RPSBLAST alignment of GI: 254780404 and MMDB domain: 2pcr_A_

>2pcr_A (A:) Inositol-1-monophosphatase; bipolar disorder, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.60A {Aquifex aeolicus VF5}Length = 264
 Score =  103 bits (257), Expect = 3e-23
 Identities = 45/257 (17%), Positives = 95/257 (36%), Gaps = 21/257 (8%)

Query: 30  EWKQDLDIVRSAVQGASTVAMQYFLRSPNVWWKHEG-SSPVCDADIAVNDYLESFLRPLR 88
             K+ L++ + A      V  + F +      + +G    V   D    + ++  +    
Sbjct: 3   NLKKYLEVAKIAALAGGQVLKENFGKVKKENIEEKGEKDFVSYVDKTSEERIKEVILKFF 62

Query: 89  PAYGWLSEETDDDLQRLNYETLFVVDPIDGTRAFIEGRNEWCISVAVVHHGRPVIGVVHA 148
           P +  + EE   +      E  + +DP+DGT+ +I G   + +SV +V    P++G V+ 
Sbjct: 63  PDHEVVGEEXGAE--GSGSEYRWFIDPLDGTKNYINGFPIFAVSVGLVKGEEPIVGAVYL 120

Query: 149 SALGKEFFVSVGMKSTCNGKNISVSSNQMSDSLAIMASDVSLKG----------LDSYVR 198
               K ++ + G+ +  NGK I V  N+      ++    S              D +  
Sbjct: 121 PYFDKLYWGAKGLGAYVNGKRIKVKDNESLKHAGVVYGFPSRSRRDISIYLNIFKDVFYE 180

Query: 199 FRRQSSISSLCLRILMIASGEVDVLIVDRNANDWDLAAADLLLECSGGALVDIDRKLLTY 258
                   +  + +  +A G  D    +     WD+ A  ++L+ +GG       +    
Sbjct: 181 VGSXRRPGAAAVDLCXVAEGIFDG-XXEFEXKPWDITAGLVILKEAGGVYTL-VGEPFGV 238

Query: 259 NRSQVNHEVLFASAKWH 275
           +       ++  +   H
Sbjct: 239 SD------IIAGNKALH 249