RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780400|ref|YP_003064813.1| hypothetical protein CLIBASIA_01425 [Candidatus Liberibacter asiaticus str. psy62] (71 letters) >gnl|CDD|33695 COG3908, COG3908, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 77 Score = 78.1 bits (192), Expect = 4e-16 Identities = 32/62 (51%), Positives = 44/62 (70%) Query: 9 EASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISGK 68 EA IRY DG F+++ PG++V+CA+TG+ IPL +L YWSV RQ Y +A AS E E+ +G Sbjct: 12 EAVIRYLDGDFQVVSPGSFVLCAVTGKPIPLDELRYWSVARQEAYVDAAASLEREREAGP 71 Query: 69 IP 70 Sbjct: 72 EL 73 >gnl|CDD|31920 COG1734, DksA, DnaK suppressor protein [Signal transduction mechanisms]. Length = 120 Score = 26.5 bits (58), Expect = 1.7 Identities = 13/49 (26%), Positives = 19/49 (38%), Gaps = 6/49 (12%) Query: 6 DENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYA 54 D +R + + I GTY +C G+ IP +L P A Sbjct: 59 DRERKLLRKIESALDRIEEGTYGICEECGEPIPEARL------EARPTA 101 >gnl|CDD|145523 pfam02421, FeoB_N, Ferrous iron transport protein B. Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions. FeoB has been identified as part of this transport system. FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent. Length = 188 Score = 25.5 bits (57), Expect = 3.1 Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Query: 5 VDENEASIRYKDGTFEIIR-PGTY 27 V++ E + +YK EI+ PGTY Sbjct: 34 VEKKEGTFKYKGYEIEIVDLPGTY 57 >gnl|CDD|35586 KOG0365, KOG0365, KOG0365, Beta subunit of farnesyltransferase [Posttranslational modification, protein turnover, chaperones]. Length = 423 Score = 25.3 bits (55), Expect = 3.6 Identities = 11/36 (30%), Positives = 18/36 (50%), Gaps = 7/36 (19%) Query: 25 GTYVVCAITG-------QRIPLKKLCYWSVDRQVPY 53 G Y CA+ ++ L+KL W+V RQ+ + Sbjct: 248 GGYTFCALAALALLNEMDQLNLEKLLEWAVRRQMRF 283 >gnl|CDD|185742 cd09001, GH43_XYL_2, Glycosyl hydrolase family 43, beta-D-xylosidase. This glycosyl hydrolase family 43 (GH43) includes mostly enzymes that have been characterized to have beta-1,4-xylosidase (beta-D-xylosidase;xylan 1,4-beta-xylosidase; EC 3.2.1.37) activity. They are part of an array of hemicellulases that are involved in the final breakdown of plant cell-wall whereby they degrade xylan. They hydrolyze beta-1,4 glycosidic bonds between two xylose units in short xylooligosaccharides. These are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller. Length = 269 Score = 24.8 bits (55), Expect = 5.5 Identities = 10/26 (38%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Query: 10 ASIRYKDGTFEIIRP----GTYVVCA 31 S+RY +GTF + GTY+ A Sbjct: 79 PSLRYHNGTFYVFFCTNTGGTYIYTA 104 >gnl|CDD|39171 KOG3968, KOG3968, KOG3968, Atrazine chlorohydrolase/guanine deaminase [Nucleotide transport and metabolism, Secondary metabolites biosynthesis, transport and catabolism]. Length = 439 Score = 24.9 bits (54), Expect = 5.6 Identities = 10/36 (27%), Positives = 13/36 (36%), Gaps = 2/36 (5%) Query: 29 VCAITGQRIPLKKLCYWSVDRQVPY--ANAEASFEA 62 GQR + K+C VP E S E+ Sbjct: 154 AAIRAGQRALIGKVCMDCNAHAVPKGVETTEESIES 189 >gnl|CDD|31094 COG0751, GlyS, Glycyl-tRNA synthetase, beta subunit [Translation, ribosomal structure and biogenesis]. Length = 691 Score = 24.4 bits (53), Expect = 6.8 Identities = 8/30 (26%), Positives = 15/30 (50%) Query: 11 SIRYKDGTFEIIRPGTYVVCAITGQRIPLK 40 S+R+ IRP ++V + + IP + Sbjct: 149 SMRWGSKDVRFIRPIHWIVALLGDEVIPFE 178 >gnl|CDD|38108 KOG2897, KOG2897, KOG2897, DNA-binding protein YL1 and related proteins [General function prediction only]. Length = 390 Score = 24.3 bits (52), Expect = 7.3 Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 5/55 (9%) Query: 5 VDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEAS 59 + EAS + T +P VVC ITG + Y +PY+ A+A Sbjct: 271 TESGEASFLSEFPTKSPPKPRERVVCVITG-----RPARYLDPVTGLPYSTAQAF 320 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.318 0.136 0.412 Gapped Lambda K H 0.267 0.0846 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 852,223 Number of extensions: 34420 Number of successful extensions: 81 Number of sequences better than 10.0: 1 Number of HSP's gapped: 81 Number of HSP's successfully gapped: 11 Length of query: 71 Length of database: 6,263,737 Length adjustment: 42 Effective length of query: 29 Effective length of database: 5,356,159 Effective search space: 155328611 Effective search space used: 155328611 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.2 bits)