HHsearch results for GI: 254780401 and protein with PDBid: 3k9g_A

>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide, SAD phasing; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A
Probab=93.43  E-value=0.065  Score=32.70  Aligned_cols=37  Identities=27%  Similarity=0.442  Sum_probs=30.9

Q ss_pred             CEEEECCEEECCCCCCHHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             889982300078887489999999985247315987604
Q gi|254780401|r   45 PVICVGGFVMGGTGKTPTALAIAKAVIDKNLKPGFLSRG   83 (338)
Q Consensus        45 pVI~VGNitvGGtGKTP~v~~l~~~l~~~g~~~~ilsRG   83 (338)
                      .||+|.|- =||+|||-++.-||..|. +|++|.++.=-
T Consensus        28 kvI~v~s~-KGGVGKTT~a~nLA~~la-~g~rVllID~D   64 (267)
T 3k9g_A           28 KIITIASI-KGGVGKSTSAIILATLLS-KNNKVLLIDMD   64 (267)
T ss_dssp             EEEEECCS-SSSSCHHHHHHHHHHHHT-TTSCEEEEEEC
T ss_pred             EEEEEECC-CCCCHHHHHHHHHHHHHH-CCCCEEEEECC
T ss_conf             79999899-997589999999999998-79988999689