RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780403|ref|YP_003064816.1| hypothetical protein CLIBASIA_01440 [Candidatus Liberibacter asiaticus str. psy62] (80 letters) >gnl|CDD|179244 PRK01198, PRK01198, V-type ATP synthase subunit C; Provisional. Length = 352 Score = 27.5 bits (62), Expect = 0.85 Identities = 15/67 (22%), Positives = 29/67 (43%), Gaps = 8/67 (11%) Query: 7 EEQVLYLVFGGELENITQKKMRNPDDI-DVVGIFSSY------SNAYDVW-KEKSQQMVD 58 EE L+ GEL+ K++ + ++V I A + + + Q ++ Sbjct: 122 EEIEELLIPAGELDLEKLKELLEAKSVEEIVKILEGTEYYEVLEEALEDYEETGDLQPIE 181 Query: 59 NALMRYF 65 NAL +Y+ Sbjct: 182 NALDKYY 188 >gnl|CDD|128434 smart00129, KISc, Kinesin motor, catalytic domain. ATPase. Microtubule-dependent molecular motors that play important roles in intracellular transport of organelles and in cell division. Length = 335 Score = 25.6 bits (57), Expect = 2.9 Identities = 8/28 (28%), Positives = 17/28 (60%) Query: 37 GIFSSYSNAYDVWKEKSQQMVDNALMRY 64 +F + ++ DV++E + +VD+ L Y Sbjct: 52 KVFGATASQEDVFEETAAPLVDSVLEGY 79 >gnl|CDD|178529 PLN02941, PLN02941, inositol-tetrakisphosphate 1-kinase. Length = 328 Score = 25.3 bits (56), Expect = 3.4 Identities = 8/13 (61%), Positives = 11/13 (84%) Query: 63 RYFVVDISRFPHY 75 RY+V+DI+ FP Y Sbjct: 294 RYYVIDINYFPGY 306 >gnl|CDD|181438 PRK08471, flgK, flagellar hook-associated protein FlgK; Validated. Length = 613 Score = 25.0 bits (55), Expect = 4.2 Identities = 7/29 (24%), Positives = 14/29 (48%) Query: 32 DIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60 D+D GI + ++ W + + D+A Sbjct: 104 DLDDTGILKDLQDYFNAWNDFASNPKDSA 132 >gnl|CDD|182761 PRK10828, PRK10828, putative oxidoreductase; Provisional. Length = 183 Score = 24.6 bits (54), Expect = 6.3 Identities = 8/16 (50%), Positives = 11/16 (68%) Query: 16 GGELENITQKKMRNPD 31 G +L+NI + MR PD Sbjct: 23 GEQLQNILRAGMRAPD 38 >gnl|CDD|184147 PRK13566, PRK13566, anthranilate synthase; Provisional. Length = 720 Score = 24.5 bits (54), Expect = 7.1 Identities = 13/30 (43%), Positives = 15/30 (50%), Gaps = 4/30 (13%) Query: 11 LYLVFGGEL----ENITQKKMRNPDDIDVV 36 LY FG +L E I QK R D D+V Sbjct: 157 LYGAFGYDLAFQFEPIEQKLPRPDDQRDLV 186 >gnl|CDD|181902 PRK09489, rsmC, 16S ribosomal RNA m2G1207 methyltransferase; Provisional. Length = 342 Score = 23.7 bits (52), Expect = 9.6 Identities = 9/31 (29%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 30 PDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60 P +D + ++ + W+ S+QM DNA Sbjct: 34 PAQLDAASV-RVHTQQFHHWQVLSRQMGDNA 63 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.319 0.138 0.397 Gapped Lambda K H 0.267 0.0681 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,359,321 Number of extensions: 69550 Number of successful extensions: 132 Number of sequences better than 10.0: 1 Number of HSP's gapped: 131 Number of HSP's successfully gapped: 17 Length of query: 80 Length of database: 5,994,473 Length adjustment: 50 Effective length of query: 30 Effective length of database: 4,914,073 Effective search space: 147422190 Effective search space used: 147422190 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.1 bits)