>TIGR00497 hsdM type I restriction-modification system, M subunit; InterPro: IPR004546 There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements , , as summarised below: Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA. Type I restriction endonucleases are components of prokaryotic DNA restriction-modification mechanisms that protects the organism against invading foreign DNA. Type I enzymes have three different subunits subunits - M (modification), S (specificity) and R (restriction) - that form multifunctional enzymes with restriction (3.1.21.3 from EC), methylase (2.1.1.72 from EC) and ATPase activities , . The S subunit is required for both restriction and modification and is responsible for recognition of the DNA sequence specific for the system. The M subunit is necessary for modification, and the R subunit is required for restriction. These enzymes use S-Adenosyl-L-methionine (AdoMet) as the methyl group donor in the methylation reaction, and have a requirement for ATP. They recognize asymmetric DNA sequences split into two domains of specific sequence, one 3-4 bp long and another 4-5 bp long, separated by a nonspecific spacer 6-8 bp in length. Cleavage occurs a considerable distance from the recognition sites, rarely less than 400 bp away and up to 7000 bp away. Adenosyl residues are methylated, one on each strand of the recognition sequence. These enzymes are widespread in eubacteria and archaea. In enteric bacteria they have been subdivide into four families: types IA, IB, IC and ID. This entry represents the M subunit (HsdM) of type I restriction endonucleases such as EcoRI (3.1.21.3 from EC), which recognises the DNA sequence 5'-GAATTC. The M subunit (HsdM) functions in methylation of specific adenine residues, which is required for both restriction and modification activities , , . Methylation of specific residues prevents the host from digesting its own genome via its restriction enzymes. The M and S subunits together form a methyltransferase that methylates two adenine residues in complementary strands of a bipartite DNA recognition sequence. In the presence of the R subunit, the complex can also act as an endonuclease, binding to the same target sequence but cutting the DNA some distance from this site. Whether the DNA is cut or modified depends on the methylation state of the target sequence: when the target site is unmodified, the DNA is cut; when the target site is hemi-methylated, the complex acts as a maintenance methyltransferase, modifying the DNA so that both strands become methylated.; GO: 0003677 DNA binding, 0009007 site-specific DNA-methyltransferase (adenine-specific) activity, 0006306 DNA methylation.

Probab=91.10  E-value=0.086  Score=31.48  Aligned_cols=106  Identities=20%  Similarity=0.130  Sum_probs=68.7

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCCHHHHHC-CCC-----CCHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             8677858999999987763336455896786110012221001101-687-----3301110001235667642001332
Q gi|254780405|r   23 SIRPSDSRTKKALFDILTHVYPVFLDSTRMLNIFAGTGSVGFEALS-RGC-----HYVLFVDNNSESIRLIRRNSELLGV   96 (189)
Q Consensus        23 ~~RPt~~~vrealFniL~~~~~~~~~~~~vlDlfaGsG~lgiEalS-rGA-----~~v~~vE~~~~a~~~lk~N~~~~~~   96 (189)
T Consensus       201 g~~~~p~~~~~~~~~~~~~~~~---~~~~~~d~~cg~g~~~~~~~~~~g~~~~~~~~~~g~~~~~~~~~~c~~~~~~~~~  277 (516)
T TIGR00497       201 GEFFTPQDVSELLAKIALGGKD---TVDDVYDPCCGSGSLLLQFSKVLGKDKNSLKGYFGQEINLTTYNLCRLNLFLHDI  277 (516)
T ss_pred             CCCCCHHHHHHHHHHHHCCCCC---HHHHHHHHCCCCCHHHHHHHHHHCCCHHHHHHHCCCHHCCHHHHHHHHHHHHHHC
T ss_conf             6544625589898876404520---0234443104751367787877323101122220210011034455554555312


Q ss_pred             C-CCHHHHHHHHHHHH-------HHCCCCCCCCCCCCHHHHHC
Q ss_conf             2-10022344566542-------10034444310151343100
Q gi|254780405|r   97 E-KNCNIFFRDVLRLG-------KIGNISPFQLVYLDPPYGQG  131 (189)
Q Consensus        97 ~-~~~~ii~~D~~~~~-------~~~~~~~fDiIf~DPPY~~~  131 (189)
T Consensus       278 ~~~~~~~~~~d~~~~~~~~~~~~~c~~~~~~~~~~~~pp~~~~  320 (516)
T TIGR00497       278 DYANFNIANGDTLLDPEWEKHYVNCSDDEGFDAVVSNPPYSTK  320 (516)
T ss_pred             CCCCCEECCCCCCCCCHHHHCCCCCCCCCCCEEEECCCCCCEE
T ss_conf             3001000023100362012100124677773245537874200