BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780400|ref|YP_003064813.1| hypothetical protein CLIBASIA_01425 [Candidatus Liberibacter asiaticus str. psy62] (71 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780400|ref|YP_003064813.1| hypothetical protein CLIBASIA_01425 [Candidatus Liberibacter asiaticus str. psy62] Length = 71 Score = 149 bits (375), Expect = 1e-38, Method: Compositional matrix adjust. Identities = 71/71 (100%), Positives = 71/71 (100%) Query: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF Sbjct: 1 MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASF 60 Query: 61 EAEKISGKIPY 71 EAEKISGKIPY Sbjct: 61 EAEKISGKIPY 71 >gi|254781062|ref|YP_003065475.1| putative aminotransferase involved in iron-sulfur cluster biogenesis [Candidatus Liberibacter asiaticus str. psy62] Length = 406 Score = 22.3 bits (46), Expect = 1.7, Method: Composition-based stats. Identities = 7/21 (33%), Positives = 14/21 (66%) Query: 32 ITGQRIPLKKLCYWSVDRQVP 52 + G IP+K++C + +R +P Sbjct: 176 VLGTVIPIKEICRIAHERNIP 196 >gi|254780831|ref|YP_003065244.1| hypothetical protein CLIBASIA_03620 [Candidatus Liberibacter asiaticus str. psy62] Length = 341 Score = 21.6 bits (44), Expect = 2.6, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 12/19 (63%), Gaps = 2/19 (10%) Query: 53 YANAEASFEAEKISGKIPY 71 + N A FEAEKI IP+ Sbjct: 280 FGNGGARFEAEKIG--IPF 296 >gi|254780451|ref|YP_003064864.1| aconitate hydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 896 Score = 20.0 bits (40), Expect = 7.5, Method: Compositional matrix adjust. Identities = 9/26 (34%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Query: 7 ENEASIRYKDGTFEIIRPGTYVVCAI 32 E+ I Y DGTF+ + ++C I Sbjct: 852 ESTLEIHYSDGTFKCVP----IICCI 873 >gi|254780374|ref|YP_003064787.1| flagellar basal body L-ring protein [Candidatus Liberibacter asiaticus str. psy62] Length = 238 Score = 20.0 bits (40), Expect = 8.1, Method: Composition-based stats. Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 2 YNKVDENEASIRYKDGTFEIIRP 24 Y+K+ E S K T E++RP Sbjct: 203 YDKIAEARISYGGKGRTTELLRP 225 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.318 0.136 0.412 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,998 Number of Sequences: 1233 Number of extensions: 1438 Number of successful extensions: 6 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 71 length of database: 328,796 effective HSP length: 42 effective length of query: 29 effective length of database: 277,010 effective search space: 8033290 effective search space used: 8033290 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.8 bits) S2: 31 (16.5 bits)