BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780403|ref|YP_003064816.1| hypothetical protein CLIBASIA_01440 [Candidatus Liberibacter asiaticus str. psy62] (80 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780403|ref|YP_003064816.1| hypothetical protein CLIBASIA_01440 [Candidatus Liberibacter asiaticus str. psy62] Length = 80 Score = 166 bits (420), Expect = 6e-44, Method: Compositional matrix adjust. Identities = 80/80 (100%), Positives = 80/80 (100%) Query: 1 MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60 MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA Sbjct: 1 MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60 Query: 61 LMRYFVVDISRFPHYELGKE 80 LMRYFVVDISRFPHYELGKE Sbjct: 61 LMRYFVVDISRFPHYELGKE 80 >gi|254780570|ref|YP_003064983.1| phosphoribosylglycinamide formyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 205 Score = 25.0 bits (53), Expect = 0.26, Method: Compositional matrix adjust. Identities = 11/41 (26%), Positives = 23/41 (56%) Query: 16 GGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQM 56 G + ++ Q +N ++VG+FS SNA + K + +++ Sbjct: 14 GTNMLSLIQATKKNDYPAEIVGVFSDNSNAQGLVKARKEKV 54 >gi|254780355|ref|YP_003064768.1| type II citrate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 429 Score = 24.6 bits (52), Expect = 0.32, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 14/18 (77%) Query: 9 QVLYLVFGGELENITQKK 26 +V YL+ GEL N++Q+K Sbjct: 84 EVCYLLLHGELANVSQQK 101 >gi|254780212|ref|YP_003064625.1| bacterioferritin comigratory protein [Candidatus Liberibacter asiaticus str. psy62] Length = 157 Score = 22.7 bits (47), Expect = 1.1, Method: Compositional matrix adjust. Identities = 8/10 (80%), Positives = 9/10 (90%) Query: 44 NAYDVWKEKS 53 +YDVWKEKS Sbjct: 101 KSYDVWKEKS 110 >gi|254780635|ref|YP_003065048.1| hypothetical protein CLIBASIA_02610 [Candidatus Liberibacter asiaticus str. psy62] Length = 412 Score = 21.9 bits (45), Expect = 2.4, Method: Compositional matrix adjust. Identities = 8/13 (61%), Positives = 10/13 (76%) Query: 34 DVVGIFSSYSNAY 46 DV+GI SSY+ Y Sbjct: 299 DVIGIISSYTGEY 311 >gi|254780894|ref|YP_003065307.1| hypothetical protein CLIBASIA_03955 [Candidatus Liberibacter asiaticus str. psy62] Length = 103 Score = 20.4 bits (41), Expect = 6.6, Method: Compositional matrix adjust. Identities = 8/24 (33%), Positives = 14/24 (58%) Query: 36 VGIFSSYSNAYDVWKEKSQQMVDN 59 VGI+ AY + + ++Q +DN Sbjct: 50 VGIYDKDHFAYPILAKSARQRIDN 73 >537021.9.peg.472_1 Length = 369 Score = 20.4 bits (41), Expect = 6.8, Method: Composition-based stats. Identities = 10/40 (25%), Positives = 17/40 (42%) Query: 34 DVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDISRFP 73 D++ + +S+ YD S + D A + V I P Sbjct: 247 DIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIP 286 >gi|254780419|ref|YP_003064832.1| aspartyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 622 Score = 20.0 bits (40), Expect = 7.1, Method: Compositional matrix adjust. Identities = 12/47 (25%), Positives = 22/47 (46%) Query: 18 ELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRY 64 E+ + Q + N + + G+F +SN V + D+A+ RY Sbjct: 240 EMSFVEQDDILNTMENVLRGVFEEFSNGNTVSNNFLRICYDDAIRRY 286 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.138 0.397 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,185 Number of Sequences: 1233 Number of extensions: 1932 Number of successful extensions: 8 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 80 length of database: 328,796 effective HSP length: 49 effective length of query: 31 effective length of database: 268,379 effective search space: 8319749 effective search space used: 8319749 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 31 (16.5 bits)