RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780402|ref|YP_003064815.1| 3-deoxy-D-manno-octulosonic-acid transferase [Candidatus Liberibacter asiaticus str. psy62] (440 letters) >gnl|CDD|31708 COG1519, KdtA, 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane]. Length = 419 Score = 406 bits (1045), Expect = e-114 Identities = 169/420 (40%), Positives = 244/420 (58%), Gaps = 7/420 (1%) Query: 9 LLGIYRWGGIFFMPFLSVSLSLYRVFNRERGRKF-GERLG-YPTALRPIGPLIWFHASSV 66 L +YR +PF++ L LYR F + RK GER G Y ++P GPL+W HA+SV Sbjct: 1 LRFLYRLLLTLALPFIAPRL-LYRSFKGPKYRKRLGERFGFYKPPVKPEGPLVWIHAASV 59 Query: 67 GETMALIGLIPAIRSRH--VNVLLTTMTATSAKVARKYLGQYAIHQYAPLDIQPAVSRFL 124 GE +A + L+ A+R R + +L+TTMT T A+ A G IHQY PLD+ AV RFL Sbjct: 60 GEVLAALPLVRALRERFPDLRILVTTMTPTGAERAAALFGDSVIHQYLPLDLPIAVRRFL 119 Query: 125 KYWKPDCMILSESDIWPLTVFELSKQRIPQVLVNARMSRRSFKNWKTVLSFSKKIFSQFS 184 + W+P +I+ E+++WP + EL ++ IP VLVNAR+S RSF + + ++ +F Sbjct: 120 RKWRPKLLIIMETELWPNLINELKRRGIPLVLVNARLSDRSFARYAKLKFLARLLFKNID 179 Query: 185 LVIVQSERYFRRYKELGAQKLIVSGNLKIDTESLPCDKELLSLYQESIAG-RYTWAAIST 243 L++ QSE +R++ LGA+ ++V+GNLK D E P L+ + + G R W A ST Sbjct: 180 LILAQSEEDAQRFRSLGAKPVVVTGNLKFDIEPPPQLAAELAALRRQLGGHRPVWVAAST 239 Query: 244 FEGEEDKAVYVH-NFIKCRTDVLTIIVPRHPRRCDAIERRLIAKGLKVARRSRGDVINAE 302 EGEE+ + H K ++L I+VPRHP R A+E L KGL V RRS+GD ++ Sbjct: 240 HEGEEEIILDAHQALKKQFPNLLLILVPRHPERFKAVENLLKRKGLSVTRRSQGDPPFSD 299 Query: 303 VDIFLGDTIGEMGFYLRMTEIAFIGRSFCASGGQNPLEAAMLGCAILSGPNVENFRDIYR 362 D+ LGDT+GE+G + +IAF+G S GG NPLE A G ++ GP NF DI Sbjct: 300 TDVLLGDTMGELGLLYGIADIAFVGGSLVPIGGHNPLEPAAFGTPVIFGPYTFNFSDIAE 359 Query: 363 RMVSSGAVRIVEEVGTLADMVYSLLSEPTIRYEMINAAINEVKKMQGPLKITLRSLDSYV 422 R++ +GA VE+ LA V LL++ R A + + + +G L TL +L Y+ Sbjct: 360 RLLQAGAGLQVEDADLLAKAVELLLADEDKREAYGRAGLEFLAQNRGALARTLEALKPYL 419 >gnl|CDD|146849 pfam04413, Glycos_transf_N, 3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family. Length = 186 Score = 207 bits (529), Expect = 5e-54 Identities = 76/181 (41%), Positives = 115/181 (63%), Gaps = 6/181 (3%) Query: 42 FGERLGYPTALRPI--GPLIWFHASSVGETMALIGLIPAIRSRH--VNVLLTTMTATSAK 97 ER G+ + P GPLIW HA+SVGE +A + LI A+++R+ + +L+TT T T A+ Sbjct: 5 LRERFGFASPPPPQGGGPLIWLHAASVGEVLAALPLIEALKARYPGLRILVTTTTPTGAE 64 Query: 98 VARKYLGQYAIHQYAPLDIQPAVSRFLKYWKPDCMILSESDIWPLTVFELSKQRIPQVLV 157 +ARK L IHQY PLD+ AV RFLK+W+PD +++ E+++WP + K+ IP VLV Sbjct: 65 LARKLLPDRVIHQYLPLDLPGAVRRFLKHWRPDLLVIVETELWPNLIAAAKKRGIPVVLV 124 Query: 158 NARMSRRSFKNWKTVLSFSKKIFSQFSLVIVQSERYFRRYKELGA--QKLIVSGNLKIDT 215 NAR+S RS + ++ + + +F L++ QSE R++ LGA ++ V+GNLK D Sbjct: 125 NARLSERSARRYRRFPGLFRPLLRRFDLILAQSEEDAERFRALGAPPDRVEVTGNLKFDA 184 Query: 216 E 216 Sbjct: 185 A 185 >gnl|CDD|99990 cd03820, GT1_amsD_like, This family is most closely related to the GT1 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.. Length = 348 Score = 34.5 bits (80), Expect = 0.055 Identities = 30/148 (20%), Positives = 54/148 (36%), Gaps = 13/148 (8%) Query: 95 SAKVARKYLGQYAIH-QYAPLDIQPAVSRFLKYWKPDCMILSESDIWPLTVFELSKQRIP 153 K+ LG A + + LK KPD +I + LT +I Sbjct: 49 DPKIKVIDLGDKRDSKLLARFKKLRRLRKLLKNNKPDVVISFLT--SLLTFLASLGLKIV 106 Query: 154 QVLVNARMSRRSFKNWKTVLSFSKKIFSQFSLVIVQSERYFRRYKELGAQKLIVSGN-LK 212 +++V+ S ++K L + ++ + V+V +E Y + + ++V N L Sbjct: 107 KLIVSEHNSPDAYKKRLRRLLLRRLLYRRADAVVVLTEEDRALYYKKFNKNVVVIPNPLP 166 Query: 213 IDTESLPCD---KELLSLYQESIAGRYT 237 E D K +L+ GR Sbjct: 167 FPPEEPSSDLKSKRILA------VGRLV 188 >gnl|CDD|113327 pfam04552, Sigma54_DBD, Sigma-54, DNA binding domain. This DNA binding domain is based on peptide fragmentation data. This domain is proximal to DNA in the promoter/holoenzyme complex. Furthermore this region contains a putative helix-turn-helix motif. At the C-terminus, there is a highly conserved region known as the RpoN box and is the signature of the sigma-54 proteins. Length = 160 Score = 31.0 bits (71), Expect = 0.72 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 9/58 (15%) Query: 239 AAISTFEGEEDKAVYVHNFIKCRTDVLTII---VPRHPRRCDAIERRLIAKGLKVARR 293 +A+ST G E A + IK +I P+ P D I L +G+ +ARR Sbjct: 90 SAVSTSGGGEASATAIRALIK------KLIAAEDPKKPLSDDKIVELLKEQGIDIARR 141 >gnl|CDD|88409 cd05014, SIS_Kpsf, KpsF-like protein. KpsF is an arabinose-5-phosphate isomerase which contains SIS (Sugar ISomerase) domains. SIS domains are found in many phosphosugar isomerases and phosphosugar binding proteins. KpsF catalyzes the reversible reaction of ribulose 5-phosphate to arabinose 5-phosphate. This is the second step in the CMP-Kdo biosynthesis pathway.. Length = 128 Score = 29.7 bits (67), Expect = 1.6 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 2/60 (3%) Query: 64 SSVGETMALIGLIPAIRSRHVNVLLTTMTATS--AKVARKYLGQYAIHQYAPLDIQPAVS 121 S+ GET L+ L+P ++ R ++ T S AK++ L + PL + P S Sbjct: 55 SNSGETDELLNLLPHLKRRGAPIIAITGNPNSTLAKLSDVVLDLPVEEEACPLGLAPTTS 114 >gnl|CDD|99982 cd03811, GT1_WabH_like, This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.. Length = 353 Score = 28.8 bits (65), Expect = 3.1 Identities = 28/158 (17%), Positives = 56/158 (35%), Gaps = 13/158 (8%) Query: 72 LIGLIPAIRSRHVNVLLTTMTAT-------SAKVARKYLGQYAIHQYAPLDIQPAVSRFL 124 L+ L + R +V L + + V + + L + R L Sbjct: 18 LLNLANGLDKRGYDVTLVVLRDEGDYLELLPSNVKLIPVRVLKLKSLRDLLAILRLRRLL 77 Query: 125 KYWKPDCMILSESDIWPLTVFELSKQRIPQVLVNARMSR-RSFKNWKTVLSFSKKIFSQF 183 + KPD ++S P + L+ + +++V S K +L +K++ + Sbjct: 78 RKEKPDV-VISHLTTTPNVLALLAARLGTKLIVWEHNSLSLELKRKLRLLLLIRKLYRRA 136 Query: 184 SLVIVQSE---RYFRRYKELGAQKLIVSGNLKIDTESL 218 ++ SE + + K+ V N ID E + Sbjct: 137 DKIVAVSEGVKEDLLKLLGIPPDKIEVIYNP-IDIEEI 173 >gnl|CDD|31137 COG0794, GutQ, Predicted sugar phosphate isomerase involved in capsule formation [Cell envelope biogenesis, outer membrane]. Length = 202 Score = 28.3 bits (63), Expect = 4.4 Identities = 30/111 (27%), Positives = 38/111 (34%), Gaps = 21/111 (18%) Query: 39 GRKFGERL---GYP-----------TALRPIGP---LIWFHASSVGETMALIGLIPAIRS 81 G+KF RL G P L I P +I S GET L+ L P + Sbjct: 54 GKKFAARLASTGTPAFFVGPAEALHGDLGMITPGDVVIAISGS--GETKELLNLAPKAKR 111 Query: 82 RHVNVLLTTMTATS--AKVARKYLGQYAIHQYAPLDIQPAVSRFLKYWKPD 130 ++ T S AK A L + PL + P S L D Sbjct: 112 LGAKLIAITSNPDSSLAKAADVVLVIPVKTEACPLGLAPTTSTTLTLALGD 162 >gnl|CDD|58511 cd01834, SGNH_hydrolase_like_2, SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.. Length = 191 Score = 27.2 bits (60), Expect = 9.5 Identities = 21/113 (18%), Positives = 34/113 (30%), Gaps = 40/113 (35%) Query: 296 GDVINAEVDIFLGDTIGEMGFYLRMTE-----------IAFIGRSFC---ASGGQNPLEA 341 GD I +F+G++I + G Y+ E + F + S + Sbjct: 1 GDRI-----VFIGNSITDRGGYVGYVETYLAARYPELKLTFRNLGWSGDTVSDLAARRDR 55 Query: 342 -----------AMLG-----CAILSGPNVENFRDIYRRMVSS-----GAVRIV 373 M G +E F+ RR++ A RIV Sbjct: 56 DVLPAKPDVVSIMFGINDSFRGFDDPVGLEKFKTNLRRLIDRLKNKESAPRIV 108 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.325 0.139 0.414 Gapped Lambda K H 0.267 0.0781 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 5,331,829 Number of extensions: 285873 Number of successful extensions: 912 Number of sequences better than 10.0: 1 Number of HSP's gapped: 907 Number of HSP's successfully gapped: 16 Length of query: 440 Length of database: 6,263,737 Length adjustment: 97 Effective length of query: 343 Effective length of database: 4,167,664 Effective search space: 1429508752 Effective search space used: 1429508752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 59 (26.4 bits)