RPSBLAST alignment for GI: 254780404 and conserved domain: KOG3099

>gnl|CDD|38309 KOG3099, KOG3099, KOG3099, Bisphosphate 3'-nucleotidase BPNT1/Inositol polyphosphate 1-phosphatase [Nucleotide transport and metabolism]. Length = 340
 Score = 51.2 bits (122), Expect = 3e-07
 Identities = 46/183 (25%), Positives = 77/183 (42%), Gaps = 25/183 (13%)

Query: 94  LSEETDDDLQRLNYETLFV-VDPIDGTRAFIEGRNEWCISV--AVVHHGRPVIGVVH--- 147
           L E    +L+ L  E L + VDP+DGT  +I G  + C++V   + + GR V GV++   
Sbjct: 129 LDEACPSELKNLPEEDLGIWVDPLDGTAEYITGGLD-CVTVLIGIAYKGRAVGGVINQPF 187

Query: 148 ----ASALGKEFFVSVGMKS------TCNGKNISVSSNQMSDSLAIMASDVSLKGLDSYV 197
                  LG+  +   G+        T N + I  ++   S+S        S   L +++
Sbjct: 188 YEEPDVYLGRTIWGVEGLGVNGFPAHTGNAEAIVTTTRSHSNSS-------SQDALVAFL 240

Query: 198 RFRRQSSISSLCLRILMIASGEVDVLIVDRNA-NDWDLAAADLLLECSGGALVDIDRKLL 256
                  +     ++L +  G+VD  +        WD  A + +L   GG L DI   +L
Sbjct: 241 DGDEVEKVGGAGFKVLKVVEGKVDAYVFASPGCKKWDTCAPEAILRALGGDLTDIAGSVL 300

Query: 257 TYN 259
            Y 
Sbjct: 301 KYV 303