RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780405|ref|YP_003064818.1| hypothetical protein CLIBASIA_01450 [Candidatus Liberibacter asiaticus str. psy62] (189 letters) >gnl|CDD|31085 COG0742, COG0742, N6-adenine-specific methylase [DNA replication, recombination, and repair]. Length = 187 Score = 170 bits (433), Expect = 2e-43 Identities = 72/189 (38%), Positives = 120/189 (63%), Gaps = 7/189 (3%) Query: 3 KIRIIGGKFQRRLLHTPQNRSIRPSDSRTKKALFDILTHVYPVFLDSTRMLNIFAGTGSV 62 ++RIIGGK++ R L TP RP+ R ++ALF+IL ++ R+L++FAG+G++ Sbjct: 1 QMRIIGGKYKGRKLKTPDGPGTRPTTDRVREALFNILAPDE---IEGARVLDLFAGSGAL 57 Query: 63 GFEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVLR-LGKIGNISPFQL 121 G EALSRG V+FV+ + +++++++ N + LG+E + D LR L ++G PF L Sbjct: 58 GLEALSRGAARVVFVEKDRKAVKILKENLKALGLEGEARVLRNDALRALKQLGTREPFDL 117 Query: 122 VYLDPPYGQGLAQQALAII--DKEGWLEPNALVIIEEYAGTCI-SVGAAFHFLQERKYGD 178 V+LDPPY +GL + LA++ ++ GWL+P AL+++E + + A F +E+KYG Sbjct: 118 VFLDPPYAKGLLDKELALLLLEENGWLKPGALIVVEHDKDVELPELPANFELHREKKYGQ 177 Query: 179 TKIYFFSYN 187 TK+ F+ Sbjct: 178 TKLTFYRRE 186 >gnl|CDD|146308 pfam03602, Cons_hypoth95, Conserved hypothetical protein 95. Length = 181 Score = 165 bits (419), Expect = 1e-41 Identities = 71/182 (39%), Positives = 110/182 (60%), Gaps = 3/182 (1%) Query: 4 IRIIGGKFQRRLLHTPQNRSIRPSDSRTKKALFDILTHVYPVFLDSTRMLNIFAGTGSVG 63 +RIIGGK++ R L P RP+ R ++ALF+IL + L R+L++FAG+G++G Sbjct: 1 MRIIGGKYKGRKLKVPPGPGTRPTTDRVREALFNILAPYFE--LGGARVLDLFAGSGALG 58 Query: 64 FEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVLRLGKIGNISPFQLVY 123 EALSRG V+FV+ + +++ ++ N E LG+E L G PF LV+ Sbjct: 59 LEALSRGASSVVFVEKDKKAVATLKENLEALGLEGAVLRMDAARALLRLAGKGPPFDLVF 118 Query: 124 LDPPYGQGLAQQALAIIDKEGWLEPNALVIIE-EYAGTCISVGAAFHFLQERKYGDTKIY 182 LDPPY +GL ++AL ++ ++GWL PNAL+++E E A ++E+KYG TK+ Sbjct: 119 LDPPYAKGLIEEALELLAEKGWLNPNALIVVETESDEELPEQPANLELVREKKYGQTKLA 178 Query: 183 FF 184 F+ Sbjct: 179 FY 180 >gnl|CDD|31289 COG1092, COG1092, Predicted SAM-dependent methyltransferases [General function prediction only]. Length = 393 Score = 45.7 bits (108), Expect = 7e-06 Identities = 25/85 (29%), Positives = 38/85 (44%), Gaps = 13/85 (15%) Query: 51 RMLNIFAGTGSVGFEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEK--------NCNI 102 R+LN+F+ TG A G V VD + ++ R N+EL G++ + Sbjct: 220 RVLNLFSYTGGFSVHAALGGASEVTSVDLSKRALEWARENAELNGLDGDRHRFIVGDVFK 279 Query: 103 FFRDVLRLGKIGNISPFQLVYLDPP 127 + R R G+ F L+ LDPP Sbjct: 280 WLRKAERRGE-----KFDLIILDPP 299 >gnl|CDD|32444 COG2263, COG2263, Predicted RNA methylase [Translation, ribosomal structure and biogenesis]. Length = 198 Score = 44.5 bits (105), Expect = 2e-05 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 7/84 (8%) Query: 46 FLDSTRMLNIFAGTGSVGFEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFR 105 L+ +L++ AGTG + A G VL VD + E++ + R N+E L + + Sbjct: 43 DLEGKTVLDLGAGTGILAIGAALLGASRVLAVDIDPEALEIARANAEELLGDVEFVV--A 100 Query: 106 DVLRLGKIGNISPFQLVYLDPPYG 129 DV F V ++PP+G Sbjct: 101 DVSDFR-----GKFDTVIMNPPFG 119 >gnl|CDD|31243 COG1041, COG1041, Predicted DNA modification methylase [DNA replication, recombination, and repair]. Length = 347 Score = 41.1 bits (96), Expect = 2e-04 Identities = 30/120 (25%), Positives = 45/120 (37%), Gaps = 8/120 (6%) Query: 10 KFQRRLLHTPQNRSIRPSDSRTKKALFDILTHVYPVFLDSTRMLNIFAGTGSVGFEALSR 69 F++R D R +A+ + L V +L+ F GTG + EA Sbjct: 164 AFEKRDPEKRPFFRPGSMDPRLARAMVN-LARVKR----GELVLDPFCGTGGILIEAGLM 218 Query: 70 GCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVLRLGKIGNISPFQLVYLDPPYG 129 G V+ D + +R + N E G+E + D L N + DPPYG Sbjct: 219 GAR-VIGSDIDERMVRGAKINLEYYGIEDYPVLKVLDATNLPLRDNS--VDAIATDPPYG 275 >gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.).. Length = 107 Score = 38.2 bits (89), Expect = 0.001 Identities = 21/102 (20%), Positives = 38/102 (37%), Gaps = 8/102 (7%) Query: 51 RMLNIFAGTGSVGFEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVLRL 110 R+L++ GTG++ S V VD + ++ L R+ + N + D L Sbjct: 1 RVLDLGCGTGALALALASGPGARVTGVDISPVALELARKA-AAALLADNVEVLKGDAEEL 59 Query: 111 GKIGNISPFQLVYLDPPYG------QGLAQQALAIIDKEGWL 146 F ++ DPP ++A ++ G L Sbjct: 60 -PPEADESFDVIISDPPLHHLVEDLARFLEEARRLLKPGGVL 100 >gnl|CDD|33880 COG4123, COG4123, Predicted O-methyltransferase [General function prediction only]. Length = 248 Score = 38.3 bits (89), Expect = 0.001 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 1/79 (1%) Query: 51 RMLNIFAGTGSVGFEALSRGCH-YVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVLR 109 R+L++ AG G++G R ++ V+ E+ + +RN L +E+ + D+ Sbjct: 47 RILDLGAGNGALGLLLAQRTEKAKIVGVEIQEEAAEMAQRNVALNPLEERIQVIEADIKE 106 Query: 110 LGKIGNISPFQLVYLDPPY 128 K + F L+ +PPY Sbjct: 107 FLKALVFASFDLIICNPPY 125 >gnl|CDD|32590 COG2520, COG2520, Predicted methyltransferase [General function prediction only]. Length = 341 Score = 36.8 bits (85), Expect = 0.004 Identities = 14/62 (22%), Positives = 25/62 (40%) Query: 46 FLDSTRMLNIFAGTGSVGFEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFR 105 + +L++FAG G +G V +D N +++ ++ N L VE Sbjct: 186 VKEGETVLDMFAGVGPFSIPIAKKGRPKVYAIDINPDAVEYLKENIRLNKVEGRVEPILG 245 Query: 106 DV 107 D Sbjct: 246 DA 247 >gnl|CDD|37941 KOG2730, KOG2730, KOG2730, Methylase [General function prediction only]. Length = 263 Score = 35.7 bits (82), Expect = 0.007 Identities = 29/125 (23%), Positives = 51/125 (40%), Gaps = 5/125 (4%) Query: 46 FLDSTRMLNIFAGTGSVGFEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFR 105 +++ +++ F G G + +G + V+ +D + I R N+E+ GV Sbjct: 92 CMNAEVIVDAFCGVGGNTIQFALQGPY-VIAIDIDPVKIACARHNAEVYGVPDRITFICG 150 Query: 106 DVLRLGKIGNISP--FQLVYLDPPYGQGLAQQALAIIDKEGWLEPNALVIIEEYAGTCIS 163 D L L + V+L PP+G G + + D E L+P I + + Sbjct: 151 DFLDLASKLKADKIKYDCVFLSPPWG-GPSYLRADVYDLETHLKPMGTKIFKSSLKISPN 209 Query: 164 VGAAF 168 V A F Sbjct: 210 V-AYF 213 >gnl|CDD|32423 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme metabolism]. Length = 187 Score = 35.2 bits (81), Expect = 0.010 Identities = 18/48 (37%), Positives = 30/48 (62%), Gaps = 1/48 (2%) Query: 51 RMLNIFAGTGSVGFE-ALSRGCHYVLFVDNNSESIRLIRRNSELLGVE 97 R+ +I AGTGS+ E AL+ V+ ++ + E++ LI RN+ GV+ Sbjct: 37 RLWDIGAGTGSITIEWALAGPSGRVIAIERDEEALELIERNAARFGVD 84 >gnl|CDD|32446 COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis]. Length = 432 Score = 34.1 bits (78), Expect = 0.021 Identities = 20/95 (21%), Positives = 40/95 (42%), Gaps = 4/95 (4%) Query: 51 RMLNIFAGTGSVGFEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVLR- 109 R+L+++ G G+ G L++ V V+ + E++ + N+ G++ N D Sbjct: 296 RVLDLYCGVGTFGL-PLAKRVKKVHGVEISPEAVEAAQENAAANGID-NVEFIAGDAEEF 353 Query: 110 LGKIGNISPFQLVYLDPPYGQGLAQQALAIIDKEG 144 +V +DPP G ++ L + K Sbjct: 354 TPAWWEGYKPDVVVVDPP-RAGADREVLKQLAKLK 387 >gnl|CDD|38630 KOG3420, KOG3420, KOG3420, Predicted RNA methylase [Translation, ribosomal structure and biogenesis]. Length = 185 Score = 32.6 bits (74), Expect = 0.058 Identities = 19/83 (22%), Positives = 37/83 (44%), Gaps = 4/83 (4%) Query: 47 LDSTRMLNIFAGTGSVGFEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRD 106 ++ ++ ++ G G + VL D + E++ + RN+E E ++ D Sbjct: 47 IEGKKLKDLGCGCGMLSIAFSMPKNESVLGFDIDPEALEIFTRNAEEF--EVQIDLLQCD 104 Query: 107 VLRLGKIGNISPFQLVYLDPPYG 129 +L L G I F ++PP+G Sbjct: 105 ILDLELKGGI--FDTAVINPPFG 125 >gnl|CDD|110191 pfam01170, UPF0020, Putative RNA methylase family UPF0020. This domain is probably a methylase. It is associated with the THUMP domain that also occurs with RNA modification domains. Length = 171 Score = 32.7 bits (75), Expect = 0.061 Identities = 22/83 (26%), Positives = 33/83 (39%), Gaps = 3/83 (3%) Query: 48 DSTRMLNIFAGTGSVGFEALSRGCHYVLF-VDNNSESIRLIRRNSELLGVEKNCNIFFRD 106 +L+ F G+G++ EA G + L+ D + +R R N+E GV I F Sbjct: 28 PGDPLLDPFCGSGTILIEAALMGANVALYGSDIDRRMVRGARINAEAAGVGD--KIEFVQ 85 Query: 107 VLRLGKIGNISPFQLVYLDPPYG 129 + DPPYG Sbjct: 86 ADAADLPLLNGSVDTIVTDPPYG 108 >gnl|CDD|32642 COG2813, RsmC, 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis]. Length = 300 Score = 31.4 bits (71), Expect = 0.15 Identities = 19/84 (22%), Positives = 38/84 (45%), Gaps = 6/84 (7%) Query: 51 RMLNIFAGTGSVGFEALSR-GCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVLR 109 ++L++ G G +G + + VD N+ ++ R+N GVE N ++ ++ Sbjct: 161 KVLDLGCGYGVLGLVLAKKSPQAKLTLVDVNARAVESARKNLAANGVE-NTEVWASNLYE 219 Query: 110 LGKIGNISPFQLVYLDPPYGQGLA 133 + F L+ +PP+ G A Sbjct: 220 PVE----GKFDLIISNPPFHAGKA 239 >gnl|CDD|36467 KOG1253, KOG1253, KOG1253, tRNA methyltransferase [Translation, ribosomal structure and biogenesis]. Length = 525 Score = 30.8 bits (69), Expect = 0.26 Identities = 27/86 (31%), Positives = 37/86 (43%), Gaps = 5/86 (5%) Query: 48 DSTRMLNIFAGTG--SVGFEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFR 105 S R+L + TG S+ + G V+ D N ++ I+RN EL GVE Sbjct: 109 KSLRVLEALSATGLRSLRYAKELPGVRQVVANDLNENAVTSIQRNVELNGVEDIVEPHHS 168 Query: 106 D--VLRLGKIGNISPFQLVYLDPPYG 129 D VL F ++ LD PYG Sbjct: 169 DANVLMYEHPMVAKFFDVIDLD-PYG 193 >gnl|CDD|145316 pfam02086, MethyltransfD12, D12 class N6 adenine-specific DNA methyltransferase. Length = 254 Score = 30.8 bits (70), Expect = 0.27 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 56 FAGTGSVGFEALSRGCHYVLFVDNNSESIRL 86 FAG G+V FEA RG ++ D N + I L Sbjct: 28 FAGGGAVFFEAKKRGKKVLIN-DINYDLINL 57 Score = 29.3 bits (66), Expect = 0.63 Identities = 15/48 (31%), Positives = 18/48 (37%), Gaps = 12/48 (25%) Query: 85 RLIRRNSELLGVEKNCNIF----FRDVLRLGKIGNISPFQLVYLDPPY 128 L R +L +N F VL I + VYLDPPY Sbjct: 147 ELKLRALKL----QNGATIECGDFDAVLLAANISD----DFVYLDPPY 186 >gnl|CDD|31929 COG1743, COG1743, Adenine-specific DNA methylase containing a Zn-ribbon [DNA replication, recombination, and repair]. Length = 875 Score = 30.0 bits (67), Expect = 0.46 Identities = 16/57 (28%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Query: 23 SIRPSDSRTKKALFDILTHVYPVFLDSTRMLNIFAGTGSVGFEALSRGCHYVLFVDN 79 S+R S+ + + F L+ FAG GS+ EAL G V N Sbjct: 66 SLRLSEGEPHRLNPRWPQPIETPFEGPKL-LDPFAGGGSIPLEALRLGLEVVAVELN 121 >gnl|CDD|147386 pfam05175, MTS, Methyltransferase small domain. This domain is found in ribosomal RNA small subunit methyltransferase C as well as other methyltransferases . Length = 170 Score = 27.9 bits (63), Expect = 1.9 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 5/84 (5%) Query: 51 RMLNIFAGTGSVGFEALSRGCH-YVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVLR 109 ++L++ G G +G R V VD N+ ++ R N G+E N +F+ D+ Sbjct: 34 KVLDLGCGYGVLGAALAKRSPDLEVTMVDINARALESARANLAANGLE-NGEVFWSDLYS 92 Query: 110 LGKIGNISPFQLVYLDPPYGQGLA 133 + G F L+ +PP+ G A Sbjct: 93 AVEPGK---FDLIISNPPFHAGKA 113 >gnl|CDD|72952 cd04480, RPA1_DBD_A_like, RPA1_DBD_A_like: A subgroup of uncharacterized plant OB folds with similarity to the second OB fold, the ssDNA-binding domain (DBD)-A, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-A, RPA1 contains three other OB folds: DBD-B, DBD-C, and RPA1N. The major DNA binding activity of RPA is associated with DBD-A and DBD-B of RPA1. RPA1 DBD-C is involved in trimerization. The ssDNA-binding mechanism is believed to be multistep and to involve conformational change.. Length = 86 Score = 27.2 bits (60), Expect = 3.2 Identities = 12/60 (20%), Positives = 27/60 (45%), Gaps = 4/60 (6%) Query: 73 YVLFVDNNSESIRLIRRNSELL----GVEKNCNIFFRDVLRLGKIGNISPFQLVYLDPPY 128 + ++ + + ES+ ++ + + + K FR +L+ GK IS F++ Y Sbjct: 10 WDVYNNASGESLEMVLVDEKGNRIHATIPKRLAAKFRPLLKEGKWYTISNFEVAPNTGSY 69 >gnl|CDD|146448 pfam03813, Nrap, Nrap protein. Members of this family are nucleolar RNA-associated proteins (Nrap) which are highly conserved from yeast (Saccharomyces cerevisiae) to human. In the mouse, Nrap is ubiquitously expressed and is specifically localized in the nucleolus. Nrap is a large nucleolar protein (of more than 1000 amino acids). Nrap appears to be associated with ribosome biogenesis by interacting with pre-rRNA primary transcript. Length = 930 Score = 26.9 bits (60), Expect = 3.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Query: 44 PVFLDSTRMLNIFAGTGSVGFEAL 67 PV D +R LNI A ++ L Sbjct: 258 PVLFDGSRGLNILAKMTPWSYQRL 281 >gnl|CDD|146638 pfam04107, GCS2, Glutamate-cysteine ligase family 2(GCS2). Also known as gamma-glutamylcysteine synthetase and gamma-ECS (EC:6.3.2.2). This enzyme catalyses the first and rate limiting step in de novo glutathione biosynthesis. Members of this family are found in archaea, bacteria and plants. May and Leaver discuss the possible evolutionary origins of glutamate-cysteine ligase enzymes in different organisms and suggest that it evolved independently in different eukaryotes, from an ancestral bacterial enzyme. They also state that Arabidopsis thaliana gamma-glutamylcysteine synthetase is structurally unrelated to mammalian, yeast and Escherichia coli homologues. In plants, there are separate cytosolic and chloroplast forms of the enzyme. Length = 291 Score = 26.6 bits (59), Expect = 4.6 Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Query: 51 RMLNIFAGTGSVGFEALSRGCHYVLFVDNNSESI-RLIRR 89 RM G G + + GCH + +D++SE+I ++R Sbjct: 108 RMYEYMPRVGVYGRQMMVAGCHVQVNIDSSSEAIMAVLRL 147 >gnl|CDD|30708 COG0359, RplI, Ribosomal protein L9 [Translation, ribosomal structure and biogenesis]. Length = 148 Score = 25.9 bits (57), Expect = 6.6 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 7/39 (17%) Query: 102 IFFRDVLRLGKIGNI----SPFQLVYLDPPYGQGLAQQA 136 I DV LGK G+I + +L P +GLA A Sbjct: 4 ILLEDVKGLGKKGDIVEVKDGYARNFLIP---KGLAVPA 39 >gnl|CDD|113224 pfam04445, DUF548, Protein of unknown function (DUF548). Protein of unknown function found in proteobacteria. In Salmonella typhimurium, expression of this protein is regulated by heat shock. Length = 235 Score = 25.8 bits (57), Expect = 6.6 Identities = 20/94 (21%), Positives = 34/94 (36%), Gaps = 14/94 (14%) Query: 42 VYPVFLDSTRMLNIFAGTGSVGFEALSRGCHYVLFVDNN------SESIRLIRRNSELLG 95 P LD+T AG G F S GC L + + ++ ++ E+ Sbjct: 75 YLPTVLDAT------AGLGRDAFVLASLGCRVRLVERHPVVAALLEDGLQRAYQDPEIGA 128 Query: 96 -VEKNCNIFFRDVLRLGKIGNISPFQLVYLDPPY 128 ++ ++ + P +VYLDP Y Sbjct: 129 WLQARLHLLHGSSADQLEPNIDQP-DVVYLDPMY 161 >gnl|CDD|34782 COG5183, SSM4, Protein involved in mRNA turnover and stability [RNA processing and modification]. Length = 1175 Score = 25.8 bits (56), Expect = 7.6 Identities = 23/106 (21%), Positives = 34/106 (32%), Gaps = 14/106 (13%) Query: 87 IRRNSELLGVEKNCNIFFRDVLRLGKIGNISPFQLVYLDPP---------YGQGLAQQAL 137 I N +C R L +G+ I F VYL +G Sbjct: 353 IVANGVAFWANTSCTEEARKRLGIGRNRIICIFMKVYLIILLNAFFRALTFGLVDHYDFG 412 Query: 138 AIIDKEGWLEPNALVIIEEYAGTCISVGAAFHFLQERKYGDTKIYF 183 I++K + AL + EY + +G +F F Y I Sbjct: 413 NIMNKGMY----ALHLDNEYQS-PLVIGISFIFHMSIAYTIISIVI 453 >gnl|CDD|33563 COG3768, COG3768, Predicted membrane protein [Function unknown]. Length = 350 Score = 25.7 bits (56), Expect = 7.7 Identities = 16/72 (22%), Positives = 29/72 (40%), Gaps = 23/72 (31%) Query: 73 YVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVLRLGKIGNISPFQLVYLDPPY---- 128 +V + ++RLI R +EL G+ LG +G + +LV + + Sbjct: 228 FVAW-----RNLRLINRIAELYGI------------ELGYLGRLRLLRLVLANLAFAGAI 270 Query: 129 --GQGLAQQALA 138 G + Q L+ Sbjct: 271 EVGDSVGQDWLS 282 >gnl|CDD|36364 KOG1149, KOG1149, KOG1149, Glutamyl-tRNA synthetase (mitochondrial) [Translation, ribosomal structure and biogenesis]. Length = 524 Score = 25.7 bits (56), Expect = 7.7 Identities = 13/31 (41%), Positives = 16/31 (51%) Query: 5 RIIGGKFQRRLLHTPQNRSIRPSDSRTKKAL 35 R GGKF R+ T Q R IR S+ + L Sbjct: 62 RKKGGKFILRIEDTDQKRLIRGSEEAIYEDL 92 >gnl|CDD|35739 KOG0519, KOG0519, KOG0519, Sensory transduction histidine kinase [Signal transduction mechanisms]. Length = 786 Score = 25.8 bits (56), Expect = 7.7 Identities = 10/52 (19%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Query: 74 VLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVLRLGKIGNISPFQLVYLD 125 +L VD+N + ++ + LG E ++ L K + + ++++D Sbjct: 669 ILLVDDNPVNRKVATGMLKKLGAEVTEVNSGQEALDKLKPPH--SYDVIFMD 718 >gnl|CDD|35168 COG5609, COG5609, Uncharacterized conserved protein [Function unknown]. Length = 124 Score = 25.6 bits (56), Expect = 8.3 Identities = 12/58 (20%), Positives = 24/58 (41%), Gaps = 2/58 (3%) Query: 103 FFRDVLRLGKIGNISPFQLVYLDPPYGQGLAQQALAIIDKEGWLEPNALVIIEEYAGT 160 F ++ + G ++P + L G+ + +Q + K G + IIE+ G Sbjct: 35 FLDNMAIISLEGILTPAEYFLLSTKEGEIMVKQTRTELVKSG--YKDLPEIIEKIIGA 90 >gnl|CDD|32082 COG1898, RfbC, dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane]. Length = 173 Score = 25.6 bits (56), Expect = 9.0 Identities = 11/43 (25%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Query: 63 GFEALSRGCHYVLFVDN--NSESIRLIRRNSELLGVEKNCNIF 103 GF+ LS V V + E R I N +G++ Sbjct: 117 GFQVLSDDAEVVYKVTEEYDPEHERGIPWNDPTIGIDWPLKDP 159 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.325 0.143 0.429 Gapped Lambda K H 0.267 0.0796 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,413,558 Number of extensions: 126057 Number of successful extensions: 379 Number of sequences better than 10.0: 1 Number of HSP's gapped: 370 Number of HSP's successfully gapped: 41 Length of query: 189 Length of database: 6,263,737 Length adjustment: 88 Effective length of query: 101 Effective length of database: 4,362,145 Effective search space: 440576645 Effective search space used: 440576645 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 54 (24.5 bits)