RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780400|ref|YP_003064813.1| hypothetical protein CLIBASIA_01425 [Candidatus Liberibacter asiaticus str. psy62] (71 letters) >gnl|CDD|150527 pfam09866, DUF2093, Uncharacterized protein conserved in bacteria (DUF2093). This domain, found in various hypothetical prokaryotic proteins, has no known function. Length = 42 Score = 71.9 bits (177), Expect = 4e-14 Identities = 22/42 (52%), Positives = 34/42 (80%) Query: 21 IIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEA 62 ++ PG++V+CA+TG+ IPL +L YWSV+RQ YA+AEA+ + Sbjct: 1 VLSPGSFVLCAVTGEPIPLDELRYWSVERQEAYASAEAALQR 42 >gnl|CDD|178481 PLN02893, PLN02893, Cellulose synthase-like protein. Length = 734 Score = 26.2 bits (58), Expect = 2.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Query: 3 NKVDENEASIRYKDGTFE 20 +KV + E S RY+ G FE Sbjct: 625 SKVVDEEQSKRYEQGIFE 642 >gnl|CDD|184106 PRK13516, PRK13516, gamma-glutamyl:cysteine ligase; Provisional. Length = 373 Score = 26.0 bits (58), Expect = 2.3 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Query: 25 GTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEA 62 G V TG+R PL + ++DR P+A A + A Sbjct: 294 GVLVD-PATGERRPLAEDILRTLDRIAPHAEALGASSA 330 >gnl|CDD|181228 PRK08097, ligB, NAD-dependent DNA ligase LigB; Reviewed. Length = 562 Score = 26.0 bits (58), Expect = 2.3 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 22 IRPGTYVVCAITGQRIP-LKKLCYWSVDRQVPYANAEASFEA 62 I PG V+ ++ GQ IP L K+ + +R P F + Sbjct: 360 IAPGDQVLVSLAGQGIPRLDKVVWRGAERTKPTPPDADRFHS 401 >gnl|CDD|116083 pfam07462, MSP1_C, Merozoite surface protein 1 (MSP1) C-terminus. This family represents the C-terminal region of merozoite surface protein 1 (MSP1) which are found in a number of Plasmodium species. MSP-1 is a 200-kDa protein expressed on the surface of the P. vivax merozoite. MSP-1 of Plasmodium species is synthesized as a high-molecular-weight precursor and then processed into several fragments. At the time of red cell invasion by the merozoite, only the 19-kDa C-terminal fragment (MSP-119), which contains two epidermal growth factor-like domains, remains on the surface. Antibodies against MSP-119 inhibit merozoite entry into red cells, and immunisation with MSP-119 protects monkeys from challenging infections. Hence, MSP-119 is considered a promising vaccine candidate. Length = 574 Score = 25.3 bits (55), Expect = 3.8 Identities = 12/37 (32%), Positives = 20/37 (54%) Query: 33 TGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISGKI 69 TG+ +PLK L S+ R+ Y N E ++ G++ Sbjct: 165 TGEAVPLKTLSEVSIQREDNYLNLEKFRVLSRLEGRL 201 >gnl|CDD|184796 PRK14701, PRK14701, reverse gyrase; Provisional. Length = 1638 Score = 24.5 bits (53), Expect = 6.2 Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 35 QRIPLKKLCYWSVDRQVPYANAEASFEAEKISGKIP 70 + IPLK L W+V+ A+A + S KIP Sbjct: 1045 RVIPLKYLIEWNVNLDEVEREAKAIYRQRAGSKKIP 1080 >gnl|CDD|172296 PRK13758, PRK13758, anaerobic sulfatase-maturase; Provisional. Length = 370 Score = 24.5 bits (53), Expect = 6.6 Identities = 12/30 (40%), Positives = 15/30 (50%) Query: 5 VDENEASIRYKDGTFEIIRPGTYVVCAITG 34 ++ N SIRY DG E I G C + G Sbjct: 230 LNGNRVSIRYFDGLLETILLGKSSSCGMNG 259 >gnl|CDD|129639 TIGR00548, lolB, outer membrane lipoprotein LolB. This protein, LolB, is known so far only in the gamma and beta subdivisions of the Proteobacteria. It is a processed, lipid-modified outer membrane protein. It is required in E. coli for insertion of the major outer lipoprotein (Lpp) into the outer membrane. Lpp is transferred to LolB from the carrier protein LolA in the periplasm. Previously, this protein was thought to play in role in 5-aminolevulinic acid synthesis and was designated HemM. Length = 202 Score = 24.2 bits (52), Expect = 7.5 Identities = 9/40 (22%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Query: 32 ITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISGKIPY 71 G R+PL L +W R +P +++ + Y Sbjct: 121 TLGMRLPLSHLLWWV--RGLPAPDSDYRLTLDADLRLATY 158 >gnl|CDD|131473 TIGR02420, dksA, RNA polymerase-binding protein DksA. The model that is the basis for this family describes a small, pleiotropic protein, DksA (DnaK suppressor A), originally named as a multicopy suppressor of temperature sensitivity of dnaKJ mutants. DksA mutants are defective in quorum sensing, virulence, etc. DksA is now understood to bind RNA polymerase directly and modulate its response to small molecules to control the level of transcription of rRNA. Nearly all members of this family are in the Proteobacteria. Whether the closest homologs outside the Proteobacteria function equivalently is unknown. The low value set for the noise cutoff allows identification of possible DksA proteins from outside the proteobacteria. TIGR02419 describes a closely related family of short sequences usually found in prophage regions of proteobacterial genomes or in known phage. Length = 110 Score = 24.1 bits (53), Expect = 7.6 Identities = 9/27 (33%), Positives = 13/27 (48%) Query: 16 DGTFEIIRPGTYVVCAITGQRIPLKKL 42 D + I G Y C G+ I L++L Sbjct: 69 DEALKRIEDGEYGYCEECGEEIGLRRL 95 >gnl|CDD|163061 TIGR02890, spore_yteA, sporulation protein, yteA family. Members of this predicted regulatory protein are found only in endospore-forming members of the Firmicutes group of bacteria, and in nearly every such species; Clostridium perfringens seems to be an exception. The member from Bacillus subtilis, the model system for the study of the sporulation program, has been designated both yteA and yzwB. Some (but not all) members of this family show a strong sequence match to PFAM family pfam01258 the C4-type zinc finger protein, DksA/TraR family, but only one of the four key Cys residues is conserved. All members of this protein family share an additional C-terminal domain. The function of proteins in this family is unknown. YteA was detected in mature spores of Bacillus subtilis by Kuwana, et al., and appears to be expressed under control of sigma-K. Length = 159 Score = 24.2 bits (53), Expect = 7.7 Identities = 9/21 (42%), Positives = 14/21 (66%) Query: 22 IRPGTYVVCAITGQRIPLKKL 42 I GTY +C + G+ IP ++L Sbjct: 81 IENGTYGICEVCGKPIPYERL 101 >gnl|CDD|181913 PRK09501, potD, spermidine/putrescine ABC transporter periplasmic substrate-binding protein; Reviewed. Length = 348 Score = 24.1 bits (52), Expect = 8.0 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 6/29 (20%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVV 29 MY K+ YKDG ++++ P TY V Sbjct: 65 MYAKLKT------YKDGAYDLVVPSTYYV 87 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.318 0.136 0.412 Gapped Lambda K H 0.267 0.0712 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,151,368 Number of extensions: 55621 Number of successful extensions: 109 Number of sequences better than 10.0: 1 Number of HSP's gapped: 109 Number of HSP's successfully gapped: 16 Length of query: 71 Length of database: 5,994,473 Length adjustment: 42 Effective length of query: 29 Effective length of database: 5,086,937 Effective search space: 147521173 Effective search space used: 147521173 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.1 bits)