HHsearch alignment of GI: 254780401 and MMDB domain: 2f1r_A_1-44_95-171

>2f1r_A (A:1-44,A:95-171) Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus}
Probab=94.80  E-value=0.025  Score=36.77  Aligned_cols=31  Identities=16%  Similarity=0.247  Sum_probs=28.3

Q ss_pred             EECCCCCCHHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             0078887489999999985247315987604
Q gi|254780401|r   53 VMGGTGKTPTALAIAKAVIDKNLKPGFLSRG   83 (338)
Q Consensus        53 tvGGtGKTP~v~~l~~~l~~~g~~~~ilsRG   83 (338)
                      -..|+|||-++..|+++|+++|+++++++.-
T Consensus         9 G~~G~GKTT~~~~l~~~l~~~g~~v~vi~~D   39 (121)
T 2f1r_A            9 GTSDSGKTTLITRMMPILRERGLRVAVVKRH   39 (121)
T ss_dssp             ESCHHHHHHHHHHHHHHHHHTTCCEEEEEC-
T ss_pred             CCCCCCHHHHHHHHHHHHCCCCCEEEEECEE
T ss_conf             8899539999999983418788689990664