HHsearch alignment for GI: 254780405 and conserved domain: TIGR03587

>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase. Members of this small clade are methyltransferases of the pfam08241 family and are observed within operons for the biosynthesis of pseudaminic acid, a component of exopolysaccharide and flagellin glycosyl modifications. Notable among these genomes is Pseudomonas fluorescens PfO-1. Possibly one of the two hydroxyl groups of pseudaminic acid, at positions 4 and 8 is converted to a methoxy group by this enzyme
Probab=93.94  E-value=0.051  Score=32.86  Aligned_cols=106  Identities=20%  Similarity=0.179  Sum_probs=64.4

Q ss_pred             HHHHHHHHHHHCCCCCCCCCEEEECCCCCCCCHHHHHCC--CCCCHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHH
Q ss_conf             999999877633364558967861100122210011016--873301110001235667642001332210022344566
Q gi|254780405|r   31 TKKALFDILTHVYPVFLDSTRMLNIFAGTGSVGFEALSR--GCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVL  108 (189)
Q Consensus        31 vrealFniL~~~~~~~~~~~~vlDlfaGsG~lgiEalSr--GA~~v~~vE~~~~a~~~lk~N~~~~~~~~~~~ii~~D~~  108 (189)
T Consensus        29 sn~~~f~~~l~~---~~~ikSilE~GcNIGl-NL~ALk~L~P~~~l~gIEIN~~A~~~lk~~~~------~~~i~n~SIl   98 (204)
T TIGR03587        29 AKLAMFARALNR---LPKIASILELGANIGM-NLAALKRLLPFKHIYGVEINEYAVEKAKAYLP------NINIIQGSLF   98 (204)
T ss_pred             HHHHHHHHHHHC---CCCCCEEEEECCCCCH-HHHHHHHHCCCCEEEEEECCHHHHHHHHHHCC------CCEEEECCCC
T ss_conf             899999999835---7888826896688477-69999874874404999539999999986589------7269965334


Q ss_pred             HHHHHCCCCCCCCCCC-------CHHHHHCCHHHHHHHHHHCCCCCCCEEEEEEC
Q ss_conf             5421003444431015-------13431000288898887448888974999981
Q gi|254780405|r  109 RLGKIGNISPFQLVYL-------DPPYGQGLAQQALAIIDKEGWLEPNALVIIEE  156 (189)
Q Consensus       109 ~~~~~~~~~~fDiIf~-------DPPY~~~~~~~~l~~l~~~~~L~~~gliiiE~  156 (189)
T Consensus        99 d~---~~~~~~DLv~t~GVLIHinP~~----L~~vy~~l~~---~s~kyili~EY  143 (204)
T TIGR03587        99 DP---FKDNFFDLVLTKGVLIHINPDN----LPTAYRELYR---CSNRYILIAEY  143 (204)
T ss_pred             CC---CCCCCEEEEEEEEEEEEECHHH----HHHHHHHHHH---HHCCEEEEEEE
T ss_conf             66---7787423899830899978899----9999999998---52055999994