HHSEARCH alignment of GI: 254780401 and SCOP domain: d1hyqa_

Alignment
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
Probab=92.45  E-value=0.042  Score=32.37  Aligned_cols=36  Identities=25%  Similarity=0.280  Sum_probs=30.4

Q ss_pred             CEEEECCEEECCCCCCHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             8899823000788874899999999852473159876
Q gi|254780401|r   45 PVICVGGFVMGGTGKTPTALAIAKAVIDKNLKPGFLS   81 (338)
Q Consensus        45 pVI~VGNitvGGtGKTP~v~~l~~~l~~~g~~~~ils   81 (338)
                      .||+|-|. -||.|||-++.-||..|.++|++|+++-
T Consensus         2 kvIav~s~-KGGvGKTtia~nlA~~la~~g~~VlliD   37 (232)
T d1hyqa_           2 RTITVASG-KGGTGKTTITANLGVALAQLGHDVTIVD   37 (232)
T ss_dssp             EEEEEEES-SSCSCHHHHHHHHHHHHHHTTCCEEEEE
T ss_pred             EEEEEECC-CCCCHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             79999799-9998099999999999996899899995


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Cell division regulator MinD
species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]