5] Length = 75 Score = 101 bits (253), Expect = 3e-20, Method: Composition-based stats. Identities = 33/65 (50%), Positives = 42/65 (64%), Gaps = 3/65 (4%) Query: 1 MYNKVD---ENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAE 57 M NK+ EA + Y DG F II PG YV+CA+TG+RIPL++L WSVDRQ YA + Sbjct: 1 MLNKLGLSGHGEAKVEYLDGDFRIISPGAYVLCAVTGERIPLEQLSLWSVDRQEAYATPQ 60 Query: 58 ASFEA 62 + E Sbjct: 61 IALER 65 >gi|197106406|ref|YP_002131783.1| hypothetical protein PHZ_c2945 [Phenylobacterium zucineum HLK1] gi|196479826|gb|ACG79354.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1] Length = 74 Score = 101 bits (253), Expect = 3e-20, Method: Composition-based stats. Identities = 24/57 (42%), Positives = 38/57 (66%) Query: 10 ASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKIS 66 A + Y DG F +++PG YVVCA+TGQ++PL++L YWS + Q YA + + + + Sbjct: 14 AKLHYGDGDFAVLKPGRYVVCAVTGQKVPLEQLRYWSAELQEAYAGPGEALKRWRET 70 >gi|90426174|ref|YP_534544.1| hypothetical protein RPC_4703 [Rhodopseudomonas palustris BisB18] gi|90108188|gb|ABD90225.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18] Length = 73 Score = 101 bits (253), Expect = 3e-20, Method: Composition-based stats. Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 3/66 (4%) Query: 1 MYNKVDE---NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAE 57 M NK EA ++Y DG F + PGTYV CA+TG +IPL +L YWSVD + YA+ Sbjct: 1 MLNKFGPSGLGEAQVQYLDGDFRVTSPGTYVKCAVTGVQIPLDELKYWSVDLKEAYASPA 60 Query: 58 ASFEAE 63 A + Sbjct: 61 AVLQRH 66 >gi|332185594|ref|ZP_08387342.1| hypothetical protein SUS17_740 [Sphingomonas sp. S17] gi|332014572|gb|EGI56629.1| hypothetical protein SUS17_740 [Sphingomonas sp. S17] Length = 66 Score = 101 bits (253), Expect = 3e-20, Method: Composition-based stats. Identities = 26/61 (42%), Positives = 37/61 (60%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 M + A + Y F ++ PG +VVCA+TG+RIPL+ L YWS RQ YA+A A+ Sbjct: 1 MLMSNTDRPARLHYLANGFRVLSPGDHVVCAVTGRRIPLEDLKYWSAARQEAYADAHATA 60 Query: 61 E 61 + Sbjct: 61 Q 61 >gi|91978568|ref|YP_571227.1| hypothetical protein RPD_4107 [Rhodopseudomonas palustris BisB5] gi|91685024|gb|ABE41326.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5] Length = 75 Score = 101 bits (253), Expect = 3e-20, Method: Composition-based stats. Identities = 31/66 (46%), Positives = 39/66 (59%), Gaps = 3/66 (4%) Query: 1 MYNKVDE---NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAE 57 M NK EA ++Y DG F +I PGTYV CA+TG +IPL +L YWSVD + YA Sbjct: 1 MLNKFSPSGSGEAQVQYLDGDFRVISPGTYVRCAVTGVQIPLDELKYWSVDLKEAYATPI 60 Query: 58 ASFEAE 63 A + Sbjct: 61 AVLQRH 66 >gi|294013431|ref|YP_003546891.1| hypothetical protein SJA_C1-34450 [Sphingobium japonicum UT26S] gi|292676761|dbj|BAI98279.1| conserved hypothetical protein [Sphingobium japonicum UT26S] Length = 69 Score = 101 bits (252), Expect = 4e-20, Method: Composition-based stats. Identities = 26/63 (41%), Positives = 42/63 (66%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 M + A + Y +F +++ G +V+CA++G++IPL+ L YWS+ RQ PYA+AE S Sbjct: 1 MLMSNRDRPARLHYMAYSFRVLQAGDHVLCAVSGRKIPLEDLRYWSIARQEPYASAEISA 60 Query: 61 EAE 63 +AE Sbjct: 61 QAE 63 >gi|87198196|ref|YP_495453.1| hypothetical protein Saro_0170 [Novosphingobium aromaticivorans DSM 12444] gi|87133877|gb|ABD24619.1| conserved hypothetical protein [Novosphingobium aromaticivorans DSM 12444] Length = 67 Score = 100 bits (250), Expect = 7e-20, Method: Composition-based stats. Identities = 25/67 (37%), Positives = 31/67 (46%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 M A + Y G F + G +VVCA++GQ IPL L YW +RQ YA AE S Sbjct: 1 MLMSQSGRLARLHYLSGGFRQLSAGDHVVCAVSGQTIPLDMLRYWCAERQEAYATAEISV 60 Query: 61 EAEKISG 67 Sbjct: 61 RRHLEGK 67 >gi|94496132|ref|ZP_01302710.1| hypothetical protein SKA58_03440 [Sphingomonas sp. SKA58] gi|94424311|gb|EAT09334.1| hypothetical protein SKA58_03440 [Sphingomonas sp. SKA58] Length = 70 Score = 100 bits (250), Expect = 7e-20, Method: Composition-based stats. Identities = 28/66 (42%), Positives = 43/66 (65%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 M + A + Y +F +++ G +V+CA+TGQ I L+ L YWS+ RQ PYA+A+AS Sbjct: 1 MLMSSRDRIARLHYLPYSFRVLKAGDHVLCAMTGQPIALQDLRYWSIARQEPYASAQASV 60 Query: 61 EAEKIS 66 EAE+ + Sbjct: 61 EAEQKA 66 >gi|254293366|ref|YP_003059389.1| hypothetical protein Hbal_0998 [Hirschia baltica ATCC 49814] gi|254041897|gb|ACT58692.1| conserved hypothetical protein [Hirschia baltica ATCC 49814] Length = 70 Score = 100 bits (249), Expect = 8e-20, Method: Composition-based stats. Identities = 29/65 (44%), Positives = 41/65 (63%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 M EA I+Y D FEI++ G +V+CA+T ++I L+ L YWSVD Q PY +AEA+ Sbjct: 1 MLPSGLPGEAKIKYLDADFEILKMGKFVICAVTNEQILLEDLKYWSVDLQEPYVDAEAAV 60 Query: 61 EAEKI 65 + K Sbjct: 61 KRWKE 65 >gi|182677909|ref|YP_001832055.1| hypothetical protein Bind_0917 [Beijerinckia indica subsp. indica ATCC 9039] gi|182633792|gb|ACB94566.1| conserved hypothetical protein [Beijerinckia indica subsp. indica ATCC 9039] Length = 73 Score = 100 bits (249), Expect = 8e-20, Method: Composition-based stats. Identities = 28/61 (45%), Positives = 37/61 (60%) Query: 8 NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISG 67 EA ++Y DG IIRPG +V CA+TG I L+ L YW+VD Q YA+ EA + + Sbjct: 12 GEAEVQYLDGDLRIIRPGAFVRCAVTGVSIALEDLRYWNVDLQEAYASPEAKLQRLQPLS 71 Query: 68 K 68 K Sbjct: 72 K 72 >gi|254456173|ref|ZP_05069602.1| conserved hypothetical protein [Candidatus Pelagibacter sp. HTCC7211] gi|207083175|gb|EDZ60601.1| conserved hypothetical protein [Candidatus Pelagibacter sp. HTCC7211] Length = 62 Score = 100 bits (249), Expect = 8e-20, Method: Composition-based stats. Identities = 24/62 (38%), Positives = 39/62 (62%), Gaps = 1/62 (1%) Query: 5 VDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANA-EASFEAE 63 + A +++ FEI+ G +V+CAI+ ++IPL+ L YWSV++Q Y + EA+ E E Sbjct: 1 MINKLAKLKFLPNNFEIVENGDHVICAISKKKIPLENLNYWSVEKQEAYYSYVEAAIERE 60 Query: 64 KI 65 K Sbjct: 61 KK 62 >gi|329888468|ref|ZP_08267066.1| hypothetical protein BDIM_03910 [Brevundimonas diminuta ATCC 11568] gi|328847024|gb|EGF96586.1| hypothetical protein BDIM_03910 [Brevundimonas diminuta ATCC 11568] Length = 69 Score = 99.7 bits (248), Expect = 1e-19, Method: Composition-based stats. Identities = 24/62 (38%), Positives = 35/62 (56%) Query: 7 ENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKIS 66 EA + Y FEI++ G +V CA++G IPL+ L YWSV+ Q YA+ E + + Sbjct: 8 RTEAKLIYGTPEFEIVQHGDHVRCAVSGAPIPLEALNYWSVELQEAYASGELMTQRWVET 67 Query: 67 GK 68 K Sbjct: 68 HK 69 >gi|114797746|ref|YP_761422.1| hypothetical protein HNE_2743 [Hyphomonas neptunium ATCC 15444] gi|114737920|gb|ABI76045.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444] Length = 83 Score = 99.3 bits (247), Expect = 1e-19, Method: Composition-based stats. Identities = 27/57 (47%), Positives = 37/57 (64%) Query: 6 DENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEA 62 D EA + Y D FE + G+YV CA+TG++IPL + YWSVD Q Y +AEA+ + Sbjct: 22 DGGEARLIYGDNDFEQVSAGSYVTCAVTGRKIPLGAVRYWSVDLQEAYWDAEAASQR 78 >gi|75676738|ref|YP_319159.1| hypothetical protein Nwi_2554 [Nitrobacter winogradskyi Nb-255] gi|74421608|gb|ABA05807.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255] Length = 119 Score = 99.3 bits (247), Expect = 1e-19, Method: Composition-based stats. Identities = 30/62 (48%), Positives = 38/62 (61%) Query: 2 YNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFE 61 + + + EAS +Y DG F +I PGTYV CA+T RIPL +L YWSVD Q YA A + Sbjct: 49 FRQSGQGEASAQYLDGDFRVISPGTYVRCAVTDARIPLDELKYWSVDLQEAYALPSAVLQ 108 Query: 62 AE 63 Sbjct: 109 RH 110 >gi|296444343|ref|ZP_06886308.1| Protein of unknown function DUF2093 [Methylosinus trichosporium OB3b] gi|296257990|gb|EFH05052.1| Protein of unknown function DUF2093 [Methylosinus trichosporium OB3b] Length = 73 Score = 99.3 bits (247), Expect = 1e-19, Method: Composition-based stats. Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 2/63 (3%) Query: 8 NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISG 67 EA + Y DG F + R G +V CA+TG+ IPL++L YW+VD Q PY++ +A I Sbjct: 12 GEAEVEYGDGEFRVRRAGAFVRCAVTGEPIPLEELRYWNVDLQEPYSSPQAKLTR--IGV 69 Query: 68 KIP 70 K+P Sbjct: 70 KLP 72 >gi|300024095|ref|YP_003756706.1| hypothetical protein Hden_2589 [Hyphomicrobium denitrificans ATCC 51888] gi|299525916|gb|ADJ24385.1| Protein of unknown function DUF2093 [Hyphomicrobium denitrificans ATCC 51888] Length = 78 Score = 99.3 bits (247), Expect = 2e-19, Method: Composition-based stats. Identities = 31/61 (50%), Positives = 38/61 (62%) Query: 7 ENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKIS 66 NEA +RY DG FE++ PG +V CA+TGQ I L L YWSVD Q YA+AE S + Sbjct: 11 RNEAKLRYLDGEFEVLTPGEFVRCAVTGQPISLANLRYWSVDAQEAYASAEISVKRYLEL 70 Query: 67 G 67 Sbjct: 71 K 71 >gi|146342913|ref|YP_001207961.1| hypothetical protein BRADO6094 [Bradyrhizobium sp. ORS278] gi|146195719|emb|CAL79746.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278] Length = 80 Score = 99.3 bits (247), Expect = 2e-19, Method: Composition-based stats. Identities = 28/58 (48%), Positives = 36/58 (62%) Query: 6 DENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAE 63 + EA ++Y DG F +I PG+YV CA+T RIPL +L YWSVD Q YA A + Sbjct: 14 GQGEAQVQYLDGDFRVISPGSYVRCAVTDARIPLDELKYWSVDLQEAYALPSAVLQRH 71 >gi|148556051|ref|YP_001263633.1| hypothetical protein Swit_3147 [Sphingomonas wittichii RW1] gi|148501241|gb|ABQ69495.1| Uncharacterized protein [Sphingomonas wittichii RW1] Length = 65 Score = 99.0 bits (246), Expect = 2e-19, Method: Composition-based stats. Identities = 23/60 (38%), Positives = 35/60 (58%) Query: 7 ENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKIS 66 A + Y F ++ G +VVCA++G IPL +L YWSV RQ Y +A + +AE+ + Sbjct: 6 GRRARLNYLANGFRVLVAGDHVVCAVSGAAIPLDELRYWSVARQEAYLSAVEATKAEQQA 65 >gi|148557872|ref|YP_001257265.1| hypothetical protein BOV_A0197 [Brucella ovis ATCC 25840] gi|225628679|ref|ZP_03786713.1| Hypothetical protein, conserved [Brucella ceti str. Cudo] gi|237816723|ref|ZP_04595715.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] gi|294853232|ref|ZP_06793904.1| hypothetical protein BAZG_02180 [Brucella sp. NVSL 07-0026] gi|148369157|gb|ABQ62029.1| conserved hypothetical protein [Brucella ovis ATCC 25840] gi|225616525|gb|EEH13573.1| Hypothetical protein, conserved [Brucella ceti str. Cudo] gi|237787536|gb|EEP61752.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] gi|294818887|gb|EFG35887.1| hypothetical protein BAZG_02180 [Brucella sp. NVSL 07-0026] Length = 105 Score = 98.6 bits (245), Expect = 3e-19, Method: Composition-based stats. Identities = 31/59 (52%), Positives = 40/59 (67%) Query: 9 EASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISG 67 EA +RY DG +EI++ G++V CA+TG IPL +L YWSV RQ PYA+ SFE E Sbjct: 38 EAVLRYLDGDYEIVKHGSFVSCAVTGAPIPLDELKYWSVARQEPYASGLISFERELEMN 96 >gi|315122188|ref|YP_004062677.1| hypothetical protein CKC_02190 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495590|gb|ADR52189.1| hypothetical protein CKC_02190 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 73 Score = 98.2 bits (244), Expect = 3e-19, Method: Composition-based stats. Identities = 51/71 (71%), Positives = 65/71 (91%), Gaps = 2/71 (2%) Query: 1 MYNKV--DENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEA 58 MYNK+ +ENEA I+YKDGTF++IRPGTYV+CAITGQRIPL+KLCYW+VDRQVPYA++++ Sbjct: 1 MYNKIDSNENEAVIQYKDGTFKVIRPGTYVICAITGQRIPLQKLCYWNVDRQVPYADSKS 60 Query: 59 SFEAEKISGKI 69 S EAE+ +G I Sbjct: 61 SLEAERRAGTI 71 >gi|85709868|ref|ZP_01040933.1| hypothetical protein NAP1_13323 [Erythrobacter sp. NAP1] gi|85688578|gb|EAQ28582.1| hypothetical protein NAP1_13323 [Erythrobacter sp. NAP1] Length = 67 Score = 97.8 bits (243), Expect = 4e-19, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 37/62 (59%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 M E A + Y +F ++RPG +V+CA++ + IPL++L YWS + Q YA+AE + Sbjct: 1 MLMSSSEKAAKLYYGASSFRVLRPGQHVICAVSAEVIPLEELRYWSAEHQEAYASAEIAT 60 Query: 61 EA 62 Sbjct: 61 RR 62 >gi|83859481|ref|ZP_00953002.1| hypothetical protein OA2633_13790 [Oceanicaulis alexandrii HTCC2633] gi|83852928|gb|EAP90781.1| hypothetical protein OA2633_13790 [Oceanicaulis alexandrii HTCC2633] Length = 86 Score = 97.8 bits (243), Expect = 4e-19, Method: Composition-based stats. Identities = 23/64 (35%), Positives = 39/64 (60%) Query: 2 YNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFE 61 +++ EA++ + D F I++PG YV CA+TG++I L L YWS + Q Y +A A+ + Sbjct: 9 FDRDFAGEATLEFGDADFMILKPGAYVKCAVTGEKITLNNLRYWSAELQEAYLDASAATQ 68 Query: 62 AEKI 65 + Sbjct: 69 RWRE 72 >gi|302383334|ref|YP_003819157.1| hypothetical protein Bresu_2224 [Brevundimonas subvibrioides ATCC 15264] gi|302193962|gb|ADL01534.1| Protein of unknown function DUF2093 [Brevundimonas subvibrioides ATCC 15264] Length = 64 Score = 97.4 bits (242), Expect = 6e-19, Method: Composition-based stats. Identities = 21/54 (38%), Positives = 35/54 (64%) Query: 10 ASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAE 63 A++ Y DG F +++PG +V+CA++G+ IPL+ L YWS +RQ Y + + Sbjct: 8 ATLHYGDGEFAVLKPGPFVLCAVSGRAIPLETLRYWSAERQEAYFSPAEALSRF 61 >gi|328545021|ref|YP_004305130.1| hypothetical protein SL003B_3404 [polymorphum gilvum SL003B-26A1] gi|326414763|gb|ADZ71826.1| hypothetical protein SL003B_3404 [Polymorphum gilvum SL003B-26A1] Length = 75 Score = 97.4 bits (242), Expect = 6e-19, Method: Composition-based stats. Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 4/69 (5%) Query: 1 MYNKVDE----NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANA 56 M N+ + EA IRY DG + I PGT+V CA+TGQ IPL +L YWSV+RQ Y +A Sbjct: 1 MMNRYENPRIPGEARIRYLDGDYHIEAPGTFVRCAVTGQVIPLDELKYWSVERQEAYVDA 60 Query: 57 EASFEAEKI 65 A+ + + Sbjct: 61 AAALKRYQE 69 >gi|307941673|ref|ZP_07657028.1| conserved hypothetical protein [Roseibium sp. TrichSKD4] gi|307775281|gb|EFO34487.1| conserved hypothetical protein [Roseibium sp. TrichSKD4] Length = 73 Score = 96.7 bits (240), Expect = 8e-19, Method: Composition-based stats. Identities = 31/71 (43%), Positives = 45/71 (63%), Gaps = 4/71 (5%) Query: 2 YNKVDE----NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAE 57 N+ ++ NEA IRY DG +++ PGT+V CA+T IPL +L YWSV+ Q PY +A Sbjct: 1 MNRFEKPGMPNEARIRYLDGDYQVETPGTFVRCAVTDTVIPLDELKYWSVELQEPYIDAH 60 Query: 58 ASFEAEKISGK 68 AS + + + K Sbjct: 61 ASLKRFQETQK 71 >gi|217976271|ref|YP_002360418.1| hypothetical protein Msil_0073 [Methylocella silvestris BL2] gi|217501647|gb|ACK49056.1| conserved hypothetical protein [Methylocella silvestris BL2] Length = 73 Score = 96.7 bits (240), Expect = 1e-18, Method: Composition-based stats. Identities = 29/61 (47%), Positives = 39/61 (63%) Query: 8 NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISG 67 EA + Y DG F I+RPG +V CA TG I +++L YW+VD Q PYA+ EA K++ Sbjct: 12 GEAEVEYLDGEFRILRPGAFVRCAATGAAIRIEELRYWNVDLQEPYASPEAKLLRLKMAA 71 Query: 68 K 68 K Sbjct: 72 K 72 >gi|221235266|ref|YP_002517703.1| hypothetical protein CCNA_02330 [Caulobacter crescentus NA1000] gi|220964439|gb|ACL95795.1| hypothetical protein CCNA_02330 [Caulobacter crescentus NA1000] Length = 71 Score = 96.7 bits (240), Expect = 1e-18, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 35/59 (59%) Query: 6 DENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEK 64 + A + Y DG + ++ PG +V+CA++ ++IPL+ L YWS + Q YA + + + Sbjct: 11 SDGLAVLHYGDGEYAVLSPGRFVLCAVSNKQIPLEALRYWSPEHQEAYAGPAEALKRWQ 69 >gi|306840955|ref|ZP_07473696.1| Hypothetical protein BIBO2_0755 [Brucella sp. BO2] gi|306289012|gb|EFM60277.1| Hypothetical protein BIBO2_0755 [Brucella sp. BO2] Length = 78 Score = 96.3 bits (239), Expect = 1e-18, Method: Composition-based stats. Identities = 31/59 (52%), Positives = 40/59 (67%) Query: 9 EASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISG 67 EA +RY DG +EI++ G++V CA+TG IPL +L YWSV RQ PYA+ SFE E Sbjct: 11 EAVLRYLDGDYEIVKHGSFVSCAVTGAPIPLDELRYWSVARQEPYASGLISFERELEMN 69 >gi|262276800|ref|ZP_06054593.1| conserved hypothetical protein [alpha proteobacterium HIMB114] gi|262223903|gb|EEY74362.1| conserved hypothetical protein [alpha proteobacterium HIMB114] Length = 60 Score = 95.5 bits (237), Expect = 2e-18, Method: Composition-based stats. Identities = 23/57 (40%), Positives = 36/57 (63%) Query: 8 NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEK 64 EA I+Y G+FE+ G +V+CA++G++I LK L YW+VD Q PY + + + Sbjct: 2 KEAKIKYFHGSFEVESEGDFVICAVSGKKILLKDLKYWNVDLQEPYFSPIEVSQKYQ 58 >gi|295690268|ref|YP_003593961.1| hypothetical protein Cseg_2899 [Caulobacter segnis ATCC 21756] gi|295432171|gb|ADG11343.1| Protein of unknown function DUF2093 [Caulobacter segnis ATCC 21756] Length = 70 Score = 95.5 bits (237), Expect = 2e-18, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 35/59 (59%) Query: 6 DENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEK 64 + A + Y DG + ++ PG +V+CAIT +IPL L YWS + Q YA+A + + + Sbjct: 11 SDGLAVLHYGDGEYAVLSPGRFVLCAITNAKIPLDALRYWSPEHQEAYASAAEALKRWQ 69 >gi|167645190|ref|YP_001682853.1| hypothetical protein Caul_1225 [Caulobacter sp. K31] gi|167347620|gb|ABZ70355.1| conserved hypothetical protein [Caulobacter sp. K31] Length = 73 Score = 95.1 bits (236), Expect = 3e-18, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 34/59 (57%) Query: 8 NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKIS 66 A + Y DG F ++ PG YV+CA+TG ++ L+ L YWS + Q YA + + + S Sbjct: 13 GPAVLHYGDGEFAVMSPGHYVLCAVTGAKVQLEALRYWSPELQEAYAGPTEALKRWRES 71 >gi|17989372|ref|NP_542005.1| hypothetical protein BMEII1027 [Brucella melitensis bv. 1 str. 16M] gi|256043137|ref|ZP_05446079.1| hypothetical protein Bmelb1R_01557 [Brucella melitensis bv. 1 str. Rev.1] gi|260564359|ref|ZP_05834844.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|265989569|ref|ZP_06102126.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. Rev.1] gi|17985244|gb|AAL54269.1| hypothetical protein BMEII1027 [Brucella melitensis bv. 1 str. 16M] gi|260152002|gb|EEW87095.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|263000238|gb|EEZ12928.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. Rev.1] Length = 78 Score = 95.1 bits (236), Expect = 3e-18, Method: Composition-based stats. Identities = 31/59 (52%), Positives = 40/59 (67%) Query: 9 EASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISG 67 EA +RY DG +EI++ G++V CA+TG IPL +L YWSV RQ PYA+ SFE E Sbjct: 11 EAVLRYLDGDYEIVKHGSFVSCAVTGAPIPLDELKYWSVARQEPYASGLISFERELEMN 69 >gi|254505139|ref|ZP_05117290.1| hypothetical protein SADFL11_5179 [Labrenzia alexandrii DFL-11] gi|222441210|gb|EEE47889.1| hypothetical protein SADFL11_5179 [Labrenzia alexandrii DFL-11] Length = 93 Score = 95.1 bits (236), Expect = 3e-18, Method: Composition-based stats. Identities = 29/55 (52%), Positives = 38/55 (69%) Query: 9 EASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAE 63 EA IRY DG +++ PGT+V CA+TG IPL +L YWSV+ Q PY +A AS + Sbjct: 32 EARIRYLDGDYQVETPGTFVRCAVTGTAIPLDELKYWSVELQEPYVDAHASMKRY 86 >gi|23499976|ref|NP_699416.1| hypothetical protein BRA0217 [Brucella suis 1330] gi|62317164|ref|YP_223017.1| hypothetical protein BruAb2_0213 [Brucella abortus bv. 1 str. 9-941] gi|83269146|ref|YP_418437.1| hypothetical protein BAB2_0211 [Brucella melitensis biovar Abortus 2308] gi|161620295|ref|YP_001594181.1| hypothetical protein BCAN_B0218 [Brucella canis ATCC 23365] gi|163844404|ref|YP_001622059.1| hypothetical protein BSUIS_B0221 [Brucella suis ATCC 23445] gi|189022423|ref|YP_001932164.1| hypothetical protein BAbS19_II02010 [Brucella abortus S19] gi|225686070|ref|YP_002734042.1| hypothetical protein BMEA_B0217 [Brucella melitensis ATCC 23457] gi|254691353|ref|ZP_05154607.1| hypothetical protein Babob68_14625 [Brucella abortus bv. 6 str. 870] gi|254698442|ref|ZP_05160270.1| hypothetical protein Babob28_12247 [Brucella abortus bv. 2 str. 86/8/59] gi|254699508|ref|ZP_05161336.1| hypothetical protein Bsuib55_01414 [Brucella suis bv. 5 str. 513] gi|254702631|ref|ZP_05164459.1| hypothetical protein Bsuib36_01527 [Brucella suis bv. 3 str. 686] gi|254706238|ref|ZP_05168066.1| hypothetical protein BpinM_04365 [Brucella pinnipedialis M163/99/10] gi|254711469|ref|ZP_05173280.1| hypothetical protein BpinB_14692 [Brucella pinnipedialis B2/94] gi|254712071|ref|ZP_05173882.1| hypothetical protein BcetM6_01497 [Brucella ceti M644/93/1] gi|254715141|ref|ZP_05176952.1| hypothetical protein BcetM_01507 [Brucella ceti M13/05/1] gi|254719952|ref|ZP_05181763.1| hypothetical protein Bru83_10479 [Brucella sp. 83/13] gi|254731890|ref|ZP_05190468.1| hypothetical protein Babob42_12062 [Brucella abortus bv. 4 str. 292] gi|256015003|ref|YP_003105012.1| hypothetical protein BMI_II214 [Brucella microti CCM 4915] gi|256029900|ref|ZP_05443514.1| hypothetical protein BpinM2_04465 [Brucella pinnipedialis M292/94/1] gi|256059549|ref|ZP_05449748.1| hypothetical protein Bneo5_04250 [Brucella neotomae 5K33] gi|256111876|ref|ZP_05452837.1| hypothetical protein Bmelb3E_04350 [Brucella melitensis bv. 3 str. Ether] gi|256158070|ref|ZP_05455988.1| hypothetical protein BcetM4_04425 [Brucella ceti M490/95/1] gi|256252975|ref|ZP_05458511.1| hypothetical protein BcetB_01432 [Brucella ceti B1/94] gi|256256538|ref|ZP_05462074.1| hypothetical protein Babob9C_04075 [Brucella abortus bv. 9 str. C68] gi|256262807|ref|ZP_05465339.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] gi|260166998|ref|ZP_05753809.1| hypothetical protein BruF5_01177 [Brucella sp. F5/99] gi|260544398|ref|ZP_05820219.1| conserved hypothetical protein [Brucella abortus NCTC 8038] gi|260568460|ref|ZP_05838929.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|260756963|ref|ZP_05869311.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870] gi|260759663|ref|ZP_05872011.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292] gi|260762905|ref|ZP_05875237.1| conserved hypothetical protein [Brucella abortus bv. 2 str. 86/8/59] gi|260882775|ref|ZP_05894389.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68] gi|261216851|ref|ZP_05931132.1| conserved hypothetical protein [Brucella ceti M13/05/1] gi|261220068|ref|ZP_05934349.1| conserved hypothetical protein [Brucella ceti B1/94] gi|261313679|ref|ZP_05952876.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] gi|261319078|ref|ZP_05958275.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] gi|261319718|ref|ZP_05958915.1| conserved hypothetical protein [Brucella ceti M644/93/1] gi|261323517|ref|ZP_05962714.1| conserved hypothetical protein [Brucella neotomae 5K33] gi|261749963|ref|ZP_05993672.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513] gi|261753216|ref|ZP_05996925.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686] gi|261756385|ref|ZP_06000094.1| conserved hypothetical protein [Brucella sp. F5/99] gi|265984960|ref|ZP_06097695.1| conserved hypothetical protein [Brucella sp. 83/13] gi|265986918|ref|ZP_06099475.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1] gi|265993329|ref|ZP_06105886.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether] gi|265996584|ref|ZP_06109141.1| conserved hypothetical protein [Brucella ceti M490/95/1] gi|297249894|ref|ZP_06933595.1| hypothetical protein BAYG_02667 [Brucella abortus bv. 5 str. B3196] gi|306838541|ref|ZP_07471379.1| Hypothetical protein BROD_1355 [Brucella sp. NF 2653] gi|306845534|ref|ZP_07478103.1| Hypothetical protein BIBO1_2220 [Brucella sp. BO1] gi|23463558|gb|AAN33421.1| conserved hypothetical protein [Brucella suis 1330] gi|62197357|gb|AAX75656.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941] gi|82939420|emb|CAJ12377.1| conserved hypothetical protein [Brucella melitensis biovar Abortus 2308] gi|161337106|gb|ABX63410.1| Hypothetical protein BCAN_B0218 [Brucella canis ATCC 23365] gi|163675127|gb|ABY39237.1| Hypothetical protein, conserved [Brucella suis ATCC 23445] gi|189020997|gb|ACD73718.1| hypothetical protein BAbS19_II02010 [Brucella abortus S19] gi|225642175|gb|ACO02088.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457] gi|255997663|gb|ACU49350.1| hypothetical protein BMI_II214 [Brucella microti CCM 4915] gi|260097669|gb|EEW81543.1| conserved hypothetical protein [Brucella abortus NCTC 8038] gi|260155125|gb|EEW90206.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|260669981|gb|EEX56921.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292] gi|260673326|gb|EEX60147.1| conserved hypothetical protein [Brucella abortus bv. 2 str. 86/8/59] gi|260677071|gb|EEX63892.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870] gi|260872303|gb|EEX79372.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68] gi|260918652|gb|EEX85305.1| conserved hypothetical protein [Brucella ceti B1/94] gi|260921940|gb|EEX88508.1| conserved hypothetical protein [Brucella ceti M13/05/1] gi|261292408|gb|EEX95904.1| conserved hypothetical protein [Brucella ceti M644/93/1] gi|261298301|gb|EEY01798.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] gi|261299497|gb|EEY02994.1| conserved hypothetical protein [Brucella neotomae 5K33] gi|261302705|gb|EEY06202.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] gi|261736369|gb|EEY24365.1| conserved hypothetical protein [Brucella sp. F5/99] gi|261739716|gb|EEY27642.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513] gi|261742969|gb|EEY30895.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686] gi|262550881|gb|EEZ07042.1| conserved hypothetical protein [Brucella ceti M490/95/1] gi|262764199|gb|EEZ10231.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether] gi|263092628|gb|EEZ16849.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] gi|264659115|gb|EEZ29376.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1] gi|264663552|gb|EEZ33813.1| conserved hypothetical protein [Brucella sp. 83/13] gi|297173763|gb|EFH33127.1| hypothetical protein BAYG_02667 [Brucella abortus bv. 5 str. B3196] gi|306273855|gb|EFM55682.1| Hypothetical protein BIBO1_2220 [Brucella sp. BO1] gi|306406408|gb|EFM62649.1| Hypothetical protein BROD_1355 [Brucella sp. NF 2653] gi|326410396|gb|ADZ67460.1| conserved hypothetical protein [Brucella melitensis M28] gi|326553689|gb|ADZ88328.1| conserved hypothetical protein [Brucella melitensis M5-90] Length = 78 Score = 94.7 bits (235), Expect = 4e-18, Method: Composition-based stats. Identities = 31/59 (52%), Positives = 40/59 (67%) Query: 9 EASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISG 67 EA +RY DG +EI++ G++V CA+TG IPL +L YWSV RQ PYA+ SFE E Sbjct: 11 EAVLRYLDGDYEIVKHGSFVSCAVTGAPIPLDELKYWSVARQEPYASGLISFERELEMN 69 >gi|315500483|ref|YP_004089286.1| hypothetical protein Astex_3505 [Asticcacaulis excentricus CB 48] gi|315418495|gb|ADU15135.1| Protein of unknown function DUF2093 [Asticcacaulis excentricus CB 48] Length = 72 Score = 94.7 bits (235), Expect = 4e-18, Method: Composition-based stats. Identities = 23/59 (38%), Positives = 36/59 (61%) Query: 9 EASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISG 67 EA + Y DG + ++RPG +V+CA++G++IPL+ L YW+ Q YA E + K Sbjct: 12 EAILHYGDGEYAVMRPGKFVICAVSGKQIPLEALRYWNPRTQEAYAGPEEATARWKALN 70 >gi|118590720|ref|ZP_01548121.1| hypothetical protein SIAM614_06118 [Stappia aggregata IAM 12614] gi|118436696|gb|EAV43336.1| hypothetical protein SIAM614_06118 [Stappia aggregata IAM 12614] Length = 85 Score = 94.0 bits (233), Expect = 6e-18, Method: Composition-based stats. Identities = 28/55 (50%), Positives = 37/55 (67%) Query: 9 EASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAE 63 EA +RY DG +++ PGT+V CA+TG IPL +L YWSV RQ Y +A AS + Sbjct: 27 EARVRYLDGDYQVETPGTFVRCAVTGTAIPLDELKYWSVARQEAYVDANASMKRY 81 >gi|329851149|ref|ZP_08265906.1| hypothetical protein ABI_39840 [Asticcacaulis biprosthecum C19] gi|328839995|gb|EGF89567.1| hypothetical protein ABI_39840 [Asticcacaulis biprosthecum C19] Length = 69 Score = 93.6 bits (232), Expect = 8e-18, Method: Composition-based stats. Identities = 25/59 (42%), Positives = 37/59 (62%) Query: 9 EASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISG 67 +A + Y DG + I+RPG +VVCA+TG+R+PL+ L YW+ Q YA E + + K Sbjct: 10 QAVLHYGDGEYTIMRPGKFVVCAVTGKRVPLEALRYWNPRNQEAYAGPEEAMQRWKSLN 68 >gi|240849930|ref|YP_002971319.1| hypothetical protein Bgr_02840 [Bartonella grahamii as4aup] gi|240267053|gb|ACS50641.1| hypothetical protein Bgr_02840 [Bartonella grahamii as4aup] Length = 78 Score = 93.6 bits (232), Expect = 8e-18, Method: Composition-based stats. Identities = 25/58 (43%), Positives = 38/58 (65%) Query: 6 DENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAE 63 E EA I Y + ++II G+Y +CA++GQ+IP+ L YW+ RQ YA+ E S++ E Sbjct: 5 SEREAKIHYSNNGYDIIEYGSYTICAVSGQKIPIDDLKYWNHHRQEAYASCEISYQRE 62 >gi|299533971|ref|ZP_07047326.1| hypothetical protein CTS44_24193 [Comamonas testosteroni S44] gi|298718041|gb|EFI59043.1| hypothetical protein CTS44_24193 [Comamonas testosteroni S44] Length = 56 Score = 93.2 bits (231), Expect = 9e-18, Method: Composition-based stats. Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 2/57 (3%) Query: 14 YKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISGKIP 70 Y DG F + R G +V CA+TG+ IPL++L YW+VD Q PY++ +A I K+P Sbjct: 1 YGDGEFRVRRAGAFVRCAVTGEPIPLEELRYWNVDLQEPYSSPQAKLTR--IGVKLP 55 >gi|323137827|ref|ZP_08072902.1| Protein of unknown function DUF2093 [Methylocystis sp. ATCC 49242] gi|322396830|gb|EFX99356.1| Protein of unknown function DUF2093 [Methylocystis sp. ATCC 49242] Length = 73 Score = 93.2 bits (231), Expect = 9e-18, Method: Composition-based stats. Identities = 24/59 (40%), Positives = 35/59 (59%) Query: 9 EASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISG 67 EA + + DG + + +PG YV CA+TG+ IPL+ L YW+VD Q PY+ A + Sbjct: 13 EAVVEFLDGEYRVRKPGAYVRCAVTGEPIPLEDLRYWNVDLQEPYSGPHAKLMRLGVKK 71 >gi|239833561|ref|ZP_04681889.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301] gi|239821624|gb|EEQ93193.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301] Length = 99 Score = 92.8 bits (230), Expect = 1e-17, Method: Composition-based stats. Identities = 33/59 (55%), Positives = 38/59 (64%) Query: 9 EASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISG 67 EA +RY DG +EI+R G YV CA+TG IPL +L YWSV RQ PYA SFE E Sbjct: 32 EAVLRYLDGDYEIVRHGAYVACAVTGAHIPLDELKYWSVARQEPYATGLISFERELEVN 90 >gi|85717180|ref|ZP_01048138.1| hypothetical protein NB311A_14662 [Nitrobacter sp. Nb-311A] gi|85696013|gb|EAQ33913.1| hypothetical protein NB311A_14662 [Nitrobacter sp. Nb-311A] Length = 61 Score = 92.8 bits (230), Expect = 1e-17, Method: Composition-based stats. Identities = 27/52 (51%), Positives = 33/52 (63%) Query: 12 IRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAE 63 ++Y DG F +I PGTYV CA+T RIPL +L YWSVD Q YA A + Sbjct: 1 MQYLDGDFRVISPGTYVRCAVTDARIPLDELKYWSVDLQEAYALPSAVLQRH 52 >gi|153010371|ref|YP_001371585.1| hypothetical protein Oant_3048 [Ochrobactrum anthropi ATCC 49188] gi|151562259|gb|ABS15756.1| conserved hypothetical protein [Ochrobactrum anthropi ATCC 49188] Length = 100 Score = 92.8 bits (230), Expect = 1e-17, Method: Composition-based stats. Identities = 33/59 (55%), Positives = 38/59 (64%) Query: 9 EASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISG 67 EA +RY DG +EI+R G YV CA+TG IPL +L YWSV RQ PYA SFE E Sbjct: 33 EAVLRYLDGDYEIVRHGAYVACAVTGAHIPLDELKYWSVSRQEPYATGLISFERELEVN 91 >gi|304393196|ref|ZP_07375124.1| conserved hypothetical protein [Ahrensia sp. R2A130] gi|303294203|gb|EFL88575.1| conserved hypothetical protein [Ahrensia sp. R2A130] Length = 73 Score = 92.8 bits (230), Expect = 1e-17, Method: Composition-based stats. Identities = 33/72 (45%), Positives = 48/72 (66%), Gaps = 3/72 (4%) Query: 1 MYNKVD---ENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAE 57 M N+V+ A++RY + + ++ PGT+VVCAITG IPL +L YWS RQ Y + E Sbjct: 1 MLNRVNIAVPQAATLRYAEADYTVLAPGTHVVCAITGDNIPLDELKYWSFARQEAYVDVE 60 Query: 58 ASFEAEKISGKI 69 AS EAE+ +G++ Sbjct: 61 ASVEAERKAGRL 72 >gi|254695347|ref|ZP_05157175.1| hypothetical protein Babob3T_12015 [Brucella abortus bv. 3 str. Tulya] gi|261215719|ref|ZP_05930000.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya] gi|260917326|gb|EEX84187.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya] Length = 78 Score = 92.8 bits (230), Expect = 1e-17, Method: Composition-based stats. Identities = 30/59 (50%), Positives = 39/59 (66%) Query: 9 EASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISG 67 EA +RY DG +EI++ G++V CA+TG I L +L YWSV RQ PYA+ SFE E Sbjct: 11 EAVLRYLDGDYEIVKHGSFVSCAVTGAPISLDELKYWSVARQEPYASGLISFERELEMN 69 >gi|163867559|ref|YP_001608758.1| hypothetical protein Btr_0297 [Bartonella tribocorum CIP 105476] gi|161017205|emb|CAK00763.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476] Length = 78 Score = 92.0 bits (228), Expect = 2e-17, Method: Composition-based stats. Identities = 27/58 (46%), Positives = 40/58 (68%) Query: 6 DENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAE 63 DE EA +RY + ++I+ GTY+VCA++GQ+IP+ L YW+ RQ YA+ E S+ E Sbjct: 5 DEREAKVRYSNNGYDIVEYGTYIVCAVSGQKIPIDDLKYWNHHRQEAYASCEISYHRE 62 >gi|319898389|ref|YP_004158482.1| hypothetical protein BARCL_0211 [Bartonella clarridgeiae 73] gi|319402353|emb|CBI75892.1| conserved protein of unknown function [Bartonella clarridgeiae 73] Length = 77 Score = 90.9 bits (225), Expect = 5e-17, Method: Composition-based stats. Identities = 28/59 (47%), Positives = 42/59 (71%) Query: 5 VDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAE 63 +E EA+I Y + +++II+ GTY VCA++GQ+IPL L YW+ RQ YA+ E S++ E Sbjct: 4 NNECEATIHYFNNSYKIIKYGTYTVCAVSGQKIPLDDLKYWNHQRQEAYASCELSYQRE 62 >gi|312115899|ref|YP_004013495.1| hypothetical protein Rvan_3201 [Rhodomicrobium vannielii ATCC 17100] gi|311221028|gb|ADP72396.1| Protein of unknown function DUF2093 [Rhodomicrobium vannielii ATCC 17100] Length = 75 Score = 90.1 bits (223), Expect = 8e-17, Method: Composition-based stats. Identities = 28/67 (41%), Positives = 39/67 (58%), Gaps = 5/67 (7%) Query: 2 YNKV-----DENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANA 56 N++ EA IRY DG F++++ G YV CA+T + I +++L YWSV Q PY NA Sbjct: 1 MNRMERPFAFGQEAKIRYLDGEFQVLKHGAYVRCAVTDEPIRIEELKYWSVAYQEPYINA 60 Query: 57 EASFEAE 63 AS Sbjct: 61 AASLRRH 67 >gi|49475079|ref|YP_033120.1| hypothetical protein BH02680 [Bartonella henselae str. Houston-1] gi|49237884|emb|CAF27080.1| hypothetical protein BH02680 [Bartonella henselae str. Houston-1] Length = 78 Score = 90.1 bits (223), Expect = 1e-16, Method: Composition-based stats. Identities = 25/58 (43%), Positives = 37/58 (63%) Query: 6 DENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAE 63 +E EA I Y + ++II GTY +CA++GQ+I + L YW+ RQ YA+ E S+ E Sbjct: 5 NEREAKIHYSNNGYKIIEYGTYTLCAVSGQKILIDDLKYWNHHRQEAYASCEISYHRE 62 >gi|241761542|ref|ZP_04759629.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis ATCC 10988] gi|260753907|ref|YP_003226800.1| hypothetical protein Za10_1682 [Zymomonas mobilis subsp. mobilis NCIMB 11163] gi|241373850|gb|EER63383.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis ATCC 10988] gi|258553270|gb|ACV76216.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis NCIMB 11163] Length = 76 Score = 90.1 bits (223), Expect = 1e-16, Method: Composition-based stats. Identities = 26/66 (39%), Positives = 42/66 (63%), Gaps = 3/66 (4%) Query: 6 DENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYAN---AEASFEA 62 + A + Y DG F ++ G++V+CAI+G+ I L L YWSV++Q PYA+ AE ++ Sbjct: 8 KDQPAKVEYLDGHFRLLSRGSHVICAISGKSIDLDSLHYWSVEKQEPYASAYEAEIAYSR 67 Query: 63 EKISGK 68 E+ + K Sbjct: 68 EQEAKK 73 >gi|319408062|emb|CBI81716.1| conserved hypothetical protein [Bartonella schoenbuchensis R1] Length = 80 Score = 89.7 bits (222), Expect = 1e-16, Method: Composition-based stats. Identities = 25/59 (42%), Positives = 39/59 (66%) Query: 5 VDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAE 63 +E EA+I+Y ++I+ GTY +CA++GQ+IP+ L YW+ RQ YA+ E S+ E Sbjct: 4 NNEREATIQYSSNGYKIVNYGTYTLCAVSGQKIPIDDLKYWNHHRQEAYASCELSYRRE 62 >gi|49473917|ref|YP_031959.1| hypothetical protein BQ02560 [Bartonella quintana str. Toulouse] gi|49239420|emb|CAF25759.1| hypothetical protein BQ02560 [Bartonella quintana str. Toulouse] Length = 78 Score = 89.7 bits (222), Expect = 1e-16, Method: Composition-based stats. Identities = 25/59 (42%), Positives = 37/59 (62%) Query: 5 VDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAE 63 DE EA I Y + ++I+ GTY +CA++ Q+IP+ L YW+ RQ YA+ E S+ E Sbjct: 4 NDEREAKIHYSNNGYKIVEYGTYTLCAVSRQKIPIDDLKYWNHHRQEAYASCEISYHRE 62 >gi|294011578|ref|YP_003545038.1| hypothetical protein SJA_C1-15920 [Sphingobium japonicum UT26S] gi|292674908|dbj|BAI96426.1| conserved hypothetical protein [Sphingobium japonicum UT26S] Length = 70 Score = 89.3 bits (221), Expect = 1e-16, Method: Composition-based stats. Identities = 20/55 (36%), Positives = 32/55 (58%) Query: 7 ENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFE 61 + A + Y F+++RPG +V+CA++G RI L+ L YWS + Q Y E + Sbjct: 5 QGLAVLHYDTPHFDVVRPGQFVLCAVSGARIDLEDLKYWSAEFQEAYRGPEEATR 59 >gi|148557298|ref|YP_001264880.1| hypothetical protein Swit_4404 [Sphingomonas wittichii RW1] gi|148502488|gb|ABQ70742.1| Uncharacterized protein [Sphingomonas wittichii RW1] Length = 73 Score = 89.3 bits (221), Expect = 2e-16, Method: Composition-based stats. Identities = 23/52 (44%), Positives = 31/52 (59%) Query: 5 VDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANA 56 A +RY F I++ G +V+CA+TG+RIPL +L YWSVD Q Y Sbjct: 3 FSGKLAILRYDTPQFSIVQRGDHVLCAVTGERIPLNELRYWSVDHQEAYRGP 54 >gi|114569180|ref|YP_755860.1| hypothetical protein Mmar10_0629 [Maricaulis maris MCS10] gi|114339642|gb|ABI64922.1| conserved hypothetical protein [Maricaulis maris MCS10] Length = 76 Score = 89.3 bits (221), Expect = 2e-16, Method: Composition-based stats. Identities = 22/69 (31%), Positives = 35/69 (50%) Query: 2 YNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFE 61 ++K + EA + Y D F I++ G +V CA+T I L +L YW+VD Q Y + + + Sbjct: 6 FDKEFQGEAILEYGDSDFIILKAGAFVRCAVTNDPIQLDQLRYWNVDEQEAYKDVLVAKQ 65 Query: 62 AEKISGKIP 70 P Sbjct: 66 RWIELNSEP 74 >gi|254419161|ref|ZP_05032885.1| hypothetical protein BBAL3_1471 [Brevundimonas sp. BAL3] gi|196185338|gb|EDX80314.1| hypothetical protein BBAL3_1471 [Brevundimonas sp. BAL3] Length = 65 Score = 89.3 bits (221), Expect = 2e-16, Method: Composition-based stats. Identities = 21/61 (34%), Positives = 33/61 (54%) Query: 2 YNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFE 61 + + +A++ Y DG F +++PG +V CA+T + IPL+ L YWS RQ Y Sbjct: 1 MDATNTTQAALHYGDGEFAVLKPGRFVRCAVTEKPIPLEVLRYWSPTRQEAYFGPAEFIA 60 Query: 62 A 62 Sbjct: 61 R 61 >gi|307294353|ref|ZP_07574197.1| Protein of unknown function DUF2093 [Sphingobium chlorophenolicum L-1] gi|306880504|gb|EFN11721.1| Protein of unknown function DUF2093 [Sphingobium chlorophenolicum L-1] Length = 69 Score = 88.9 bits (220), Expect = 2e-16, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 31/55 (56%) Query: 7 ENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFE 61 + A + Y F+I+RPG +V+CA++G RI L L YWS + Q Y E + Sbjct: 5 QGLAVLHYDTPHFDILRPGQFVMCAVSGARIDLDDLKYWSAEFQEAYRGPEEATR 59 >gi|319403682|emb|CBI77267.1| conserved hypothetical protein [Bartonella rochalimae ATCC BAA-1498] gi|319406599|emb|CBI80241.1| conserved hypothetical protein [Bartonella sp. 1-1C] Length = 77 Score = 88.6 bits (219), Expect = 3e-16, Method: Composition-based stats. Identities = 25/58 (43%), Positives = 42/58 (72%) Query: 6 DENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAE 63 +E EA+I Y + +++I++ GTY +CA++GQ+IP+ L YW+ RQ YA+ E S++ E Sbjct: 5 NECEATIHYFNNSYKIVKYGTYTICAVSGQKIPIDDLKYWNHQRQEAYASCELSYQRE 62 >gi|56552416|ref|YP_163255.1| hypothetical protein ZMO1520 [Zymomonas mobilis subsp. mobilis ZM4] gi|56543990|gb|AAV90144.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis ZM4] Length = 76 Score = 88.6 bits (219), Expect = 3e-16, Method: Composition-based stats. Identities = 26/66 (39%), Positives = 42/66 (63%), Gaps = 3/66 (4%) Query: 6 DENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYAN---AEASFEA 62 + A + Y DG F ++ G++V+CAI+G+ I L L YWSV++Q PYA+ AE ++ Sbjct: 8 KDQPAKVEYFDGHFRLLSRGSHVICAISGKSIDLDSLHYWSVEKQEPYASAYEAEIAYSR 67 Query: 63 EKISGK 68 E+ + K Sbjct: 68 EQEAKK 73 >gi|121602772|ref|YP_989455.1| hypothetical protein BARBAKC583_1202 [Bartonella bacilliformis KC583] gi|120614949|gb|ABM45550.1| conserved hypothetical protein [Bartonella bacilliformis KC583] Length = 77 Score = 87.4 bits (216), Expect = 5e-16, Method: Composition-based stats. Identities = 27/58 (46%), Positives = 39/58 (67%) Query: 6 DENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAE 63 DE EA I Y G ++I++ GTY +CA++GQ+IP+ L YW+ RQ YA E S++ E Sbjct: 5 DEREAIIHYSSGGYKIVKYGTYTLCAVSGQKIPIDDLKYWNHKRQEAYACCEFSYQRE 62 >gi|319405153|emb|CBI78759.1| conserved hypothetical protein [Bartonella sp. AR 15-3] Length = 77 Score = 87.4 bits (216), Expect = 6e-16, Method: Composition-based stats. Identities = 26/58 (44%), Positives = 42/58 (72%) Query: 6 DENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAE 63 +E EA+I Y + +++I++ GTY VCA++GQ+IP+ L YW+ RQ YA+ E S++ E Sbjct: 5 NECEATIHYFNNSYKIVKYGTYTVCAVSGQKIPIDNLKYWNHQRQEAYASCELSYQRE 62 >gi|330813632|ref|YP_004357871.1| hypothetical protein SAR11G3_00657 [Candidatus Pelagibacter sp. IMCC9063] gi|327486727|gb|AEA81132.1| hypothetical protein SAR11G3_00657 [Candidatus Pelagibacter sp. IMCC9063] Length = 60 Score = 84.7 bits (209), Expect = 4e-15, Method: Composition-based stats. Identities = 20/55 (36%), Positives = 33/55 (60%) Query: 8 NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEA 62 EA ++Y G F++I G YV+C I+ ++I L+ L YWSV+ Q Y++ + Sbjct: 2 KEAKLKYYAGGFDVITQGNYVLCVISKKKIDLQDLRYWSVELQEAYSSPIEVAKK 56 >gi|329890595|ref|ZP_08268938.1| hypothetical protein BDIM_22990 [Brevundimonas diminuta ATCC 11568] gi|328845896|gb|EGF95460.1| hypothetical protein BDIM_22990 [Brevundimonas diminuta ATCC 11568] Length = 69 Score = 84.3 bits (208), Expect = 5e-15, Method: Composition-based stats. Identities = 21/51 (41%), Positives = 29/51 (56%) Query: 10 ASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 A + Y DG F ++ G +V CA++G IPL L YWSV++Q YA Sbjct: 14 ACLHYGDGEFAVLSAGAFVRCAVSGAAIPLAALRYWSVEKQEAYAGPREYL 64 >gi|94496992|ref|ZP_01303566.1| hypothetical protein SKA58_13087 [Sphingomonas sp. SKA58] gi|94423668|gb|EAT08695.1| hypothetical protein SKA58_13087 [Sphingomonas sp. SKA58] Length = 80 Score = 84.3 bits (208), Expect = 6e-15, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 31/56 (55%) Query: 8 NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAE 63 A + Y F IIRPG +V+CA++G RI L+ L YWS Q Y AE + A Sbjct: 9 GLAVLEYDAADFAIIRPGQFVLCAVSGARIDLQDLKYWSARWQEAYRGAEEATAAY 64 >gi|16126486|ref|NP_421050.1| hypothetical protein CC_2247 [Caulobacter crescentus CB15] gi|13423756|gb|AAK24218.1| hypothetical protein CC_2247 [Caulobacter crescentus CB15] Length = 46 Score = 77.0 bits (189), Expect = 7e-13, Method: Composition-based stats. Identities = 15/43 (34%), Positives = 27/43 (62%) Query: 22 IRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEK 64 + PG +V+CA++ ++IPL+ L YWS + Q YA + + + Sbjct: 2 LSPGRFVLCAVSNKQIPLEALRYWSPEHQEAYAGPAEALKRWQ 44 >gi|225076831|ref|ZP_03720030.1| hypothetical protein NEIFLAOT_01882 [Neisseria flavescens NRL30031/H210] gi|224951870|gb|EEG33079.1| hypothetical protein NEIFLAOT_01882 [Neisseria flavescens NRL30031/H210] Length = 138 Score = 38.1 bits (88), Expect = 0.44, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 4/47 (8%) Query: 22 IRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISGK 68 I G Y CA TG+ I LK+L + R + EA E++ K Sbjct: 93 IDEGDYGFCADTGEPIGLKRL----LARPTATLSVEAQERRERMKKK 135 >gi|298370544|ref|ZP_06981860.1| RNA polymerase-binding protein DksA [Neisseria sp. oral taxon 014 str. F0314] gi|298282004|gb|EFI23493.1| RNA polymerase-binding protein DksA [Neisseria sp. oral taxon 014 str. F0314] Length = 103 Score = 37.3 bits (86), Expect = 0.70, Method: Composition-based stats. Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 7/66 (10%) Query: 3 NKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEA 62 ++ + A ++ T I G Y CA TG+ I LK+L + R + EA Sbjct: 42 DRERKLLAKVQ---ATIRSIDEGDYGFCADTGEPIGLKRL----LARPTATLSVEAQERR 94 Query: 63 EKISGK 68 E++ + Sbjct: 95 ERMKKQ 100 >gi|298370548|ref|ZP_06981863.1| RNA polymerase-binding protein DksA [Neisseria sp. oral taxon 014 str. F0314] gi|298281158|gb|EFI22648.1| RNA polymerase-binding protein DksA [Neisseria sp. oral taxon 014 str. F0314] Length = 138 Score = 37.3 bits (86), Expect = 0.74, Method: Composition-based stats. Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 7/66 (10%) Query: 3 NKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEA 62 ++ + A ++ T I G Y CA TG+ I LK+L + R + EA Sbjct: 77 DRERKLLAKVQ---ATIRSIDEGDYGFCADTGEPIGLKRL----LARPTATLSVEAQERR 129 Query: 63 EKISGK 68 E++ + Sbjct: 130 ERMKKQ 135 >gi|59802218|ref|YP_208930.1| DskA [Neisseria gonorrhoeae FA 1090] gi|194099843|ref|YP_002002978.1| DskA [Neisseria gonorrhoeae NCCP11945] gi|240000013|ref|ZP_04719937.1| DskA [Neisseria gonorrhoeae 35/02] gi|240013039|ref|ZP_04719952.1| DskA [Neisseria gonorrhoeae DGI18] gi|240017611|ref|ZP_04724151.1| DskA [Neisseria gonorrhoeae FA6140] gi|240081908|ref|ZP_04726451.1| DskA [Neisseria gonorrhoeae FA19] gi|240114189|ref|ZP_04728679.1| DskA [Neisseria gonorrhoeae MS11] gi|240116827|ref|ZP_04730889.1| DskA [Neisseria gonorrhoeae PID18] gi|240119056|ref|ZP_04733118.1| DskA [Neisseria gonorrhoeae PID1] gi|240122232|ref|ZP_04735194.1| DskA [Neisseria gonorrhoeae PID24-1] gi|240122406|ref|ZP_04735362.1| DskA [Neisseria gonorrhoeae PID332] gi|240126747|ref|ZP_04739633.1| DskA [Neisseria gonorrhoeae SK-92-679] gi|240127121|ref|ZP_04739782.1| DskA [Neisseria gonorrhoeae SK-93-1035] gi|260441621|ref|ZP_05795437.1| DskA [Neisseria gonorrhoeae DGI2] gi|268595820|ref|ZP_06129987.1| DnaK suppressor protein DskA [Neisseria gonorrhoeae 35/02] gi|268598006|ref|ZP_06132173.1| DnaK suppressor protein DskA [Neisseria gonorrhoeae FA19] gi|268600261|ref|ZP_06134428.1| DnaK suppressor protein [Neisseria gonorrhoeae MS11] gi|268602505|ref|ZP_06136672.1| DnaK suppressor protein [Neisseria gonorrhoeae PID18] gi|268604770|ref|ZP_06138937.1| DnaK suppressor protein [Neisseria gonorrhoeae PID1] gi|268680994|ref|ZP_06147856.1| DnaK suppressor protein [Neisseria gonorrhoeae PID332] gi|268685325|ref|ZP_06152187.1| DnaK suppressor protein [Neisseria gonorrhoeae SK-92-679] gi|268685477|ref|ZP_06152339.1| DnaK suppressor protein [Neisseria gonorrhoeae SK-93-1035] gi|291044995|ref|ZP_06570704.1| DnaK suppressor protein DskA [Neisseria gonorrhoeae DGI2] gi|293398059|ref|ZP_06642265.1| DnaK suppressor protein [Neisseria gonorrhoeae F62] gi|59719113|gb|AAW90518.1| putative dosage-dependent DnaK suppressor protein [Neisseria gonorrhoeae FA 1090] gi|193935133|gb|ACF30957.1| DskA [Neisseria gonorrhoeae NCCP11945] gi|268549209|gb|EEZ44627.1| DnaK suppressor protein DskA [Neisseria gonorrhoeae 35/02] gi|268551794|gb|EEZ46813.1| DnaK suppressor protein DskA [Neisseria gonorrhoeae FA19] gi|268584392|gb|EEZ49068.1| DnaK suppressor protein [Neisseria gonorrhoeae MS11] gi|268586636|gb|EEZ51312.1| DnaK suppressor protein [Neisseria gonorrhoeae PID18] gi|268588901|gb|EEZ53577.1| DnaK suppressor protein [Neisseria gonorrhoeae PID1] gi|268621278|gb|EEZ53678.1| DnaK suppressor protein [Neisseria gonorrhoeae PID332] gi|268625609|gb|EEZ58009.1| DnaK suppressor protein [Neisseria gonorrhoeae SK-92-679] gi|268625761|gb|EEZ58161.1| DnaK suppressor protein [Neisseria gonorrhoeae SK-93-1035] gi|291011889|gb|EFE03885.1| DnaK suppressor protein DskA [Neisseria gonorrhoeae DGI2] gi|291612005|gb|EFF41074.1| DnaK suppressor protein [Neisseria gonorrhoeae F62] gi|317165311|gb|ADV08852.1| DskA [Neisseria gonorrhoeae TCDC-NG08107] Length = 138 Score = 36.2 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 4/47 (8%) Query: 22 IRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISGK 68 I G Y CA TG+ I LK+L + R + EA E++ + Sbjct: 93 IDEGDYGFCADTGEPIGLKRL----LARPTATLSVEAQERRERMKKQ 135 >gi|254494794|ref|ZP_05107965.1| DnaK suppressor protein [Neisseria gonorrhoeae 1291] gi|226513834|gb|EEH63179.1| DnaK suppressor protein [Neisseria gonorrhoeae 1291] Length = 138 Score = 36.2 bits (83), Expect = 1.7, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 4/47 (8%) Query: 22 IRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISGK 68 I G Y CA TG+ I LK+L + R + EA E++ + Sbjct: 93 IDEGDYGFCADTGEPIGLKRL----LARPTATLSVEAQERRERMKKQ 135 >gi|319638707|ref|ZP_07993466.1| DnaK suppressor protein [Neisseria mucosa C102] gi|317399948|gb|EFV80610.1| DnaK suppressor protein [Neisseria mucosa C102] Length = 138 Score = 36.2 bits (83), Expect = 1.7, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 4/47 (8%) Query: 22 IRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISGK 68 I G Y CA TG+ I LK+L + R + EA E++ + Sbjct: 93 IDEGDYGFCADTGEPIGLKRL----LARPTATLSVEAQERRERMKKQ 135 >gi|261379677|ref|ZP_05984250.1| RNA polymerase-binding protein DksA [Neisseria subflava NJ9703] gi|284798168|gb|EFC53515.1| RNA polymerase-binding protein DksA [Neisseria subflava NJ9703] Length = 138 Score = 35.8 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 4/47 (8%) Query: 22 IRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISGK 68 I G Y CA TG+ I LK+L + R + EA E++ + Sbjct: 93 IDEGDYGFCADTGEPIGLKRL----LARPTATLSVEAQERRERMKKQ 135 >gi|152977180|ref|YP_001376697.1| TraR/DksA family transcriptional regulator [Bacillus cereus subsp. cytotoxis NVH 391-98] gi|152025932|gb|ABS23702.1| transcriptional regulator, TraR/DksA family [Bacillus cytotoxicus NVH 391-98] Length = 243 Score = 35.4 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 10/21 (47%), Positives = 16/21 (76%) Query: 22 IRPGTYVVCAITGQRIPLKKL 42 I GTY +C ++G+ IPL++L Sbjct: 84 IEAGTYGICEVSGEPIPLERL 104 >gi|261401841|ref|ZP_05987966.1| RNA polymerase-binding protein DksA [Neisseria lactamica ATCC 23970] gi|269208023|gb|EEZ74478.1| RNA polymerase-binding protein DksA [Neisseria lactamica ATCC 23970] Length = 138 Score = 35.0 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 4/47 (8%) Query: 22 IRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISGK 68 I G Y CA TG+ I LK+L + R + EA E++ + Sbjct: 93 IDRGDYGFCADTGEPIGLKRL----LARPTATLSVEAQERRERMKKQ 135 >gi|308174755|ref|YP_003921460.1| hypothetical protein BAMF_2864 [Bacillus amyloliquefaciens DSM 7] gi|307607619|emb|CBI43990.1| conserved hypothetical protein [Bacillus amyloliquefaciens DSM 7] gi|328554686|gb|AEB25178.1| hypothetical protein BAMTA208_15095 [Bacillus amyloliquefaciens TA208] gi|328913095|gb|AEB64691.1| hypothetical protein LL3_03160 [Bacillus amyloliquefaciens LL3] Length = 239 Score = 35.0 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 14/65 (21%), Positives = 27/65 (41%), Gaps = 17/65 (26%) Query: 16 DGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVP---------YANAEASFEAEKIS 66 D + + I GTY +C ++G+ IP +L Y++ +A + I Sbjct: 80 DYSLKQIENGTYGICEVSGKEIPYDRL--------EALPTATTLAEYSSQDAVSKDRPIE 131 Query: 67 GKIPY 71 + P+ Sbjct: 132 EETPF 136 >gi|313667384|ref|YP_004047668.1| DnaK suppressor protein [Neisseria lactamica ST-640] gi|309378572|emb|CBX22844.1| unnamed protein product [Neisseria lactamica Y92-1009] gi|313004846|emb|CBN86271.1| putative DnaK suppressor protein [Neisseria lactamica 020-06] Length = 138 Score = 35.0 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 4/47 (8%) Query: 22 IRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISGK 68 I G Y CA TG+ I LK+L + R + EA E++ + Sbjct: 93 IDRGDYGFCADTGEPIGLKRL----LARPTATLSVEAQERRERMKKQ 135 >gi|295402069|ref|ZP_06812029.1| transcriptional regulator, TraR/DksA family [Geobacillus thermoglucosidasius C56-YS93] gi|312109829|ref|YP_003988145.1| TraR/DksA family transcriptional regulator [Geobacillus sp. Y4.1MC1] gi|294975851|gb|EFG51469.1| transcriptional regulator, TraR/DksA family [Geobacillus thermoglucosidasius C56-YS93] gi|311214930|gb|ADP73534.1| transcriptional regulator, TraR/DksA family [Geobacillus sp. Y4.1MC1] Length = 254 Score = 35.0 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 9/24 (37%), Positives = 16/24 (66%) Query: 20 EIIRPGTYVVCAITGQRIPLKKLC 43 ++I GTY +C + G+ IP ++L Sbjct: 84 QVIENGTYGICEVCGKPIPYERLK 107 >gi|50812282|ref|NP_390962.2| hypothetical protein BSU30840 [Bacillus subtilis subsp. subtilis str. 168] gi|221311024|ref|ZP_03592871.1| hypothetical protein Bsubs1_16776 [Bacillus subtilis subsp. subtilis str. 168] gi|221315350|ref|ZP_03597155.1| hypothetical protein BsubsN3_16687 [Bacillus subtilis subsp. subtilis str. NCIB 3610] gi|221320267|ref|ZP_03601561.1| hypothetical protein BsubsJ_16608 [Bacillus subtilis subsp. subtilis str. JH642] gi|221324550|ref|ZP_03605844.1| hypothetical protein BsubsS_16752 [Bacillus subtilis subsp. subtilis str. SMY] gi|321312622|ref|YP_004204909.1| hypothetical protein BSn5_06270 [Bacillus subtilis BSn5] gi|37999942|sp|P42408|YTEA_BACSU RecName: Full=Uncharacterized protein yteA; AltName: Full=ORFQ gi|669001|gb|AAA62288.1| ORFQ [Bacillus subtilis] gi|32468812|emb|CAB15062.2| conserved hypothetical protein [Bacillus subtilis subsp. subtilis str. 168] gi|291485524|dbj|BAI86599.1| hypothetical protein BSNT_04488 [Bacillus subtilis subsp. natto BEST195] gi|320018896|gb|ADV93882.1| hypothetical protein BSn5_06270 [Bacillus subtilis BSn5] Length = 239 Score = 35.0 bits (80), Expect = 3.6, Method: Composition-based stats. Identities = 9/21 (42%), Positives = 15/21 (71%) Query: 22 IRPGTYVVCAITGQRIPLKKL 42 I GTY +C ++G+ IP ++L Sbjct: 86 IENGTYGICEVSGKEIPFERL 106 >gi|2293290|gb|AAC00368.1| YteA [Bacillus subtilis] Length = 181 Score = 34.6 bits (79), Expect = 4.6, Method: Composition-based stats. Identities = 9/21 (42%), Positives = 15/21 (71%) Query: 22 IRPGTYVVCAITGQRIPLKKL 42 I GTY +C ++G+ IP ++L Sbjct: 86 IENGTYGICEVSGKEIPFERL 106 >gi|228993598|ref|ZP_04153506.1| DNA binding protein, DksA/TraR [Bacillus pseudomycoides DSM 12442] gi|228999634|ref|ZP_04159211.1| DNA binding protein, DksA/TraR [Bacillus mycoides Rock3-17] gi|229007193|ref|ZP_04164800.1| DNA binding protein, DksA/TraR [Bacillus mycoides Rock1-4] gi|228754065|gb|EEM03496.1| DNA binding protein, DksA/TraR [Bacillus mycoides Rock1-4] gi|228760160|gb|EEM09129.1| DNA binding protein, DksA/TraR [Bacillus mycoides Rock3-17] gi|228766189|gb|EEM14835.1| DNA binding protein, DksA/TraR [Bacillus pseudomycoides DSM 12442] Length = 243 Score = 34.6 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 11/21 (52%), Positives = 16/21 (76%) Query: 22 IRPGTYVVCAITGQRIPLKKL 42 I GTY VC ++G+ IPL++L Sbjct: 84 IEAGTYGVCEVSGEEIPLERL 104 >gi|296330059|ref|ZP_06872542.1| hypothetical protein BSU6633_03072 [Bacillus subtilis subsp. spizizenii ATCC 6633] gi|305675668|ref|YP_003867340.1| hypothetical protein BSUW23_14970 [Bacillus subtilis subsp. spizizenii str. W23] gi|296152784|gb|EFG93650.1| hypothetical protein BSU6633_03072 [Bacillus subtilis subsp. spizizenii ATCC 6633] gi|305413912|gb|ADM39031.1| conserved hypothetical protein [Bacillus subtilis subsp. spizizenii str. W23] Length = 239 Score = 34.2 bits (78), Expect = 5.7, Method: Composition-based stats. Identities = 9/21 (42%), Positives = 15/21 (71%) Query: 22 IRPGTYVVCAITGQRIPLKKL 42 I GTY +C ++G+ IP ++L Sbjct: 86 IENGTYGICEVSGKEIPYERL 106 >gi|229087390|ref|ZP_04219529.1| DNA binding protein, DksA/TraR [Bacillus cereus Rock3-44] gi|228695919|gb|EEL48765.1| DNA binding protein, DksA/TraR [Bacillus cereus Rock3-44] Length = 243 Score = 34.2 bits (78), Expect = 5.8, Method: Composition-based stats. Identities = 11/21 (52%), Positives = 16/21 (76%) Query: 22 IRPGTYVVCAITGQRIPLKKL 42 I GTY VC ++G+ IPL++L Sbjct: 84 IEAGTYGVCEVSGEEIPLERL 104 >gi|284162037|ref|YP_003400660.1| reverse gyrase [Archaeoglobus profundus DSM 5631] gi|284012034|gb|ADB57987.1| reverse gyrase [Archaeoglobus profundus DSM 5631] Length = 1566 Score = 34.2 bits (78), Expect = 6.2, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%) Query: 37 IPLKKLCYWSVDRQVPYANAEASFEAEKISGKIP 70 IPLK L W+V+ Q A+A + + KIP Sbjct: 985 IPLKYLIEWNVNLQEVEREAKAIYRQRPSAKKIP 1018 >gi|294789030|ref|ZP_06754270.1| RNA polymerase-binding protein DksA [Simonsiella muelleri ATCC 29453] gi|294483132|gb|EFG30819.1| RNA polymerase-binding protein DksA [Simonsiella muelleri ATCC 29453] Length = 138 Score = 33.9 bits (77), Expect = 7.7, Method: Composition-based stats. Identities = 17/66 (25%), Positives = 28/66 (42%), Gaps = 7/66 (10%) Query: 3 NKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEA 62 ++ + A I+ + I G Y C TG+ I LK+L + R + EA Sbjct: 77 DRERKLLAKIQ---ESLRDIEEGDYGYCRDTGEPIGLKRL----LARPTATLSVEAQERR 129 Query: 63 EKISGK 68 E+I + Sbjct: 130 ERIKKQ 135 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.312 0.177 0.664 Lambda K H 0.267 0.0549 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,151,826,746 Number of Sequences: 14124377 Number of extensions: 65984364 Number of successful extensions: 98648 Number of sequences better than 10.0: 136 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 11 Number of HSP's that attempted gapping in prelim test: 98521 Number of HSP's gapped (non-prelim): 136 length of query: 71 length of database: 4,842,793,630 effective HSP length: 43 effective length of query: 28 effective length of database: 4,235,445,419 effective search space: 118592471732 effective search space used: 118592471732 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.0 bits) S2: 77 (33.8 bits)