BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780408|ref|YP_003064821.1| hypothetical protein CLIBASIA_01465 [Candidatus Liberibacter asiaticus str. psy62] (75 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254780408|ref|YP_003064821.1| hypothetical protein CLIBASIA_01465 [Candidatus Liberibacter asiaticus str. psy62] gi|254040085|gb|ACT56881.1| hypothetical protein CLIBASIA_01465 [Candidatus Liberibacter asiaticus str. psy62] Length = 75 Score = 154 bits (388), Expect = 5e-36, Method: Compositional matrix adjust. Identities = 75/75 (100%), Positives = 75/75 (100%) Query: 1 MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDP 60 MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDP Sbjct: 1 MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDP 60 Query: 61 TRFGDWEKNGISIDF 75 TRFGDWEKNGISIDF Sbjct: 61 TRFGDWEKNGISIDF 75 >gi|315122149|ref|YP_004062638.1| hypothetical protein CKC_01995 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495551|gb|ADR52150.1| hypothetical protein CKC_01995 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 64 Score = 103 bits (256), Expect = 9e-21, Method: Compositional matrix adjust. Identities = 49/64 (76%), Positives = 56/64 (87%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 MNN+T K S + LSSIAKRALEEA+QR+SA NK+AK P+EIGGR G DPTRFGDWEKNG+ Sbjct: 1 MNNNTTKKSKETLSSIAKRALEEARQRRSAENKNAKHPVEIGGRDGPDPTRFGDWEKNGL 60 Query: 72 SIDF 75 SIDF Sbjct: 61 SIDF 64 >gi|83950713|ref|ZP_00959446.1| hypothetical protein ISM_06425 [Roseovarius nubinhibens ISM] gi|83838612|gb|EAP77908.1| hypothetical protein ISM_06425 [Roseovarius nubinhibens ISM] Length = 64 Score = 68.6 bits (166), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 30/64 (46%), Positives = 43/64 (67%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 M++ + T L A+RAL EA++R+ +A LP E+GGRKG +P R+GDWEK GI Sbjct: 1 MSDDSQPTDRKDLPPAAQRALAEAEERRRLAEAEAPLPKELGGRKGPEPVRYGDWEKKGI 60 Query: 72 SIDF 75 ++DF Sbjct: 61 AVDF 64 >gi|83945682|ref|ZP_00958027.1| hypothetical protein OA2633_10839 [Oceanicaulis alexandrii HTCC2633] gi|83850883|gb|EAP88743.1| hypothetical protein OA2633_10839 [Oceanicaulis alexandrii HTCC2633] Length = 67 Score = 66.6 bits (161), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 31/53 (58%), Positives = 38/53 (71%) Query: 23 PLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 PLS AKRAL EA++R+ DA+ E+GG KG +PTRFGDWEK GI+ DF Sbjct: 15 PLSEAAKRALAEAEERRRQAEADAEREKELGGPKGPEPTRFGDWEKKGITYDF 67 >gi|222087918|ref|YP_002546456.1| hypothetical protein Arad_4931 [Agrobacterium radiobacter K84] gi|221725366|gb|ACM28522.1| conserved hypothetical protein [Agrobacterium radiobacter K84] Length = 74 Score = 66.6 bits (161), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Query: 23 PLSSIAKRALEEAKQRKSANNK-DAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 PLS AKRAL EA++R+ A + LP EIGGR G DP+RFGDWE NG +IDF Sbjct: 21 PLSPAAKRALAEAEERRKAQAQAQTDLPPEIGGRGGADPSRFGDWEINGRTIDF 74 >gi|255262510|ref|ZP_05341852.1| conserved domain protein [Thalassiobium sp. R2A62] gi|255104845|gb|EET47519.1| conserved domain protein [Thalassiobium sp. R2A62] Length = 62 Score = 65.5 bits (158), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 32/64 (50%), Positives = 44/64 (68%), Gaps = 2/64 (3%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 M ++ T +D L A+RAL EA++R++ K A LP E+GGR G +P RFGDWEK GI Sbjct: 1 MTDTPTNTPND-LPPAAQRALAEAEERRALEAKQA-LPKELGGRDGPEPVRFGDWEKKGI 58 Query: 72 SIDF 75 ++DF Sbjct: 59 AVDF 62 >gi|126727796|ref|ZP_01743626.1| hypothetical protein RB2150_10549 [Rhodobacterales bacterium HTCC2150] gi|126702923|gb|EBA02026.1| hypothetical protein RB2150_10549 [Rhodobacterales bacterium HTCC2150] Length = 84 Score = 63.5 bits (153), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 33/76 (43%), Positives = 47/76 (61%), Gaps = 4/76 (5%) Query: 3 TVQINIRGL---MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLD 59 T + RGL + + S L AKRAL EA++R+ K +LP+E+GGR+G + Sbjct: 10 TSKSRFRGLITSLGKNMTDASDTNLPPAAKRALAEAEERRK-KAKAKELPLELGGREGPE 68 Query: 60 PTRFGDWEKNGISIDF 75 P R+GDWEK GI++DF Sbjct: 69 PVRYGDWEKKGIAVDF 84 >gi|254464711|ref|ZP_05078122.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I] gi|206685619|gb|EDZ46101.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I] Length = 63 Score = 63.2 bits (152), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 31/64 (48%), Positives = 38/64 (59%), Gaps = 1/64 (1%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 M+ T D L A RAL EA++R+ A P E+GGR G DP R+GDWEK GI Sbjct: 1 MSEETAPEKKD-LPPAAVRALAEAEERRKAAEAQEPRPKELGGRDGPDPARYGDWEKKGI 59 Query: 72 SIDF 75 +IDF Sbjct: 60 AIDF 63 >gi|110635744|ref|YP_675952.1| hypothetical protein Meso_3416 [Mesorhizobium sp. BNC1] gi|110286728|gb|ABG64787.1| protein of unknown function DUF1674 [Chelativorans sp. BNC1] Length = 70 Score = 62.8 bits (151), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 7/68 (10%) Query: 13 NNSTIKTSHDP--LSSIAKRALEEA---KQRKSANNKDAKLPIEIGGRKGLDPTRFGDWE 67 + + + DP LS AKRALEEA ++R++A DA P EIGGR G DP R+GDWE Sbjct: 5 SREEVPSRRDPATLSPAAKRALEEAEDRRKRRAAQQADA--PREIGGRDGPDPARYGDWE 62 Query: 68 KNGISIDF 75 GI+ DF Sbjct: 63 VKGIATDF 70 >gi|150398385|ref|YP_001328852.1| hypothetical protein Smed_3193 [Sinorhizobium medicae WSM419] gi|150029900|gb|ABR62017.1| protein of unknown function DUF1674 [Sinorhizobium medicae WSM419] Length = 66 Score = 62.4 bits (150), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 31/63 (49%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Query: 13 NNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 N+++ PLS A RAL+EA++R+ A ++P E+GGR GLDP RFGDWE G + Sbjct: 5 NDNSPDHPRRPLSPAALRALKEAEERRGAKAP-KEIPAEVGGRGGLDPARFGDWEIKGRA 63 Query: 73 IDF 75 IDF Sbjct: 64 IDF 66 >gi|319404850|emb|CBI78451.1| conserved hypothetical protein [Bartonella rochalimae ATCC BAA-1498] Length = 71 Score = 61.6 bits (148), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 33/63 (52%), Positives = 44/63 (69%), Gaps = 4/63 (6%) Query: 14 NSTIKTSHDPLSSIAKRALEEAKQR-KSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 N+TI H P+ A+RAL+EA++R K A N++ P+E GGR G DP R+GDWE NG + Sbjct: 12 NTTI-PQHTPIPPEAQRALQEAEERRKCATNENQ--PLENGGRGGKDPARYGDWEINGRA 68 Query: 73 IDF 75 IDF Sbjct: 69 IDF 71 >gi|56698201|ref|YP_168573.1| hypothetical protein SPO3377 [Ruegeria pomeroyi DSS-3] gi|56679938|gb|AAV96604.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3] Length = 60 Score = 61.6 bits (148), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 29/53 (54%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAK-LPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L A+RAL EA++R+ + K LP E+GGR G DP R+GDWEK GI+IDF Sbjct: 8 LPPAAQRALAEAEERRRKAEAETKPLPKELGGRDGPDPARYGDWEKKGIAIDF 60 >gi|254449962|ref|ZP_05063399.1| conserved hypothetical protein [Octadecabacter antarcticus 238] gi|198264368|gb|EDY88638.1| conserved hypothetical protein [Octadecabacter antarcticus 238] Length = 58 Score = 61.6 bits (148), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 1/59 (1%) Query: 17 IKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + +H +S AKRAL EA R+ K +LP E+GGR G +P RFGDWE+ GI++DF Sbjct: 1 MTQAHKDISDAAKRALAEASDRRE-KAKAMELPEELGGRDGPEPVRFGDWERKGIAVDF 58 >gi|294675831|ref|YP_003576446.1| hypothetical protein RCAP_rcc00274 [Rhodobacter capsulatus SB 1003] gi|294474651|gb|ADE84039.1| protein of unknown function DUF1674 [Rhodobacter capsulatus SB 1003] Length = 59 Score = 61.2 bits (147), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 31/52 (59%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L A RAL EA++R+ A K A+LP E GGR G +P RFGDWEK GI+IDF Sbjct: 9 LPPAAIRALAEAEERRKAA-KAAELPKEFGGRDGPEPVRFGDWEKKGIAIDF 59 >gi|114769581|ref|ZP_01447191.1| dihydrodipicolinate reductase [alpha proteobacterium HTCC2255] gi|114549286|gb|EAU52168.1| dihydrodipicolinate reductase [alpha proteobacterium HTCC2255] gi|297183947|gb|ADI20068.1| hypothetical protein [uncultured alpha proteobacterium EB080_L11F12] Length = 59 Score = 60.8 bits (146), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 30/54 (55%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Query: 22 DPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 D + + A RALEEA RK ++ KL +E+GG KGL+PTRFGDWE+ GI+ DF Sbjct: 7 DRIKAAAHRALEEAHNRKK-ELEETKLDLELGGPKGLEPTRFGDWERKGIASDF 59 >gi|49474773|ref|YP_032815.1| hypothetical protein BQ12910 [Bartonella quintana str. Toulouse] gi|49240277|emb|CAF26750.1| hypothetical protein BQ12910 [Bartonella quintana str. Toulouse] Length = 86 Score = 60.8 bits (146), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 34/63 (53%), Positives = 43/63 (68%), Gaps = 4/63 (6%) Query: 14 NSTIKTSHDPLSSIAKRALEEAKQR-KSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 N+T+ PLSS A+RAL EA++R K NKD P+E GGR G DP+R+GDWE G + Sbjct: 27 NATV-DKQQPLSSEAQRALNEAEERRKHEKNKDK--PLENGGRGGKDPSRYGDWEIKGRA 83 Query: 73 IDF 75 IDF Sbjct: 84 IDF 86 >gi|297184253|gb|ADI20371.1| hypothetical protein [uncultured alpha proteobacterium EB080_L27A02] Length = 59 Score = 60.8 bits (146), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 30/54 (55%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Query: 22 DPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 D + + A RALEEA RK + + KL +E+GG KGL+PTRFGDWE+ GI+ DF Sbjct: 7 DRIKAAAHRALEEAHNRKKELD-ETKLDLELGGPKGLEPTRFGDWERKGIASDF 59 >gi|218661145|ref|ZP_03517075.1| hypothetical protein RetlI_17123 [Rhizobium etli IE4771] Length = 91 Score = 60.1 bits (144), Expect = 9e-08, Method: Compositional matrix adjust. Identities = 30/52 (57%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LS A+RAL EA++R+ N K +LP EIGGR G +P RFGD+E NG +IDF Sbjct: 41 LSPAAQRALAEAEERRK-NQKPLELPPEIGGRGGAEPARFGDYEINGRAIDF 91 >gi|218682720|ref|ZP_03530321.1| hypothetical protein RetlC8_28293 [Rhizobium etli CIAT 894] Length = 73 Score = 60.1 bits (144), Expect = 9e-08, Method: Compositional matrix adjust. Identities = 30/52 (57%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LS AKRAL EA++R+ N K +LP E GGR G +P RFGD+E NG +IDF Sbjct: 23 LSPAAKRALAEAEERRK-NQKPLELPPETGGRGGAEPARFGDYEINGRAIDF 73 >gi|209551490|ref|YP_002283407.1| hypothetical protein Rleg2_3919 [Rhizobium leguminosarum bv. trifolii WSM2304] gi|209537246|gb|ACI57181.1| protein of unknown function DUF1674 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 74 Score = 60.1 bits (144), Expect = 9e-08, Method: Compositional matrix adjust. Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 4/63 (6%) Query: 16 TIKTSHDP---LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 T + S P LS AKRAL EA++R+ N K +LP E GGR G +P RFGD+E NG + Sbjct: 13 TAERSEPPRKMLSPAAKRALAEAEERRK-NQKPLELPPETGGRGGAEPARFGDYEINGRA 71 Query: 73 IDF 75 IDF Sbjct: 72 IDF 74 >gi|126463526|ref|YP_001044640.1| hypothetical protein Rsph17029_2766 [Rhodobacter sphaeroides ATCC 17029] gi|332559579|ref|ZP_08413901.1| hypothetical protein RSWS8N_10990 [Rhodobacter sphaeroides WS8N] gi|126105190|gb|ABN77868.1| protein of unknown function DUF1674 [Rhodobacter sphaeroides ATCC 17029] gi|332277291|gb|EGJ22606.1| hypothetical protein RSWS8N_10990 [Rhodobacter sphaeroides WS8N] Length = 62 Score = 60.1 bits (144), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 34/64 (53%), Positives = 41/64 (64%), Gaps = 2/64 (3%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 M + T +T D L A RAL EA++R+ K LP EIGGR G +P RFGDWEK GI Sbjct: 1 MRDMTEETRKD-LPPEALRALAEAEERRR-QAKALDLPKEIGGRNGPEPVRFGDWEKKGI 58 Query: 72 SIDF 75 +IDF Sbjct: 59 AIDF 62 >gi|159045574|ref|YP_001534368.1| hypothetical protein Dshi_3034 [Dinoroseobacter shibae DFL 12] gi|157913334|gb|ABV94767.1| protein of unknown function DUF1674 [Dinoroseobacter shibae DFL 12] Length = 74 Score = 60.1 bits (144), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 29/52 (55%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L A+RAL EA RK A K + P E+GGR G +P R+GDWEK GI+IDF Sbjct: 24 LPEPARRALAEADARK-AKEKAREFPPELGGRNGPEPVRYGDWEKKGIAIDF 74 >gi|222150169|ref|YP_002551126.1| hypothetical protein Avi_4297 [Agrobacterium vitis S4] gi|221737151|gb|ACM38114.1| conserved hypothetical protein [Agrobacterium vitis S4] Length = 76 Score = 60.1 bits (144), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 31/66 (46%), Positives = 38/66 (57%), Gaps = 1/66 (1%) Query: 10 GLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKN 69 G N+ + LS A RAL EA++R+ A P E+GGR G DP RFGDWE N Sbjct: 12 GTANSDGTDAAPKTLSPAAVRALAEAEERRKAEQAQKPAP-EVGGRGGADPARFGDWEIN 70 Query: 70 GISIDF 75 G +IDF Sbjct: 71 GRAIDF 76 >gi|163734257|ref|ZP_02141697.1| hypothetical protein RLO149_08434 [Roseobacter litoralis Och 149] gi|161392265|gb|EDQ16594.1| hypothetical protein RLO149_08434 [Roseobacter litoralis Och 149] Length = 96 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 26/52 (50%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L A+RAL EA+ R+ +D LP E+GGR+G +P R+GDWE+ GI++DF Sbjct: 46 LPPAAQRALAEAEARRK-KAQDINLPPELGGREGPEPVRYGDWERKGIAVDF 96 >gi|110678029|ref|YP_681036.1| hypothetical protein RD1_0652 [Roseobacter denitrificans OCh 114] gi|109454145|gb|ABG30350.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114] Length = 64 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 26/52 (50%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L A+RAL EA+ R+ KD +P E+GGR+G +P R+GDWE+ GI++DF Sbjct: 14 LPPAAQRALAEAEARRK-KAKDMNMPPELGGREGPEPVRYGDWERKGIAVDF 64 >gi|319407811|emb|CBI81462.1| conserved hypothetical protein [Bartonella sp. 1-1C] Length = 64 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 4/63 (6%) Query: 14 NSTIKTSHDPLSSIAKRALEEAKQR-KSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 N+TI H + A+RAL+EA++R K A NK+ P+E GGR G DP R+GDWE NG + Sbjct: 5 NTTI-PQHTRIPPEAQRALQEAEERRKCATNKNQ--PLENGGRGGKDPARYGDWEVNGRA 61 Query: 73 IDF 75 IDF Sbjct: 62 IDF 64 >gi|239832891|ref|ZP_04681220.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301] gi|239825158|gb|EEQ96726.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301] Length = 72 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K D L A+RAL+EA+ R+ A K+A+ P EIGGR G DP R+GDWE G +IDF Sbjct: 16 KRPFDDLPPAAQRALKEAEARR-AVEKEAQAPREIGGRGGKDPARYGDWEIKGRTIDF 72 >gi|114571461|ref|YP_758141.1| hypothetical protein Mmar10_2922 [Maricaulis maris MCS10] gi|114341923|gb|ABI67203.1| protein of unknown function DUF1674 [Maricaulis maris MCS10] Length = 75 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 30/52 (57%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LS A+RAL EA++R+ + A+L E GGRKG +PTRFGDWEK GI DF Sbjct: 25 LSPEARRALAEAEERRKIARQ-AELAPETGGRKGPEPTRFGDWEKKGIICDF 75 >gi|312113707|ref|YP_004011303.1| hypothetical protein Rvan_0928 [Rhodomicrobium vannielii ATCC 17100] gi|311218836|gb|ADP70204.1| protein of unknown function DUF1674 [Rhodomicrobium vannielii ATCC 17100] Length = 70 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 30/48 (62%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Query: 28 AKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 AKRAL EA R+ A + + P EIG RKGL+PTRFGDWEK GI+ DF Sbjct: 24 AKRALAEADARRLAAG-EPERPREIGARKGLEPTRFGDWEKKGIASDF 70 >gi|254420487|ref|ZP_05034211.1| conserved hypothetical protein [Brevundimonas sp. BAL3] gi|196186664|gb|EDX81640.1| conserved hypothetical protein [Brevundimonas sp. BAL3] Length = 85 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 29/57 (50%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Query: 19 TSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 T PLS +A+RAL EA R++A A+ E GG G +PTR+GDWEK G++IDF Sbjct: 30 TPEKPLSDVARRALLEAADRRAAEQV-AQTDPEHGGPSGPEPTRYGDWEKKGLAIDF 85 >gi|221640600|ref|YP_002526862.1| hypothetical protein RSKD131_2501 [Rhodobacter sphaeroides KD131] gi|221161381|gb|ACM02361.1| Hypothetical Protein RSKD131_2501 [Rhodobacter sphaeroides KD131] Length = 62 Score = 58.9 bits (141), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 33/64 (51%), Positives = 40/64 (62%), Gaps = 2/64 (3%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 M + T +T D A RAL EA++R+ K LP EIGGR G +P RFGDWEK GI Sbjct: 1 MRDMTEETRKD-FPPEALRALAEAEERRR-QAKALDLPKEIGGRNGPEPVRFGDWEKKGI 58 Query: 72 SIDF 75 +IDF Sbjct: 59 AIDF 62 >gi|260574498|ref|ZP_05842502.1| protein of unknown function DUF1674 [Rhodobacter sp. SW2] gi|259023394|gb|EEW26686.1| protein of unknown function DUF1674 [Rhodobacter sp. SW2] Length = 56 Score = 58.2 bits (139), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 27/52 (51%), Positives = 35/52 (67%), Gaps = 2/52 (3%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L A+RAL EA++R+ LP E+GGR G +P R+GDWEK GI+IDF Sbjct: 7 LPPAAQRALAEAEERR--KKAQTALPPELGGRNGPEPVRYGDWEKKGIAIDF 56 >gi|254436923|ref|ZP_05050417.1| conserved hypothetical protein [Octadecabacter antarcticus 307] gi|198252369|gb|EDY76683.1| conserved hypothetical protein [Octadecabacter antarcticus 307] Length = 58 Score = 58.2 bits (139), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 28/52 (53%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 +S AKRAL EA R+ K +LP E+GGR G +P RFGDWE+ GI++DF Sbjct: 8 ISDAAKRALSEADDRRK-KAKAMELPEELGGRDGPEPVRFGDWERRGIAVDF 58 >gi|297184030|gb|ADI20150.1| hypothetical protein [uncultured alpha proteobacterium EB080_L06A09] Length = 61 Score = 58.2 bits (139), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 30/58 (51%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Query: 19 TSHDPLSSIAKRALEEAKQRK-SANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + D + + A RALEEAK RK + K A +E+GG KGL+PTR+GDWE+ GI+ DF Sbjct: 4 SKSDRIKAAAIRALEEAKGRKIKIDVKKANQELELGGPKGLEPTRYGDWERKGIASDF 61 >gi|218670930|ref|ZP_03520601.1| hypothetical protein RetlG_04368 [Rhizobium etli GR56] Length = 74 Score = 58.2 bits (139), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 32/66 (48%), Positives = 42/66 (63%), Gaps = 4/66 (6%) Query: 13 NNSTIKTSHDP---LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKN 69 + T + S P LS A+RAL EA++R+ + K LP EIGGR G +P RFGD+E N Sbjct: 10 QSPTAEGSEPPRKMLSPAAQRALAEAEERRK-HQKPLDLPPEIGGRGGAEPARFGDYEIN 68 Query: 70 GISIDF 75 G +IDF Sbjct: 69 GRAIDF 74 >gi|49476253|ref|YP_034294.1| hypothetical protein BH16010 [Bartonella henselae str. Houston-1] gi|49239061|emb|CAF28364.1| hypothetical protein BH16010 [Bartonella henselae str. Houston-1] Length = 86 Score = 58.2 bits (139), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 28/55 (50%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Query: 21 HDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 PLS A+RAL EA++R+ + K P+E GGR G DP+R+GDWE G +IDF Sbjct: 33 QQPLSPAAQRALNEAEERRKHETNEEK-PLENGGRGGKDPSRYGDWEIKGRAIDF 86 >gi|300024957|ref|YP_003757568.1| hypothetical protein Hden_3456 [Hyphomicrobium denitrificans ATCC 51888] gi|299526778|gb|ADJ25247.1| protein of unknown function DUF1674 [Hyphomicrobium denitrificans ATCC 51888] Length = 73 Score = 57.8 bits (138), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 29/54 (53%), Positives = 38/54 (70%), Gaps = 3/54 (5%) Query: 23 PLSSIAKRALEEAK-QRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 PL+ A+RAL EA+ +R+ A N+ P E+GGR G +PTRFGDWE GI+ DF Sbjct: 22 PLTPEAQRALAEAEARRQQAANQ--TRPPEVGGRSGPEPTRFGDWETGGIASDF 73 >gi|325294197|ref|YP_004280061.1| hypothetical protein AGROH133_09299 [Agrobacterium sp. H13-3] gi|325062050|gb|ADY65741.1| hypothetical protein AGROH133_09299 [Agrobacterium sp. H13-3] Length = 66 Score = 57.4 bits (137), Expect = 7e-07, Method: Compositional matrix adjust. Identities = 28/52 (53%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LS A+RAL+EA++R+ D +LP E GGR G +P RFGD+E NG +IDF Sbjct: 16 LSPAAERALKEAEERRK-QQADLQLPQETGGRGGAEPVRFGDYEINGRAIDF 66 >gi|159185403|ref|NP_527922.1| hypothetical protein Atu2827 [Agrobacterium tumefaciens str. C58] gi|17741348|gb|AAL43808.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58] Length = 70 Score = 57.4 bits (137), Expect = 7e-07, Method: Compositional matrix adjust. Identities = 28/52 (53%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LS A+RALEEA++R+ D +LP E GGR G +P RFGD+E G +IDF Sbjct: 20 LSPAAQRALEEAEERRR-QQADLQLPPETGGRGGAEPVRFGDYEIKGRAIDF 70 >gi|240851338|ref|YP_002972741.1| hypothetical protein Bgr_19610 [Bartonella grahamii as4aup] gi|240268461|gb|ACS52049.1| hypothetical protein Bgr_19610 [Bartonella grahamii as4aup] Length = 71 Score = 57.0 bits (136), Expect = 9e-07, Method: Compositional matrix adjust. Identities = 32/63 (50%), Positives = 43/63 (68%), Gaps = 4/63 (6%) Query: 14 NSTIKTSHDPLSSIAKRALEEAKQR-KSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 N+T+ LS A+RAL+EA++R KSA K+ P+E GGR G DP+R+GDWE G + Sbjct: 12 NATV-VKQQSLSPAAQRALKEAEERRKSAAKKEQ--PLENGGRGGKDPSRYGDWEIKGRA 68 Query: 73 IDF 75 IDF Sbjct: 69 IDF 71 >gi|190893966|ref|YP_001980508.1| hypothetical protein RHECIAT_CH0004403 [Rhizobium etli CIAT 652] gi|190699245|gb|ACE93330.1| hypothetical conserved protein [Rhizobium etli CIAT 652] Length = 74 Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 29/52 (55%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LS A+RAL EA++R+ N K +L EIGGR G +P RFGD+E NG +IDF Sbjct: 24 LSPAAQRALAEAEERRK-NQKPLELAPEIGGRGGAEPARFGDYEINGRAIDF 74 >gi|163757450|ref|ZP_02164539.1| hypothetical protein HPDFL43_18607 [Hoeflea phototrophica DFL-43] gi|162284952|gb|EDQ35234.1| hypothetical protein HPDFL43_18607 [Hoeflea phototrophica DFL-43] Length = 79 Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 31/54 (57%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIE--IGGRKGLDPTRFGDWEKNGISIDF 75 LS AKRAL EA +R+ A + AK+ E IGGR G DP RFGDWE +G +IDF Sbjct: 27 LSPAAKRALAEADERRKARDT-AKISTEKEIGGRGGADPARFGDWEIDGRAIDF 79 >gi|319409411|emb|CBI83057.1| conserved hypothetical protein [Bartonella schoenbuchensis R1] Length = 75 Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 3/64 (4%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 N +++K PL A+RAL+EA QR+ + K+P+E GGR G DP R+GDWE G Sbjct: 15 QNAASLKQR--PLPPEAQRALKEAAQRRKQALHE-KMPLENGGRGGKDPARYGDWEIKGR 71 Query: 72 SIDF 75 +IDF Sbjct: 72 AIDF 75 >gi|114706036|ref|ZP_01438939.1| hypothetical protein FP2506_16259 [Fulvimarina pelagi HTCC2506] gi|114538882|gb|EAU42003.1| hypothetical protein FP2506_16259 [Fulvimarina pelagi HTCC2506] Length = 80 Score = 56.2 bits (134), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 36/74 (48%), Positives = 48/74 (64%), Gaps = 6/74 (8%) Query: 7 NIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRK---SANNKDA-KLPIEIGGRK-GLDPT 61 +I G M S+ +TS LS AKRAL EA++R+ +A D LP E+ GRK G++P Sbjct: 8 DILGAMKVSS-ETSVKTLSPAAKRALAEAEERRRTRTAFKVDPDSLPSEVDGRKSGVEPV 66 Query: 62 RFGDWEKNGISIDF 75 R+GDWEK+GI DF Sbjct: 67 RYGDWEKDGIVSDF 80 >gi|85703965|ref|ZP_01035068.1| dihydrodipicolinate reductase [Roseovarius sp. 217] gi|85671285|gb|EAQ26143.1| dihydrodipicolinate reductase [Roseovarius sp. 217] Length = 63 Score = 55.8 bits (133), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 28/53 (52%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRK-GLDPTRFGDWEKNGISIDF 75 L A+RAL EA++R+ A LP E+GGR+ GL+P R+GDWEK G++IDF Sbjct: 12 LPPAAQRALAEAEERRKLAETLA-LPKELGGRQEGLEPVRYGDWEKKGLAIDF 63 >gi|121602399|ref|YP_988408.1| hypothetical protein BARBAKC583_0070 [Bartonella bacilliformis KC583] gi|120614576|gb|ABM45177.1| conserved hypothetical protein [Bartonella bacilliformis KC583] Length = 68 Score = 55.8 bits (133), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 28/65 (43%), Positives = 40/65 (61%), Gaps = 1/65 (1%) Query: 11 LMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNG 70 + N++ + LS A+RAL+EA +R+ + K P+E GGR G DP R+GDWE G Sbjct: 5 ISNDTACSRPNSSLSPAAQRALQEAAERRKREIHEKK-PLESGGRGGKDPARYGDWEIKG 63 Query: 71 ISIDF 75 +IDF Sbjct: 64 RAIDF 68 >gi|254459606|ref|ZP_05073022.1| conserved hypothetical protein [Rhodobacterales bacterium HTCC2083] gi|206676195|gb|EDZ40682.1| conserved hypothetical protein [Rhodobacteraceae bacterium HTCC2083] Length = 59 Score = 55.8 bits (133), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 27/52 (51%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L A+RAL EA++R+ K +L E+GGR G +P R+GDWEK GI+IDF Sbjct: 9 LPPAAQRALAEAEERRK-TAKALELAPELGGRNGPEPVRYGDWEKKGIAIDF 59 >gi|327191216|gb|EGE58259.1| hypothetical protein RHECNPAF_3340058 [Rhizobium etli CNPAF512] Length = 111 Score = 55.8 bits (133), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 29/52 (55%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LS A+RAL EA++R+ N K L EIGGR G +P RFGD+E NG +IDF Sbjct: 61 LSPAAQRALAEAEERRK-NQKPLDLAPEIGGRGGAEPARFGDYEINGRAIDF 111 >gi|84684377|ref|ZP_01012278.1| hypothetical protein 1099457000260_RB2654_12169 [Maritimibacter alkaliphilus HTCC2654] gi|84667356|gb|EAQ13825.1| hypothetical protein RB2654_12169 [Rhodobacterales bacterium HTCC2654] Length = 59 Score = 55.5 bits (132), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 27/52 (51%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L A RAL EA++R+ KLP E+GGR G +P R+GDWEK G++IDF Sbjct: 9 LPPAAIRALAEAEERRK-KAAALKLPEELGGRDGPEPVRYGDWEKKGLAIDF 59 >gi|86139372|ref|ZP_01057941.1| hypothetical protein MED193_13018 [Roseobacter sp. MED193] gi|85823875|gb|EAQ44081.1| hypothetical protein MED193_13018 [Roseobacter sp. MED193] Length = 70 Score = 55.5 bits (132), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 22/30 (73%), Positives = 26/30 (86%) Query: 46 AKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 AK P+E+GGR GLDP R+GDWEK GI+IDF Sbjct: 41 AKPPVELGGRDGLDPARYGDWEKKGIAIDF 70 >gi|146337495|ref|YP_001202543.1| hypothetical protein BRADO0341 [Bradyrhizobium sp. ORS278] gi|146190301|emb|CAL74297.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278] Length = 63 Score = 55.1 bits (131), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 27/54 (50%), Positives = 37/54 (68%), Gaps = 1/54 (1%) Query: 23 PLSSIAKRALEEAKQRKSANNKDAK-LPIEIGGRKGLDPTRFGDWEKNGISIDF 75 PL+ A+RAL EA++R+ + AK +P E+ G KG +PTR+GDWE GI DF Sbjct: 10 PLTPAAQRALAEAEERRRIAAEQAKPMPKELQGPKGPEPTRYGDWENKGIISDF 63 >gi|330813353|ref|YP_004357592.1| hypothetical protein SAR11G3_00378 [Candidatus Pelagibacter sp. IMCC9063] gi|327486448|gb|AEA80853.1| hypothetical protein SAR11G3_00378 [Candidatus Pelagibacter sp. IMCC9063] Length = 70 Score = 54.7 bits (130), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 28/52 (53%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 +AK+ALEEAK+RK + + K P EI G G +PTR+GDWEK GI DF Sbjct: 20 FKEMAKKALEEAKKRKKLKSVE-KAPKEINGPAGPEPTRYGDWEKKGIVSDF 70 >gi|163869267|ref|YP_001610523.1| hypothetical protein Btr_2572 [Bartonella tribocorum CIP 105476] gi|161018970|emb|CAK02528.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476] Length = 71 Score = 54.7 bits (130), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 32/64 (50%), Positives = 42/64 (65%), Gaps = 5/64 (7%) Query: 13 NNSTIKTSHDPLSSIAKRALEEAKQR-KSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 N + IK LS A+RAL+EA++R K A K+ P+E GGR G DP+R+GDWE G Sbjct: 12 NTTVIKQPS--LSPAAQRALKEAEERRKDATTKEQ--PLENGGRGGKDPSRYGDWEIKGR 67 Query: 72 SIDF 75 +IDF Sbjct: 68 AIDF 71 >gi|149912796|ref|ZP_01901330.1| hypothetical protein RAZWK3B_02370 [Roseobacter sp. AzwK-3b] gi|149813202|gb|EDM73028.1| hypothetical protein RAZWK3B_02370 [Roseobacter sp. AzwK-3b] Length = 59 Score = 54.7 bits (130), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 27/53 (50%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRK-GLDPTRFGDWEKNGISIDF 75 L A+RAL EA++R+ + LP E+GGR+ GL+P R+GDWEK G++IDF Sbjct: 8 LPPAAQRALAEAEERRR-KAEALDLPKELGGRREGLEPVRYGDWEKKGLAIDF 59 >gi|319899455|ref|YP_004159552.1| hypothetical protein BARCL_1319 [Bartonella clarridgeiae 73] gi|319403423|emb|CBI76991.1| conserved protein of unknown function [Bartonella clarridgeiae 73] Length = 68 Score = 54.3 bits (129), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 29/66 (43%), Positives = 40/66 (60%), Gaps = 3/66 (4%) Query: 11 LMNNSTIKTSHDPLSSIAKRALEEAKQR-KSANNKDAKLPIEIGGRKGLDPTRFGDWEKN 69 + T H L A+RAL+EA++R K A N++ P+E GGR G DP R+GDWE Sbjct: 5 MSTQDTAIPDHTRLPPEAQRALQEAEERRKHATNENQ--PLENGGRGGKDPVRYGDWEVK 62 Query: 70 GISIDF 75 G ++DF Sbjct: 63 GRAVDF 68 >gi|99079929|ref|YP_612083.1| hypothetical protein TM1040_0088 [Ruegeria sp. TM1040] gi|99036209|gb|ABF62821.1| protein of unknown function DUF1674 [Ruegeria sp. TM1040] Length = 64 Score = 54.3 bits (129), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 22/38 (57%), Positives = 28/38 (73%) Query: 38 RKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 R+ A + + LP E+GGR G DP R+GDWEK GI+IDF Sbjct: 27 RRKARDAEKPLPTELGGRDGPDPARYGDWEKKGIAIDF 64 >gi|254472306|ref|ZP_05085706.1| conserved hypothetical protein [Pseudovibrio sp. JE062] gi|211958589|gb|EEA93789.1| conserved hypothetical protein [Pseudovibrio sp. JE062] Length = 87 Score = 53.5 bits (127), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 26/76 (34%), Positives = 45/76 (59%), Gaps = 1/76 (1%) Query: 1 MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAK-LPIEIGGRKGLD 59 + ++++ + + K + L A+RAL+EA++R++ + K +P E+ GR GLD Sbjct: 12 FKAQEVDMSEQVEEAPKKRRFEDLPPAAQRALKEAEERRTEIDAAQKAMPKELNGRGGLD 71 Query: 60 PTRFGDWEKNGISIDF 75 P R+ DWE GI+ DF Sbjct: 72 PARYSDWEVKGITSDF 87 >gi|126738335|ref|ZP_01754056.1| hypothetical protein RSK20926_07362 [Roseobacter sp. SK209-2-6] gi|126720832|gb|EBA17537.1| hypothetical protein RSK20926_07362 [Roseobacter sp. SK209-2-6] Length = 102 Score = 52.8 bits (125), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 21/30 (70%), Positives = 23/30 (76%) Query: 46 AKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 A P E GGR GLDP R+GDWEK GI+IDF Sbjct: 73 APPPTEYGGRDGLDPARYGDWEKKGIAIDF 102 >gi|328541768|ref|YP_004301877.1| hypothetical protein SL003B_0144 [polymorphum gilvum SL003B-26A1] gi|326411520|gb|ADZ68583.1| hypothetical protein SL003B_0144 [Polymorphum gilvum SL003B-26A1] Length = 82 Score = 52.4 bits (124), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 26/53 (49%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Query: 24 LSSIAKRALEEAK-QRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L A+RAL+EA+ +RK + + LP EI GR GL+PTR+ DWE G++ DF Sbjct: 30 LPPAAQRALKEAEARRKEIDERQKVLPREIDGRGGLEPTRYEDWEIKGLTADF 82 >gi|319406334|emb|CBI79971.1| conserved hypothetical protein [Bartonella sp. AR 15-3] Length = 64 Score = 52.4 bits (124), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 3/49 (6%) Query: 28 AKRALEEAKQR-KSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 A+RAL+EA++R K A N++ P+E GGR G DP R+GDWE G ++DF Sbjct: 18 AQRALQEAEERRKCATNENQ--PLENGGRGGKDPARYGDWEVKGRAVDF 64 >gi|118591349|ref|ZP_01548747.1| hypothetical protein SIAM614_26918 [Stappia aggregata IAM 12614] gi|118436021|gb|EAV42664.1| hypothetical protein SIAM614_26918 [Stappia aggregata IAM 12614] Length = 87 Score = 52.0 bits (123), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Query: 24 LSSIAKRALEEAKQR-KSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L A+RAL EA++R K + + LP E+ GR GL+PTR+ DWE G++ DF Sbjct: 35 LPPAAQRALMEAEERRKEIDARQQNLPEEVNGRGGLEPTRYDDWEIKGLTSDF 87 >gi|71275730|ref|ZP_00652015.1| conserved hypothetical protein [Xylella fastidiosa Dixon] gi|71899528|ref|ZP_00681685.1| conserved hypothetical protein [Xylella fastidiosa Ann-1] gi|170729588|ref|YP_001775021.1| hypothetical protein Xfasm12_0377 [Xylella fastidiosa M12] gi|71163621|gb|EAO13338.1| conserved hypothetical protein [Xylella fastidiosa Dixon] gi|71730748|gb|EAO32822.1| conserved hypothetical protein [Xylella fastidiosa Ann-1] gi|167964381|gb|ACA11391.1| conserved hypothetical protein [Xylella fastidiosa M12] Length = 72 Score = 52.0 bits (123), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 8/60 (13%) Query: 16 TIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 ++ ++ D IAK A + KQR + E+GGR GLDP R+GDWEK+G IDF Sbjct: 21 SVCSAPDDSQEIAKNATADLKQRSNLE--------EVGGRGGLDPVRYGDWEKDGRCIDF 72 >gi|289665882|ref|ZP_06487463.1| hypothetical protein XcampvN_23097 [Xanthomonas campestris pv. vasculorum NCPPB702] gi|289669029|ref|ZP_06490104.1| hypothetical protein XcampmN_11167 [Xanthomonas campestris pv. musacearum NCPPB4381] Length = 142 Score = 51.2 bits (121), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 21/28 (75%), Positives = 23/28 (82%) Query: 48 LPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LP EIGGR G +PTR+GDWEKNG IDF Sbjct: 115 LPKEIGGRDGPEPTRYGDWEKNGRCIDF 142 >gi|77748629|ref|NP_642395.2| hypothetical protein XAC2073 [Xanthomonas axonopodis pv. citri str. 306] Length = 142 Score = 51.2 bits (121), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 21/28 (75%), Positives = 23/28 (82%) Query: 48 LPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LP EIGGR G +PTR+GDWEKNG IDF Sbjct: 115 LPKEIGGRDGPEPTRYGDWEKNGRCIDF 142 >gi|259417089|ref|ZP_05741008.1| conserved domain protein [Silicibacter sp. TrichCH4B] gi|259345995|gb|EEW57809.1| conserved domain protein [Silicibacter sp. TrichCH4B] Length = 64 Score = 51.2 bits (121), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 21/38 (55%), Positives = 25/38 (65%) Query: 38 RKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 R+ A P E+GGR G DP R+GDWEK GI+IDF Sbjct: 27 RRKAREAQHPQPTELGGRDGPDPARYGDWEKKGIAIDF 64 >gi|21108299|gb|AAM36931.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] Length = 88 Score = 51.2 bits (121), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 21/28 (75%), Positives = 23/28 (82%) Query: 48 LPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LP EIGGR G +PTR+GDWEKNG IDF Sbjct: 61 LPKEIGGRDGPEPTRYGDWEKNGRCIDF 88 >gi|78047796|ref|YP_363971.1| hypothetical protein XCV2240 [Xanthomonas campestris pv. vesicatoria str. 85-10] gi|78036226|emb|CAJ23917.1| conserved hypothetical protein [Xanthomonas campestris pv. vesicatoria str. 85-10] Length = 56 Score = 51.2 bits (121), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 21/29 (72%), Positives = 24/29 (82%) Query: 47 KLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 +LP EIGGR G +PTR+GDWEKNG IDF Sbjct: 28 QLPKEIGGRDGPEPTRYGDWEKNGRCIDF 56 >gi|188576490|ref|YP_001913419.1| hypothetical protein PXO_00605 [Xanthomonas oryzae pv. oryzae PXO99A] gi|188520942|gb|ACD58887.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae PXO99A] Length = 88 Score = 50.8 bits (120), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 21/28 (75%), Positives = 23/28 (82%) Query: 48 LPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LP EIGGR G +PTR+GDWEKNG IDF Sbjct: 61 LPKEIGGRDGPEPTRYGDWEKNGRCIDF 88 >gi|163744096|ref|ZP_02151462.1| hypothetical protein RG210_08094 [Phaeobacter gallaeciensis 2.10] gi|161382643|gb|EDQ07046.1| hypothetical protein RG210_08094 [Phaeobacter gallaeciensis 2.10] Length = 64 Score = 50.8 bits (120), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 20/30 (66%), Positives = 24/30 (80%) Query: 46 AKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 A P+E+GGR G DP R+GDWEK GI+IDF Sbjct: 35 ANRPVELGGRDGPDPARYGDWEKKGIAIDF 64 >gi|21231577|ref|NP_637494.1| hypothetical protein XCC2134 [Xanthomonas campestris pv. campestris str. ATCC 33913] gi|21113264|gb|AAM41418.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] Length = 88 Score = 50.8 bits (120), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 21/28 (75%), Positives = 23/28 (82%) Query: 48 LPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LP EIGGR G +PTR+GDWEKNG IDF Sbjct: 61 LPKEIGGRDGPEPTRYGDWEKNGRCIDF 88 >gi|15967079|ref|NP_387432.1| hypothetical protein SMc04092 [Sinorhizobium meliloti 1021] gi|307302541|ref|ZP_07582298.1| protein of unknown function DUF1674 [Sinorhizobium meliloti BL225C] gi|307316128|ref|ZP_07595572.1| protein of unknown function DUF1674 [Sinorhizobium meliloti AK83] gi|15076352|emb|CAC47905.1| Hypothetical protein SMc04092 [Sinorhizobium meliloti 1021] gi|306897968|gb|EFN28710.1| protein of unknown function DUF1674 [Sinorhizobium meliloti AK83] gi|306903211|gb|EFN33801.1| protein of unknown function DUF1674 [Sinorhizobium meliloti BL225C] Length = 84 Score = 50.8 bits (120), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Query: 13 NNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 N+++ PLS A RAL+EA++R+ A +P E+GGR GLDP RFGDWE G + Sbjct: 23 NDNSPDRPKRPLSPAALRALKEAEERRRAEAP-KDMPAELGGRGGLDPARFGDWEIKGRA 81 Query: 73 IDF 75 IDF Sbjct: 82 IDF 84 >gi|166712289|ref|ZP_02243496.1| hypothetical protein Xoryp_12750 [Xanthomonas oryzae pv. oryzicola BLS256] Length = 142 Score = 50.8 bits (120), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 20/28 (71%), Positives = 23/28 (82%) Query: 48 LPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LP EIGGR G +PTR+GDWEKNG +DF Sbjct: 115 LPKEIGGRDGPEPTRYGDWEKNGRCVDF 142 >gi|254295348|ref|YP_003061371.1| hypothetical protein Hbal_3006 [Hirschia baltica ATCC 49814] gi|254043879|gb|ACT60674.1| protein of unknown function DUF1674 [Hirschia baltica ATCC 49814] Length = 87 Score = 50.8 bits (120), Expect = 7e-05, Method: Compositional matrix adjust. Identities = 27/55 (49%), Positives = 34/55 (61%), Gaps = 3/55 (5%) Query: 24 LSSIAKRALEEAKQRKSANNKDA---KLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L+ AKRALEEA R+ A + KL E G G +PTR+GDWE+ GI+ DF Sbjct: 33 LTDAAKRALEEAAIRREAEMAETAKKKLVEEWNGPAGEEPTRYGDWERKGITYDF 87 >gi|66768301|ref|YP_243063.1| hypothetical protein XC_1979 [Xanthomonas campestris pv. campestris str. 8004] gi|66573633|gb|AAY49043.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris str. 8004] Length = 88 Score = 50.8 bits (120), Expect = 7e-05, Method: Compositional matrix adjust. Identities = 21/28 (75%), Positives = 23/28 (82%) Query: 48 LPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LP EIGGR G +PTR+GDWEKNG IDF Sbjct: 61 LPKEIGGRDGPEPTRYGDWEKNGRCIDF 88 >gi|188991440|ref|YP_001903450.1| hypothetical protein xccb100_2045 [Xanthomonas campestris pv. campestris str. B100] gi|167733200|emb|CAP51398.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris] Length = 79 Score = 50.4 bits (119), Expect = 8e-05, Method: Compositional matrix adjust. Identities = 21/28 (75%), Positives = 23/28 (82%) Query: 48 LPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LP EIGGR G +PTR+GDWEKNG IDF Sbjct: 52 LPKEIGGRDGPEPTRYGDWEKNGRCIDF 79 >gi|254503260|ref|ZP_05115411.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11] gi|222439331|gb|EEE46010.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11] Length = 87 Score = 50.4 bits (119), Expect = 8e-05, Method: Compositional matrix adjust. Identities = 24/53 (45%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Query: 24 LSSIAKRALEEAK-QRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L A+RAL+EA+ +RK + K + E+ GR GL+PTR+ DWE G+++DF Sbjct: 35 LPPAAQRALKEAEDRRKEIDAKHNAMAPEVDGRGGLEPTRYDDWEIKGLTVDF 87 >gi|227823842|ref|YP_002827815.1| hypothetical protein NGR_c33320 [Sinorhizobium fredii NGR234] gi|227342844|gb|ACP27062.1| hypothetical protein NGR_c33320 [Sinorhizobium fredii NGR234] Length = 66 Score = 50.4 bits (119), Expect = 8e-05, Method: Compositional matrix adjust. Identities = 32/63 (50%), Positives = 43/63 (68%), Gaps = 1/63 (1%) Query: 13 NNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 N+++ + PLS A RAL+EA++R+ A + A +P E GGR GLDP RFGDWE G + Sbjct: 5 NDNSPGHAKRPLSPAALRALKEAEERRRAEEQ-AAMPQEFGGRGGLDPARFGDWEIKGRA 63 Query: 73 IDF 75 IDF Sbjct: 64 IDF 66 >gi|260432195|ref|ZP_05786166.1| conserved domain protein [Silicibacter lacuscaerulensis ITI-1157] gi|260416023|gb|EEX09282.1| conserved domain protein [Silicibacter lacuscaerulensis ITI-1157] Length = 86 Score = 50.4 bits (119), Expect = 8e-05, Method: Compositional matrix adjust. Identities = 20/28 (71%), Positives = 23/28 (82%) Query: 48 LPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LP E+GGR G DP R+GDWEK GI+IDF Sbjct: 59 LPKELGGRDGPDPARYGDWEKKGIAIDF 86 >gi|307943519|ref|ZP_07658863.1| putative cytoplasmic protein [Roseibium sp. TrichSKD4] gi|307773149|gb|EFO32366.1| putative cytoplasmic protein [Roseibium sp. TrichSKD4] Length = 86 Score = 50.1 bits (118), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 25/63 (39%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Query: 14 NSTIKTSHDPLSSIAKRALEEAK-QRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 ++ K D L A+RAL+EA+ +RK + + + E+ GR GL+PTR+ DWE G++ Sbjct: 24 SAAPKKKFDDLPPAAQRALKEAEARRKDIDARHNAMEKEVDGRGGLEPTRYDDWEIKGLT 83 Query: 73 IDF 75 +DF Sbjct: 84 VDF 86 >gi|15837671|ref|NP_298359.1| hypothetical protein XF1069 [Xylella fastidiosa 9a5c] gi|9106016|gb|AAF83879.1|AE003943_10 hypothetical protein XF_1069 [Xylella fastidiosa 9a5c] Length = 72 Score = 50.1 bits (118), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 26/49 (53%), Positives = 29/49 (59%), Gaps = 8/49 (16%) Query: 27 IAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 IAK A + KQR EIGGR GLDP R+GDWEK+G IDF Sbjct: 32 IAKNATADLKQRSDLE--------EIGGRGGLDPVRYGDWEKDGRCIDF 72 >gi|58426528|gb|AAW75565.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae KACC10331] Length = 384 Score = 50.1 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 21/28 (75%), Positives = 23/28 (82%) Query: 48 LPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LP EIGGR G +PTR+GDWEKNG IDF Sbjct: 357 LPKEIGGRDGPEPTRYGDWEKNGRCIDF 384 >gi|28198266|ref|NP_778580.1| hypothetical protein PD0349 [Xylella fastidiosa Temecula1] gi|182680903|ref|YP_001829063.1| hypothetical protein XfasM23_0341 [Xylella fastidiosa M23] gi|28056336|gb|AAO28229.1| conserved hypothetical protein [Xylella fastidiosa Temecula1] gi|182631013|gb|ACB91789.1| protein of unknown function DUF1674 [Xylella fastidiosa M23] Length = 72 Score = 50.1 bits (118), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 25/60 (41%), Positives = 35/60 (58%), Gaps = 8/60 (13%) Query: 16 TIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 ++ ++ + IAK A + KQR + E+GGR GLDP R+GDWEK+G IDF Sbjct: 21 SVCSAPEDSQEIAKNATADLKQRSNLE--------EVGGRGGLDPVRYGDWEKDGRCIDF 72 >gi|71899437|ref|ZP_00681596.1| conserved hypothetical protein [Xylella fastidiosa Ann-1] gi|71730846|gb|EAO32918.1| conserved hypothetical protein [Xylella fastidiosa Ann-1] gi|307579371|gb|ADN63340.1| hypothetical protein XFLM_07120 [Xylella fastidiosa subsp. fastidiosa GB514] Length = 71 Score = 50.1 bits (118), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 25/60 (41%), Positives = 35/60 (58%), Gaps = 8/60 (13%) Query: 16 TIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 ++ ++ + IAK A + KQR + E+GGR GLDP R+GDWEK+G IDF Sbjct: 20 SVCSAPEDSQEIAKNATADLKQRSNLE--------EVGGRGGLDPVRYGDWEKDGRCIDF 71 >gi|163739807|ref|ZP_02147214.1| bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase [Phaeobacter gallaeciensis BS107] gi|161386841|gb|EDQ11203.1| bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase [Phaeobacter gallaeciensis BS107] Length = 64 Score = 49.7 bits (117), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 19/27 (70%), Positives = 23/27 (85%) Query: 49 PIEIGGRKGLDPTRFGDWEKNGISIDF 75 P+E+GGR G DP R+GDWEK GI+IDF Sbjct: 38 PVELGGRDGPDPARYGDWEKKGIAIDF 64 >gi|254486787|ref|ZP_05099992.1| conserved hypothetical protein [Roseobacter sp. GAI101] gi|214043656|gb|EEB84294.1| conserved hypothetical protein [Roseobacter sp. GAI101] Length = 92 Score = 49.7 bits (117), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 18/32 (56%), Positives = 26/32 (81%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 ++ +LP E+GGR G +P R+GDWEK GI++DF Sbjct: 61 QELELPPELGGRDGPEPVRYGDWEKKGIAVDF 92 >gi|329891247|ref|ZP_08269590.1| hypothetical protein BDIM_29600 [Brevundimonas diminuta ATCC 11568] gi|328846548|gb|EGF96112.1| hypothetical protein BDIM_29600 [Brevundimonas diminuta ATCC 11568] Length = 60 Score = 49.7 bits (117), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 19/27 (70%), Positives = 24/27 (88%) Query: 49 PIEIGGRKGLDPTRFGDWEKNGISIDF 75 P E+GGRKG +PTRFGDWEK G+++DF Sbjct: 34 PNEVGGRKGPEPTRFGDWEKKGLAVDF 60 >gi|192288465|ref|YP_001989070.1| hypothetical protein Rpal_0032 [Rhodopseudomonas palustris TIE-1] gi|192282214|gb|ACE98594.1| protein of unknown function DUF1674 [Rhodopseudomonas palustris TIE-1] Length = 72 Score = 49.3 bits (116), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 26/54 (48%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Query: 24 LSSIAKRALEEAKQRK--SANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L AKRAL EA+ R+ +A + +A+ E+ G KG +PTR+GDWE GI+ DF Sbjct: 20 LPEAAKRALAEAEARRVEAAKHAEARA-KEVQGPKGPEPTRYGDWEVKGIASDF 72 >gi|84515083|ref|ZP_01002446.1| hypothetical protein SKA53_12703 [Loktanella vestfoldensis SKA53] gi|84511242|gb|EAQ07696.1| hypothetical protein SKA53_12703 [Loktanella vestfoldensis SKA53] Length = 81 Score = 49.3 bits (116), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 20/28 (71%), Positives = 23/28 (82%) Query: 48 LPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LP E+GGR G +P RFGDWEK GI+IDF Sbjct: 54 LPPELGGRDGPEPVRFGDWEKKGIAIDF 81 >gi|89067212|ref|ZP_01154725.1| hypothetical protein OG2516_10246 [Oceanicola granulosus HTCC2516] gi|89046781|gb|EAR52835.1| hypothetical protein OG2516_10246 [Oceanicola granulosus HTCC2516] Length = 57 Score = 49.3 bits (116), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 18/32 (56%), Positives = 25/32 (78%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 +D LP E+GGR G +P R+GDWE+ GI++DF Sbjct: 26 QDTPLPTELGGRDGPEPVRYGDWERKGIAVDF 57 >gi|39933111|ref|NP_945387.1| hypothetical protein RPA0031 [Rhodopseudomonas palustris CGA009] gi|39652736|emb|CAE25475.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009] Length = 72 Score = 49.3 bits (116), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 26/54 (48%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Query: 24 LSSIAKRALEEAKQRK--SANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L AKRAL EA+ R+ +A + +A+ E+ G KG +PTR+GDWE GI+ DF Sbjct: 20 LPEAAKRALAEAEARRVEAAKHAEARA-KEVQGPKGPEPTRYGDWEVKGIASDF 72 >gi|197304917|pdb|2K5K|A Chain A, Solution Structure Of Rhr2 From Rhodobacter Sphaeroides. Northeast Structural Genomics Consortium Length = 70 Score = 49.3 bits (116), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 21/28 (75%), Positives = 23/28 (82%) Query: 48 LPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LP EIGGR G +P RFGDWEK GI+IDF Sbjct: 35 LPKEIGGRNGPEPVRFGDWEKKGIAIDF 62 >gi|77464686|ref|YP_354190.1| hypothetical protein RSP_1104 [Rhodobacter sphaeroides 2.4.1] gi|77389104|gb|ABA80289.1| hypothetical protein RSP_1104 [Rhodobacter sphaeroides 2.4.1] Length = 62 Score = 49.3 bits (116), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 21/28 (75%), Positives = 23/28 (82%) Query: 48 LPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LP EIGGR G +P RFGDWEK GI+IDF Sbjct: 35 LPKEIGGRNGPEPVRFGDWEKKGIAIDF 62 >gi|89056530|ref|YP_511981.1| hypothetical protein Jann_4039 [Jannaschia sp. CCS1] gi|88866079|gb|ABD56956.1| protein of unknown function DUF1674 [Jannaschia sp. CCS1] Length = 57 Score = 49.3 bits (116), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 18/32 (56%), Positives = 26/32 (81%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K ++PIE+GGR G +P R+GDWE+ GI++DF Sbjct: 26 KAQEMPIELGGRDGPEPVRYGDWERKGIAVDF 57 >gi|16124358|ref|NP_418922.1| hypothetical protein CC_0103 [Caulobacter crescentus CB15] gi|221233041|ref|YP_002515477.1| cytosolic protein [Caulobacter crescentus NA1000] gi|13421208|gb|AAK22090.1| hypothetical protein CC_0103 [Caulobacter crescentus CB15] gi|220962213|gb|ACL93569.1| hypothetical cytosolic protein [Caulobacter crescentus NA1000] Length = 92 Score = 49.3 bits (116), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 19/28 (67%), Positives = 23/28 (82%) Query: 48 LPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LP E GGR G +PTRFGDWEK G+++DF Sbjct: 65 LPPEEGGRDGPEPTRFGDWEKKGVAVDF 92 >gi|319786899|ref|YP_004146374.1| hypothetical protein Psesu_1295 [Pseudoxanthomonas suwonensis 11-1] gi|317465411|gb|ADV27143.1| protein of unknown function DUF1674 [Pseudoxanthomonas suwonensis 11-1] Length = 56 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 24/45 (53%), Positives = 31/45 (68%), Gaps = 2/45 (4%) Query: 33 EEAKQRKSANNKDA--KLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 E+A + + +DA P EIGGR+G +PTR+GDWEKNG IDF Sbjct: 12 EDAPEGVPSLEQDAGKPTPREIGGREGPEPTRYGDWEKNGRCIDF 56 >gi|149203490|ref|ZP_01880460.1| hypothetical protein RTM1035_02695 [Roseovarius sp. TM1035] gi|149143323|gb|EDM31362.1| hypothetical protein RTM1035_02695 [Roseovarius sp. TM1035] Length = 63 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 32/65 (49%), Positives = 42/65 (64%), Gaps = 3/65 (4%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRK-GLDPTRFGDWEKNG 70 M + T S D L A+RAL EA+ R+ A LP E+GGR+ GL+P R+GDWEK G Sbjct: 1 MTDDTQTPSRD-LPPAAQRALAEAEARRKAAEA-LDLPRELGGRREGLEPVRYGDWEKKG 58 Query: 71 ISIDF 75 ++IDF Sbjct: 59 LAIDF 63 >gi|114767263|ref|ZP_01446113.1| hypothetical protein 1100011001213_R2601_08621 [Pelagibaca bermudensis HTCC2601] gi|114540616|gb|EAU43688.1| hypothetical protein R2601_08621 [Roseovarius sp. HTCC2601] Length = 65 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 20/27 (74%), Positives = 22/27 (81%) Query: 49 PIEIGGRKGLDPTRFGDWEKNGISIDF 75 P E GGR GLDP R+GDWEK GI+IDF Sbjct: 39 PKEYGGRDGLDPARYGDWEKKGIAIDF 65 >gi|260428493|ref|ZP_05782472.1| conserved domain protein [Citreicella sp. SE45] gi|260422985|gb|EEX16236.1| conserved domain protein [Citreicella sp. SE45] Length = 65 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 19/27 (70%), Positives = 22/27 (81%) Query: 49 PIEIGGRKGLDPTRFGDWEKNGISIDF 75 P E GGR GLDP R+GDWEK G++IDF Sbjct: 39 PKEYGGRDGLDPARYGDWEKKGLAIDF 65 >gi|114326939|ref|YP_744096.1| putative cytoplasmic protein [Granulibacter bethesdensis CGDNIH1] gi|114315113|gb|ABI61173.1| hypothetical cytosolic protein [Granulibacter bethesdensis CGDNIH1] Length = 68 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 21/36 (58%), Positives = 24/36 (66%) Query: 40 SANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 A D P+E GG KG +PTRFGDWE+NG IDF Sbjct: 33 PATIADTAQPVEHGGPKGPEPTRFGDWERNGRCIDF 68 >gi|285018597|ref|YP_003376308.1| hypothetical protein XALc_1827 [Xanthomonas albilineans GPE PC73] gi|283473815|emb|CBA16317.1| conserved hypothetical protein [Xanthomonas albilineans] Length = 56 Score = 48.9 bits (115), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 20/25 (80%), Positives = 22/25 (88%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGGR GL+PTR+GDWEKNG IDF Sbjct: 32 EIGGRGGLEPTRYGDWEKNGRCIDF 56 >gi|83855203|ref|ZP_00948733.1| hypothetical protein NAS141_10746 [Sulfitobacter sp. NAS-14.1] gi|83941725|ref|ZP_00954187.1| hypothetical protein EE36_05813 [Sulfitobacter sp. EE-36] gi|83843046|gb|EAP82213.1| hypothetical protein NAS141_10746 [Sulfitobacter sp. NAS-14.1] gi|83847545|gb|EAP85420.1| hypothetical protein EE36_05813 [Sulfitobacter sp. EE-36] Length = 91 Score = 48.9 bits (115), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 18/28 (64%), Positives = 23/28 (82%) Query: 48 LPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LP E+GGR G +P R+GDWEK GI++DF Sbjct: 64 LPTELGGRDGPEPVRYGDWEKKGIAVDF 91 >gi|163745467|ref|ZP_02152827.1| hypothetical protein OIHEL45_07750 [Oceanibulbus indolifex HEL-45] gi|161382285|gb|EDQ06694.1| hypothetical protein OIHEL45_07750 [Oceanibulbus indolifex HEL-45] Length = 101 Score = 48.5 bits (114), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 18/28 (64%), Positives = 23/28 (82%) Query: 48 LPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LP E+GGR G +P R+GDWEK GI++DF Sbjct: 74 LPAELGGRDGPEPVRYGDWEKKGIAVDF 101 >gi|114797835|ref|YP_762039.1| hypothetical protein HNE_3366 [Hyphomonas neptunium ATCC 15444] gi|114738009|gb|ABI76134.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444] Length = 69 Score = 48.1 bits (113), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 29/54 (53%), Positives = 38/54 (70%), Gaps = 2/54 (3%) Query: 24 LSSIAKRALEEAKQRKSANNKDAK-LPI-EIGGRKGLDPTRFGDWEKNGISIDF 75 L A+RALEEA+ RK+ + DA LP E GG K ++PTR+GDWE+ GI+ DF Sbjct: 16 LPETARRALEEAEARKAKDAADAAALPKDEFGGPKSIEPTRYGDWERKGIAYDF 69 >gi|182679036|ref|YP_001833182.1| hypothetical protein Bind_2072 [Beijerinckia indica subsp. indica ATCC 9039] gi|182634919|gb|ACB95693.1| protein of unknown function DUF1674 [Beijerinckia indica subsp. indica ATCC 9039] Length = 75 Score = 48.1 bits (113), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 21/39 (53%), Positives = 27/39 (69%) Query: 37 QRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 +RK + + LP EI GR G +P R+GDWEKNGI+ DF Sbjct: 37 RRKLHDAQHNTLPKEINGRDGPEPVRYGDWEKNGIASDF 75 >gi|126736248|ref|ZP_01751991.1| hypothetical protein RCCS2_10935 [Roseobacter sp. CCS2] gi|126714414|gb|EBA11282.1| hypothetical protein RCCS2_10935 [Roseobacter sp. CCS2] Length = 58 Score = 47.8 bits (112), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 21/39 (53%), Positives = 29/39 (74%), Gaps = 2/39 (5%) Query: 37 QRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 +RK A+ + LP E+GGR G +P R+GDWEK G++IDF Sbjct: 22 RRKKADAQ--TLPPELGGRDGPEPVRYGDWEKKGLAIDF 58 >gi|86359689|ref|YP_471581.1| hypothetical protein RHE_CH04111 [Rhizobium etli CFN 42] gi|86283791|gb|ABC92854.1| hypothetical conserved protein [Rhizobium etli CFN 42] Length = 74 Score = 47.8 bits (112), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 21/34 (61%), Positives = 25/34 (73%) Query: 42 NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 N K +LP EIGGR G +P RFGD+E NG +IDF Sbjct: 41 NQKPLELPPEIGGRGGAEPARFGDYEINGRAIDF 74 >gi|27375689|ref|NP_767218.1| hypothetical protein bsl0578 [Bradyrhizobium japonicum USDA 110] gi|27348827|dbj|BAC45843.1| bsl0578 [Bradyrhizobium japonicum USDA 110] Length = 69 Score = 47.8 bits (112), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 31/69 (44%), Positives = 42/69 (60%), Gaps = 5/69 (7%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSAN----NKDAK-LPIEIGGRKGLDPTRFGDW 66 M++ + PLS A+RAL EA+ R+ A DAK P E+ G KG +PTR+GDW Sbjct: 1 MSDQPPVSDRKPLSPAAQRALAEAEARRQAAAIQAEDDAKATPKELQGPKGPEPTRYGDW 60 Query: 67 EKNGISIDF 75 E+ GI+ DF Sbjct: 61 ERKGIASDF 69 >gi|116254450|ref|YP_770288.1| hypothetical protein RL4726 [Rhizobium leguminosarum bv. viciae 3841] gi|115259098|emb|CAK10209.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae 3841] Length = 74 Score = 47.8 bits (112), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 21/34 (61%), Positives = 25/34 (73%) Query: 42 NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 N K +LP EIGGR G +P RFGD+E NG +IDF Sbjct: 41 NQKPLELPPEIGGRGGAEPARFGDYEINGRAIDF 74 >gi|167648732|ref|YP_001686395.1| hypothetical protein Caul_4777 [Caulobacter sp. K31] gi|167351162|gb|ABZ73897.1| protein of unknown function DUF1674 [Caulobacter sp. K31] Length = 71 Score = 47.8 bits (112), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 18/28 (64%), Positives = 23/28 (82%) Query: 48 LPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LP E GGR G +PTRFGDWE+ G+++DF Sbjct: 44 LPTEEGGRDGPEPTRFGDWERKGVAVDF 71 >gi|254476553|ref|ZP_05089939.1| conserved hypothetical protein [Ruegeria sp. R11] gi|214030796|gb|EEB71631.1| conserved hypothetical protein [Ruegeria sp. R11] Length = 64 Score = 47.8 bits (112), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 19/27 (70%), Positives = 22/27 (81%) Query: 49 PIEIGGRKGLDPTRFGDWEKNGISIDF 75 P E+GGR G DP R+GDWEK GI+IDF Sbjct: 38 PKELGGRDGPDPARYGDWEKKGIAIDF 64 >gi|295687554|ref|YP_003591247.1| hypothetical protein Cseg_0102 [Caulobacter segnis ATCC 21756] gi|295429457|gb|ADG08629.1| protein of unknown function DUF1674 [Caulobacter segnis ATCC 21756] Length = 73 Score = 47.8 bits (112), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 18/27 (66%), Positives = 23/27 (85%) Query: 49 PIEIGGRKGLDPTRFGDWEKNGISIDF 75 P E GGR+G +PTRFGDWEK G+++DF Sbjct: 47 PPEKGGREGPEPTRFGDWEKKGVAVDF 73 >gi|288957513|ref|YP_003447854.1| hypothetical protein AZL_006720 [Azospirillum sp. B510] gi|288909821|dbj|BAI71310.1| hypothetical protein AZL_006720 [Azospirillum sp. B510] Length = 81 Score = 47.4 bits (111), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 25/64 (39%), Positives = 31/64 (48%), Gaps = 4/64 (6%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 M K D ++A + EA + K K P EIGG KG +PTR+GDWE G Sbjct: 22 MMTEPTKPQQDAAEAVADTTITEAAEPKGPEQK----PGEIGGPKGPEPTRYGDWEFKGR 77 Query: 72 SIDF 75 DF Sbjct: 78 CSDF 81 >gi|194365312|ref|YP_002027922.1| hypothetical protein Smal_1534 [Stenotrophomonas maltophilia R551-3] gi|194348116|gb|ACF51239.1| protein of unknown function DUF1674 [Stenotrophomonas maltophilia R551-3] Length = 56 Score = 47.4 bits (111), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 25/56 (44%), Positives = 28/56 (50%), Gaps = 12/56 (21%) Query: 20 SHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 S PL A +E+ K E GGR GLDP R+GDWEKNG IDF Sbjct: 13 SEAPLVPAAPVPVEQEKAE------------EFGGRGGLDPVRYGDWEKNGRCIDF 56 >gi|87201109|ref|YP_498366.1| hypothetical protein Saro_3097 [Novosphingobium aromaticivorans DSM 12444] gi|87136790|gb|ABD27532.1| protein of unknown function DUF1674 [Novosphingobium aromaticivorans DSM 12444] Length = 82 Score = 47.4 bits (111), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 30/78 (38%), Positives = 40/78 (51%), Gaps = 4/78 (5%) Query: 1 MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLP--IEIGGRK-G 57 +R + +R + I T D L+ A R + + N+ P +E G G Sbjct: 6 LRCPKWQLR-FASGKPICTGMDKLTPRATRRPADFTRPTHWTNEPVPAPKAVERGDDPDG 64 Query: 58 LDPTRFGDWEKNGISIDF 75 LDPTRFGDWEKNGI+IDF Sbjct: 65 LDPTRFGDWEKNGIAIDF 82 >gi|197106964|ref|YP_002132341.1| hypothetical protein PHZ_c3503 [Phenylobacterium zucineum HLK1] gi|196480384|gb|ACG79912.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1] Length = 67 Score = 47.0 bits (110), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 28/52 (53%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LS A+RALEEA+ R+ A + + P E GG +G +PTRFGDWE+ GI++DF Sbjct: 17 LSPAARRALEEAEARRKAAAEAERAP-EQGGPRGPEPTRFGDWERKGIAVDF 67 >gi|153008425|ref|YP_001369640.1| hypothetical protein Oant_1091 [Ochrobactrum anthropi ATCC 49188] gi|151560313|gb|ABS13811.1| protein of unknown function DUF1674 [Ochrobactrum anthropi ATCC 49188] Length = 69 Score = 46.2 bits (108), Expect = 0.002, Method: Compositional matrix adjust. Identities = 30/58 (51%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K + + L A+RAL+EA+ R++A + + P EIGGR G DP RFGDWE G SIDF Sbjct: 13 KRTFEDLPPAAQRALKEAEARRAAEKAN-EAPREIGGRGGKDPARFGDWEIKGRSIDF 69 >gi|84500522|ref|ZP_00998771.1| hypothetical protein OB2597_11206 [Oceanicola batsensis HTCC2597] gi|84391475|gb|EAQ03807.1| hypothetical protein OB2597_11206 [Oceanicola batsensis HTCC2597] Length = 60 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 17/27 (62%), Positives = 22/27 (81%) Query: 49 PIEIGGRKGLDPTRFGDWEKNGISIDF 75 P E+GGR G +P R+GDWEK GI++DF Sbjct: 34 PPELGGRDGPEPVRYGDWEKKGIAVDF 60 >gi|218510861|ref|ZP_03508739.1| hypothetical protein RetlB5_27692 [Rhizobium etli Brasil 5] Length = 44 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 24/45 (53%), Positives = 30/45 (66%), Gaps = 1/45 (2%) Query: 31 ALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 AL EA++R+ N K L EI GR G +P RFGD+E NG +IDF Sbjct: 1 ALAEAEERRK-NQKPLDLAPEISGRGGAEPARFGDYEINGRAIDF 44 >gi|224132902|ref|XP_002321437.1| predicted protein [Populus trichocarpa] gi|118483577|gb|ABK93686.1| unknown [Populus trichocarpa] gi|222868433|gb|EEF05564.1| predicted protein [Populus trichocarpa] Length = 118 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 25/59 (42%), Positives = 32/59 (54%), Gaps = 8/59 (13%) Query: 25 SSIAKRALEEAKQRKSANNKDA--------KLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 ++ K+ EE + S N +D K EIGG KG +PTRFGDWE+NG DF Sbjct: 60 ETVKKQEQEEITHQDSQNEEDDEDGGEYVNKETGEIGGPKGPEPTRFGDWERNGRCSDF 118 >gi|316931427|ref|YP_004106409.1| hypothetical protein Rpdx1_0032 [Rhodopseudomonas palustris DX-1] gi|315599141|gb|ADU41676.1| protein of unknown function DUF1674 [Rhodopseudomonas palustris DX-1] Length = 72 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 25/53 (47%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Query: 24 LSSIAKRALEEAKQRK-SANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L AKRAL EA+ R+ A E+ G KG +PTR+GDWE GI+ DF Sbjct: 20 LPEAAKRALAEAEARRVEAARHAEARAKEVQGPKGPEPTRYGDWEVKGIASDF 72 >gi|310816802|ref|YP_003964766.1| hypothetical protein EIO_2378 [Ketogulonicigenium vulgare Y25] gi|308755537|gb|ADO43466.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25] Length = 59 Score = 45.4 bits (106), Expect = 0.002, Method: Compositional matrix adjust. Identities = 17/25 (68%), Positives = 22/25 (88%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+GGR GL+P R+GDWEK G++IDF Sbjct: 35 ELGGRDGLEPVRYGDWEKKGLAIDF 59 >gi|241206927|ref|YP_002978023.1| hypothetical protein Rleg_4244 [Rhizobium leguminosarum bv. trifolii WSM1325] gi|240860817|gb|ACS58484.1| protein of unknown function DUF1674 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 74 Score = 45.4 bits (106), Expect = 0.002, Method: Compositional matrix adjust. Identities = 20/32 (62%), Positives = 24/32 (75%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K +LP EIGGR G +P RFGD+E NG +IDF Sbjct: 43 KPLELPPEIGGRGGAEPARFGDYEINGRAIDF 74 >gi|92115830|ref|YP_575559.1| hypothetical protein Nham_0198 [Nitrobacter hamburgensis X14] gi|91798724|gb|ABE61099.1| protein of unknown function DUF1674 [Nitrobacter hamburgensis X14] Length = 72 Score = 45.4 bits (106), Expect = 0.003, Method: Compositional matrix adjust. Identities = 19/27 (70%), Positives = 22/27 (81%) Query: 49 PIEIGGRKGLDPTRFGDWEKNGISIDF 75 P EI G KG +PTRFGDWE+NGI+ DF Sbjct: 46 PKEIQGPKGPEPTRFGDWERNGIASDF 72 >gi|126730444|ref|ZP_01746255.1| hypothetical protein SSE37_11829 [Sagittula stellata E-37] gi|126709177|gb|EBA08232.1| hypothetical protein SSE37_11829 [Sagittula stellata E-37] Length = 61 Score = 45.1 bits (105), Expect = 0.003, Method: Compositional matrix adjust. Identities = 17/28 (60%), Positives = 21/28 (75%) Query: 48 LPIEIGGRKGLDPTRFGDWEKNGISIDF 75 P E GGR G +P R+GDWEK G++IDF Sbjct: 34 FPKEYGGRDGPEPVRYGDWEKKGLAIDF 61 >gi|83594907|ref|YP_428659.1| hypothetical protein Rru_A3578 [Rhodospirillum rubrum ATCC 11170] gi|83577821|gb|ABC24372.1| hypothetical protein Rru_A3578 [Rhodospirillum rubrum ATCC 11170] Length = 65 Score = 45.1 bits (105), Expect = 0.003, Method: Compositional matrix adjust. Identities = 26/65 (40%), Positives = 35/65 (53%), Gaps = 9/65 (13%) Query: 19 TSHDPLSSIAKRALEEAKQRKSANNK--------DAKLPIEIGGRKGLDPTRFGDWEKNG 70 TS DP + A A +EA A ++ D K P+E GG +G +PTR+ DWE+NG Sbjct: 2 TSKDPRPAPASPAQDEAVPAPLAQDEAVPASPPADPK-PVEHGGPRGPEPTRYNDWERNG 60 Query: 71 ISIDF 75 DF Sbjct: 61 RCSDF 65 >gi|323137518|ref|ZP_08072595.1| protein of unknown function DUF1674 [Methylocystis sp. ATCC 49242] gi|322397144|gb|EFX99668.1| protein of unknown function DUF1674 [Methylocystis sp. ATCC 49242] Length = 70 Score = 45.1 bits (105), Expect = 0.003, Method: Compositional matrix adjust. Identities = 27/69 (39%), Positives = 33/69 (47%), Gaps = 19/69 (27%) Query: 26 SIAKRALEEAKQRKSANN-------------------KDAKLPIEIGGRKGLDPTRFGDW 66 S A RA ++ K R++ NN D EIGGR GLDP RFGDW Sbjct: 2 SDAPRASDDDKHRETKNNLPAAAQRALAEAEARRRDAVDKAKATEIGGRGGLDPARFGDW 61 Query: 67 EKNGISIDF 75 E G++ DF Sbjct: 62 EVKGVASDF 70 >gi|13473482|ref|NP_105049.1| hypothetical protein msl4095 [Mesorhizobium loti MAFF303099] gi|14024231|dbj|BAB50835.1| msl4095 [Mesorhizobium loti MAFF303099] Length = 77 Score = 45.1 bits (105), Expect = 0.003, Method: Compositional matrix adjust. Identities = 18/32 (56%), Positives = 24/32 (75%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K+A LP E+GGR G +P R+GDWE G++ DF Sbjct: 46 KEAALPKEVGGRGGKEPGRYGDWEVKGLTSDF 77 >gi|260466789|ref|ZP_05812974.1| protein of unknown function DUF1674 [Mesorhizobium opportunistum WSM2075] gi|259029401|gb|EEW30692.1| protein of unknown function DUF1674 [Mesorhizobium opportunistum WSM2075] Length = 73 Score = 45.1 bits (105), Expect = 0.003, Method: Compositional matrix adjust. Identities = 19/32 (59%), Positives = 24/32 (75%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K+A LP EIGGR G +P R+GDWE G++ DF Sbjct: 42 KEAALPREIGGRGGKEPGRYGDWEVKGLTSDF 73 >gi|91205955|ref|YP_538310.1| hypothetical protein RBE_1140 [Rickettsia bellii RML369-C] gi|157826684|ref|YP_001495748.1| hypothetical protein A1I_01605 [Rickettsia bellii OSU 85-389] gi|91069499|gb|ABE05221.1| unknown [Rickettsia bellii RML369-C] gi|157801988|gb|ABV78711.1| hypothetical protein A1I_01605 [Rickettsia bellii OSU 85-389] Length = 47 Score = 45.1 bits (105), Expect = 0.004, Method: Compositional matrix adjust. Identities = 18/32 (56%), Positives = 24/32 (75%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K+ ++P EIGG KGL+PTR+GDW+ G DF Sbjct: 16 KEKEMPKEIGGAKGLEPTRYGDWQHKGKVTDF 47 >gi|255631818|gb|ACU16276.1| unknown [Glycine max] Length = 106 Score = 44.7 bits (104), Expect = 0.004, Method: Compositional matrix adjust. Identities = 28/79 (35%), Positives = 38/79 (48%), Gaps = 11/79 (13%) Query: 8 IRGLMNNSTIKTSHDPLSSIAKRALEEA-----KQRKSANNKDA------KLPIEIGGRK 56 R L ++ST +P+ + +E+ KQR D K EIGG K Sbjct: 28 TRLLCSSSTQPQHENPVREQTQTPPQESLHDENKQRYEPKEDDGDGDSINKETGEIGGPK 87 Query: 57 GLDPTRFGDWEKNGISIDF 75 G +PTR+GDWE+NG DF Sbjct: 88 GPEPTRYGDWERNGRCSDF 106 >gi|237816178|ref|ZP_04595173.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] gi|260755500|ref|ZP_05867848.1| predicted protein [Brucella abortus bv. 6 str. 870] gi|260758723|ref|ZP_05871071.1| predicted protein [Brucella abortus bv. 4 str. 292] gi|260762557|ref|ZP_05874894.1| predicted protein [Brucella abortus bv. 2 str. 86/8/59] gi|260884521|ref|ZP_05896135.1| predicted protein [Brucella abortus bv. 9 str. C68] gi|261214771|ref|ZP_05929052.1| predicted protein [Brucella abortus bv. 3 str. Tulya] gi|261219384|ref|ZP_05933665.1| predicted protein [Brucella ceti M13/05/1] gi|261222926|ref|ZP_05937207.1| predicted protein [Brucella ceti B1/94] gi|261315835|ref|ZP_05955032.1| predicted protein [Brucella pinnipedialis M163/99/10] gi|261316305|ref|ZP_05955502.1| predicted protein [Brucella pinnipedialis B2/94] gi|261322446|ref|ZP_05961643.1| predicted protein [Brucella ceti M644/93/1] gi|261325840|ref|ZP_05965037.1| predicted protein [Brucella neotomae 5K33] gi|261750957|ref|ZP_05994666.1| predicted protein [Brucella suis bv. 5 str. 513] gi|261754211|ref|ZP_05997920.1| predicted protein [Brucella suis bv. 3 str. 686] gi|265987372|ref|ZP_06099929.1| predicted protein [Brucella pinnipedialis M292/94/1] gi|265991838|ref|ZP_06104395.1| predicted protein [Brucella melitensis bv. 1 str. Rev.1] gi|265995676|ref|ZP_06108233.1| predicted protein [Brucella melitensis bv. 3 str. Ether] gi|265998885|ref|ZP_06111442.1| predicted protein [Brucella ceti M490/95/1] gi|237788640|gb|EEP62853.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] gi|260669041|gb|EEX55981.1| predicted protein [Brucella abortus bv. 4 str. 292] gi|260672983|gb|EEX59804.1| predicted protein [Brucella abortus bv. 2 str. 86/8/59] gi|260675608|gb|EEX62429.1| predicted protein [Brucella abortus bv. 6 str. 870] gi|260874049|gb|EEX81118.1| predicted protein [Brucella abortus bv. 9 str. C68] gi|260916378|gb|EEX83239.1| predicted protein [Brucella abortus bv. 3 str. Tulya] gi|260921510|gb|EEX88163.1| predicted protein [Brucella ceti B1/94] gi|260924473|gb|EEX91041.1| predicted protein [Brucella ceti M13/05/1] gi|261295136|gb|EEX98632.1| predicted protein [Brucella ceti M644/93/1] gi|261295528|gb|EEX99024.1| predicted protein [Brucella pinnipedialis B2/94] gi|261301820|gb|EEY05317.1| predicted protein [Brucella neotomae 5K33] gi|261304861|gb|EEY08358.1| predicted protein [Brucella pinnipedialis M163/99/10] gi|261740710|gb|EEY28636.1| predicted protein [Brucella suis bv. 5 str. 513] gi|261743964|gb|EEY31890.1| predicted protein [Brucella suis bv. 3 str. 686] gi|262553574|gb|EEZ09343.1| predicted protein [Brucella ceti M490/95/1] gi|262766960|gb|EEZ12578.1| predicted protein [Brucella melitensis bv. 3 str. Ether] gi|263002794|gb|EEZ15197.1| predicted protein [Brucella melitensis bv. 1 str. Rev.1] gi|264659569|gb|EEZ29830.1| predicted protein [Brucella pinnipedialis M292/94/1] Length = 82 Score = 44.7 bits (104), Expect = 0.005, Method: Compositional matrix adjust. Identities = 29/52 (55%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L A+RAL+EA+ R++A KLP EIGGR G DP R+GDWE G +IDF Sbjct: 32 LPPAAQRALKEAEARRAAEKA-EKLPREIGGRGGKDPARYGDWEIKGRTIDF 82 >gi|148559813|ref|YP_001259651.1| hypothetical protein BOV_1745 [Brucella ovis ATCC 25840] gi|148371070|gb|ABQ61049.1| conserved hypothetical protein [Brucella ovis ATCC 25840] Length = 72 Score = 44.7 bits (104), Expect = 0.005, Method: Compositional matrix adjust. Identities = 29/52 (55%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L A+RAL+EA+ R++A KLP EIGGR G DP R+GDWE G +IDF Sbjct: 22 LPPAAQRALKEAEARRAAEKA-EKLPREIGGRGGKDPARYGDWEIKGRTIDF 72 >gi|148261840|ref|YP_001235967.1| hypothetical protein Acry_2858 [Acidiphilium cryptum JF-5] gi|146403521|gb|ABQ32048.1| protein of unknown function DUF1674 [Acidiphilium cryptum JF-5] Length = 58 Score = 44.7 bits (104), Expect = 0.005, Method: Compositional matrix adjust. Identities = 18/28 (64%), Positives = 21/28 (75%) Query: 48 LPIEIGGRKGLDPTRFGDWEKNGISIDF 75 P EIGG KG +PTR+GDWE+NG DF Sbjct: 31 WPKEIGGPKGPEPTRYGDWERNGRCTDF 58 >gi|23502665|ref|NP_698792.1| hypothetical protein BR1812 [Brucella suis 1330] gi|62290677|ref|YP_222470.1| hypothetical protein BruAb1_1792 [Brucella abortus bv. 1 str. 9-941] gi|82700592|ref|YP_415166.1| hypothetical protein BAB1_1820 [Brucella melitensis biovar Abortus 2308] gi|225628366|ref|ZP_03786400.1| Hypothetical protein, conserved [Brucella ceti str. Cudo] gi|256370216|ref|YP_003107727.1| hypothetical protein BMI_I1828 [Brucella microti CCM 4915] gi|294851051|ref|ZP_06791727.1| hypothetical protein BAZG_03184 [Brucella sp. NVSL 07-0026] gi|297249069|ref|ZP_06932777.1| hypothetical protein BAYG_03111 [Brucella abortus bv. 5 str. B3196] gi|23348674|gb|AAN30707.1| conserved hypothetical protein [Brucella suis 1330] gi|62196809|gb|AAX75109.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941] gi|82616693|emb|CAJ11776.1| conserved hypothetical protein [Brucella melitensis biovar Abortus 2308] gi|225616212|gb|EEH13260.1| Hypothetical protein, conserved [Brucella ceti str. Cudo] gi|256000379|gb|ACU48778.1| hypothetical protein BMI_I1828 [Brucella microti CCM 4915] gi|294821694|gb|EFG38690.1| hypothetical protein BAZG_03184 [Brucella sp. NVSL 07-0026] gi|297174202|gb|EFH33559.1| hypothetical protein BAYG_03111 [Brucella abortus bv. 5 str. B3196] Length = 75 Score = 44.7 bits (104), Expect = 0.005, Method: Compositional matrix adjust. Identities = 29/52 (55%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L A+RAL+EA+ R++A KLP EIGGR G DP R+GDWE G +IDF Sbjct: 25 LPPAAQRALKEAEARRAAEKA-EKLPREIGGRGGKDPARYGDWEIKGRTIDF 75 >gi|265984819|ref|ZP_06097554.1| predicted protein [Brucella sp. 83/13] gi|264663411|gb|EEZ33672.1| predicted protein [Brucella sp. 83/13] Length = 82 Score = 44.3 bits (103), Expect = 0.005, Method: Compositional matrix adjust. Identities = 29/52 (55%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L A+RAL+EA+ R++A KLP EIGGR G DP R+GDWE G +IDF Sbjct: 32 LPPAAQRALKEAEARRAAEKA-EKLPREIGGRGGKDPARYGDWEIKGRTIDF 82 >gi|17986521|ref|NP_539155.1| putative cytoplasmic protein [Brucella melitensis bv. 1 str. 16M] gi|161619732|ref|YP_001593619.1| hypothetical protein BCAN_A1850 [Brucella canis ATCC 23365] gi|163845390|ref|YP_001623045.1| hypothetical protein BSUIS_B1290 [Brucella suis ATCC 23445] gi|189024889|ref|YP_001935657.1| hypothetical protein BAbS19_I17010 [Brucella abortus S19] gi|225853256|ref|YP_002733489.1| hypothetical protein BMEA_A1862 [Brucella melitensis ATCC 23457] gi|254689965|ref|ZP_05153219.1| hypothetical protein Babob68_07309 [Brucella abortus bv. 6 str. 870] gi|254694457|ref|ZP_05156285.1| hypothetical protein Babob3T_07312 [Brucella abortus bv. 3 str. Tulya] gi|254698116|ref|ZP_05159944.1| hypothetical protein Babob28_10503 [Brucella abortus bv. 2 str. 86/8/59] gi|254700456|ref|ZP_05162284.1| hypothetical protein Bsuib55_06329 [Brucella suis bv. 5 str. 513] gi|254703578|ref|ZP_05165406.1| hypothetical protein Bsuib36_06574 [Brucella suis bv. 3 str. 686] gi|254708335|ref|ZP_05170163.1| hypothetical protein BpinM_15630 [Brucella pinnipedialis M163/99/10] gi|254708812|ref|ZP_05170623.1| hypothetical protein BpinB_00846 [Brucella pinnipedialis B2/94] gi|254714652|ref|ZP_05176463.1| hypothetical protein BcetM6_15207 [Brucella ceti M644/93/1] gi|254717550|ref|ZP_05179361.1| hypothetical protein BcetM_14336 [Brucella ceti M13/05/1] gi|254731000|ref|ZP_05189578.1| hypothetical protein Babob42_07342 [Brucella abortus bv. 4 str. 292] gi|256030338|ref|ZP_05443952.1| hypothetical protein BpinM2_06766 [Brucella pinnipedialis M292/94/1] gi|256045411|ref|ZP_05448303.1| hypothetical protein Bmelb1R_13019 [Brucella melitensis bv. 1 str. Rev.1] gi|256061835|ref|ZP_05451970.1| hypothetical protein Bneo5_15958 [Brucella neotomae 5K33] gi|256114376|ref|ZP_05455109.1| hypothetical protein Bmelb3E_16225 [Brucella melitensis bv. 3 str. Ether] gi|256160509|ref|ZP_05458198.1| hypothetical protein BcetM4_16024 [Brucella ceti M490/95/1] gi|256255715|ref|ZP_05461251.1| hypothetical protein BcetB_15853 [Brucella ceti B1/94] gi|256258220|ref|ZP_05463756.1| hypothetical protein Babob9C_12916 [Brucella abortus bv. 9 str. C68] gi|256263256|ref|ZP_05465788.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] gi|260168012|ref|ZP_05754823.1| hypothetical protein BruF5_06522 [Brucella sp. F5/99] gi|260547087|ref|ZP_05822825.1| conserved hypothetical protein [Brucella abortus NCTC 8038] gi|260565700|ref|ZP_05836183.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|260568883|ref|ZP_05839351.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|261757457|ref|ZP_06001166.1| conserved hypothetical protein [Brucella sp. F5/99] gi|17982125|gb|AAL51419.1| hypothetical cytosolic protein [Brucella melitensis bv. 1 str. 16M] gi|161336543|gb|ABX62848.1| protein of unknown function DUF1674 [Brucella canis ATCC 23365] gi|163676113|gb|ABY40223.1| Hypothetical protein, conserved [Brucella suis ATCC 23445] gi|189020461|gb|ACD73183.1| hypothetical protein BAbS19_I17010 [Brucella abortus S19] gi|225641621|gb|ACO01535.1| protein of unknown function DUF1674 [Brucella melitensis ATCC 23457] gi|260095452|gb|EEW79330.1| conserved hypothetical protein [Brucella abortus NCTC 8038] gi|260151073|gb|EEW86168.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|260154267|gb|EEW89349.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|261737441|gb|EEY25437.1| conserved hypothetical protein [Brucella sp. F5/99] gi|263093220|gb|EEZ17317.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] gi|326409815|gb|ADZ66880.1| conserved hypothetical protein [Brucella melitensis M28] gi|326539534|gb|ADZ87749.1| conserved hypothetical protein [Brucella melitensis M5-90] Length = 72 Score = 44.3 bits (103), Expect = 0.005, Method: Compositional matrix adjust. Identities = 29/52 (55%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L A+RAL+EA+ R++A KLP EIGGR G DP R+GDWE G +IDF Sbjct: 22 LPPAAQRALKEAEARRAAEKA-EKLPREIGGRGGKDPARYGDWEIKGRTIDF 72 >gi|326388833|ref|ZP_08210415.1| hypothetical protein Y88_3577 [Novosphingobium nitrogenifigens DSM 19370] gi|326206433|gb|EGD57268.1| hypothetical protein Y88_3577 [Novosphingobium nitrogenifigens DSM 19370] Length = 70 Score = 44.3 bits (103), Expect = 0.005, Method: Compositional matrix adjust. Identities = 17/19 (89%), Positives = 19/19 (100%) Query: 57 GLDPTRFGDWEKNGISIDF 75 GLDPTRFGDWE+NGI+IDF Sbjct: 52 GLDPTRFGDWERNGIAIDF 70 >gi|209883489|ref|YP_002287346.1| hypothetical protein OCAR_4334 [Oligotropha carboxidovorans OM5] gi|209871685|gb|ACI91481.1| conserved domain protein [Oligotropha carboxidovorans OM5] Length = 70 Score = 44.3 bits (103), Expect = 0.005, Method: Compositional matrix adjust. Identities = 26/69 (37%), Positives = 35/69 (50%), Gaps = 9/69 (13%) Query: 16 TIKTSHDPLSSIAKRALEEAKQR---------KSANNKDAKLPIEIGGRKGLDPTRFGDW 66 T +T D + A+R L A QR +A + P E+ G KG +PTR+GDW Sbjct: 2 TDETKPDKADAAARRPLPPAAQRALAEAEARRTAAQAQAVTAPKEVNGPKGPEPTRYGDW 61 Query: 67 EKNGISIDF 75 E GI+ DF Sbjct: 62 ENKGIASDF 70 >gi|114320487|ref|YP_742170.1| hypothetical protein Mlg_1331 [Alkalilimnicola ehrlichii MLHE-1] gi|114226881|gb|ABI56680.1| protein of unknown function DUF1674 [Alkalilimnicola ehrlichii MLHE-1] Length = 59 Score = 44.3 bits (103), Expect = 0.005, Method: Compositional matrix adjust. Identities = 18/27 (66%), Positives = 21/27 (77%) Query: 49 PIEIGGRKGLDPTRFGDWEKNGISIDF 75 P EIGG KG +PTR+GDWE+NG DF Sbjct: 33 PKEIGGPKGPEPTRYGDWERNGRCSDF 59 >gi|254719800|ref|ZP_05181611.1| hypothetical protein Bru83_09683 [Brucella sp. 83/13] gi|306839496|ref|ZP_07472304.1| cytoplasmic protein [Brucella sp. NF 2653] gi|306841591|ref|ZP_07474288.1| cytoplasmic protein [Brucella sp. BO2] gi|306844792|ref|ZP_07477377.1| cytoplasmic protein [Brucella sp. BO1] gi|306274964|gb|EFM56734.1| cytoplasmic protein [Brucella sp. BO1] gi|306288337|gb|EFM59700.1| cytoplasmic protein [Brucella sp. BO2] gi|306405441|gb|EFM61712.1| cytoplasmic protein [Brucella sp. NF 2653] Length = 72 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 29/52 (55%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L A+RAL+EA+ R++A KLP EIGGR G DP R+GDWE G +IDF Sbjct: 22 LPPAAQRALKEAEARRAAEKA-EKLPREIGGRGGKDPARYGDWEIKGRTIDF 72 >gi|320169809|gb|EFW46708.1| predicted protein [Capsaspora owczarzaki ATCC 30864] Length = 141 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 17/25 (68%), Positives = 21/25 (84%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWEKNG +IDF Sbjct: 117 ERGGPRGPEPTRYGDWEKNGRAIDF 141 >gi|315497065|ref|YP_004085869.1| hypothetical protein Astex_0014 [Asticcacaulis excentricus CB 48] gi|315415077|gb|ADU11718.1| protein of unknown function DUF1674 [Asticcacaulis excentricus CB 48] Length = 79 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 18/27 (66%), Positives = 20/27 (74%) Query: 49 PIEIGGRKGLDPTRFGDWEKNGISIDF 75 P E GG GL+PTRFGDWE+ GI DF Sbjct: 53 PFEEGGPAGLEPTRFGDWERKGIVSDF 79 >gi|195474031|ref|XP_002089295.1| GE24984 [Drosophila yakuba] gi|194175396|gb|EDW89007.1| GE24984 [Drosophila yakuba] Length = 126 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 21/54 (38%), Positives = 27/54 (50%) Query: 22 DPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 +PL A E + K N EIGG+ G +PTR+GDWE+ G DF Sbjct: 73 EPLPECAPHPAHEKEPLKPWPNNTNPYTGEIGGQAGPEPTRYGDWERKGRVTDF 126 >gi|262277841|ref|ZP_06055634.1| conserved hypothetical protein [alpha proteobacterium HIMB114] gi|262224944|gb|EEY75403.1| conserved hypothetical protein [alpha proteobacterium HIMB114] Length = 100 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 26/65 (40%), Positives = 34/65 (52%), Gaps = 3/65 (4%) Query: 14 NSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKL---PIEIGGRKGLDPTRFGDWEKNG 70 N TI P+S + +QR+S + KL E GG +G +PTR+GDWEK G Sbjct: 36 NETISKYPAPISKCDAQFNALLEQRESVTKEVTKLMQTQKEYGGPEGPEPTRYGDWEKKG 95 Query: 71 ISIDF 75 I DF Sbjct: 96 IVSDF 100 >gi|308799611|ref|XP_003074586.1| unnamed protein product [Ostreococcus tauri] gi|116000757|emb|CAL50437.1| unnamed protein product [Ostreococcus tauri] Length = 127 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 9/76 (11%) Query: 9 RGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPI---------EIGGRKGLD 59 R ++ ST+ + + ++ LE AK A N + + EIGG +GL+ Sbjct: 52 RARVDPSTLPRATNAGATHTAEELERAKAEAEARNAEKRRAFHRARGVDVDEIGGPRGLE 111 Query: 60 PTRFGDWEKNGISIDF 75 PTR+GDWE+ G DF Sbjct: 112 PTRYGDWERAGRVSDF 127 >gi|225455088|ref|XP_002264465.1| PREDICTED: hypothetical protein [Vitis vinifera] Length = 123 Score = 43.9 bits (102), Expect = 0.007, Method: Compositional matrix adjust. Identities = 17/25 (68%), Positives = 20/25 (80%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG KG +PTR+GDWE+NG DF Sbjct: 99 EIGGPKGPEPTRYGDWERNGRCSDF 123 >gi|281365006|ref|NP_652574.3| CG15283 [Drosophila melanogaster] gi|68051341|gb|AAY84934.1| IP09907p [Drosophila melanogaster] gi|272407041|gb|AAF53398.3| CG15283 [Drosophila melanogaster] Length = 126 Score = 43.9 bits (102), Expect = 0.007, Method: Compositional matrix adjust. Identities = 21/54 (38%), Positives = 27/54 (50%) Query: 22 DPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 +PL A E + K N EIGG+ G +PTR+GDWE+ G DF Sbjct: 73 EPLPECAPHPAHEKEPLKPWPNNTNPYTGEIGGQAGPEPTRYGDWERKGRVTDF 126 >gi|147807683|emb|CAN66554.1| hypothetical protein VITISV_018915 [Vitis vinifera] Length = 123 Score = 43.9 bits (102), Expect = 0.007, Method: Compositional matrix adjust. Identities = 17/25 (68%), Positives = 20/25 (80%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG KG +PTR+GDWE+NG DF Sbjct: 99 EIGGPKGPEPTRYGDWERNGRCSDF 123 >gi|302381574|ref|YP_003817397.1| hypothetical protein Bresu_0459 [Brevundimonas subvibrioides ATCC 15264] gi|302192202|gb|ADK99773.1| protein of unknown function DUF1674 [Brevundimonas subvibrioides ATCC 15264] Length = 79 Score = 43.9 bits (102), Expect = 0.008, Method: Compositional matrix adjust. Identities = 17/27 (62%), Positives = 22/27 (81%) Query: 49 PIEIGGRKGLDPTRFGDWEKNGISIDF 75 P E GG +G +PTR+GDWEK G++IDF Sbjct: 53 PEEHGGPRGPEPTRYGDWEKKGLAIDF 79 >gi|319780894|ref|YP_004140370.1| hypothetical protein Mesci_1156 [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317166782|gb|ADV10320.1| protein of unknown function DUF1674 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 73 Score = 43.9 bits (102), Expect = 0.008, Method: Compositional matrix adjust. Identities = 18/33 (54%), Positives = 23/33 (69%) Query: 43 NKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K+A P EIGGR G +P R+GDWE G++ DF Sbjct: 41 EKEASAPKEIGGRGGKEPGRYGDWEVKGLTSDF 73 >gi|167523026|ref|XP_001745850.1| hypothetical protein [Monosiga brevicollis MX1] gi|163775651|gb|EDQ89274.1| predicted protein [Monosiga brevicollis MX1] Length = 190 Score = 43.9 bits (102), Expect = 0.008, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 28/43 (65%) Query: 33 EEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 E ++ + +++N + +P E G KG +PTR+GDWE+ G DF Sbjct: 148 EASEPKPASDNSQSDMPREYNGPKGPEPTRYGDWERKGRVSDF 190 >gi|85714013|ref|ZP_01045002.1| hypothetical protein NB311A_07653 [Nitrobacter sp. Nb-311A] gi|85699139|gb|EAQ37007.1| hypothetical protein NB311A_07653 [Nitrobacter sp. Nb-311A] Length = 72 Score = 43.9 bits (102), Expect = 0.008, Method: Compositional matrix adjust. Identities = 18/27 (66%), Positives = 22/27 (81%) Query: 49 PIEIGGRKGLDPTRFGDWEKNGISIDF 75 P EI G KG +PTRFGDWE+NG++ DF Sbjct: 46 PKEILGPKGPEPTRFGDWERNGVASDF 72 >gi|296447349|ref|ZP_06889276.1| protein of unknown function DUF1674 [Methylosinus trichosporium OB3b] gi|296255128|gb|EFH02228.1| protein of unknown function DUF1674 [Methylosinus trichosporium OB3b] Length = 69 Score = 43.9 bits (102), Expect = 0.008, Method: Compositional matrix adjust. Identities = 17/24 (70%), Positives = 19/24 (79%) Query: 52 IGGRKGLDPTRFGDWEKNGISIDF 75 IGGR GLDP R+GDWE GI+ DF Sbjct: 46 IGGRGGLDPARYGDWESGGIASDF 69 >gi|86747214|ref|YP_483710.1| hypothetical protein RPB_0087 [Rhodopseudomonas palustris HaA2] gi|86570242|gb|ABD04799.1| Protein of unknown function DUF1674 [Rhodopseudomonas palustris HaA2] Length = 73 Score = 43.5 bits (101), Expect = 0.009, Method: Compositional matrix adjust. Identities = 26/53 (49%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Query: 24 LSSIAKRALEEAKQRK-SANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L AKRAL EA R+ A A E G KG +PTR+GDWE GI+ DF Sbjct: 21 LPDAAKRALAEADARRVEAAQHAAARAKEYQGPKGPEPTRYGDWEVKGIASDF 73 >gi|304392690|ref|ZP_07374630.1| hypothetical protein R2A130_2290 [Ahrensia sp. R2A130] gi|303295320|gb|EFL89680.1| hypothetical protein R2A130_2290 [Ahrensia sp. R2A130] Length = 76 Score = 43.5 bits (101), Expect = 0.010, Method: Compositional matrix adjust. Identities = 18/29 (62%), Positives = 22/29 (75%) Query: 47 KLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 +L EI GRKG +PTR+GDWE GI+ DF Sbjct: 48 ELAREIDGRKGPEPTRYGDWENKGITSDF 76 >gi|209965630|ref|YP_002298545.1| hypothetical protein RC1_2346 [Rhodospirillum centenum SW] gi|209959096|gb|ACI99732.1| conserved hypothetical protein [Rhodospirillum centenum SW] Length = 73 Score = 43.1 bits (100), Expect = 0.014, Method: Compositional matrix adjust. Identities = 18/35 (51%), Positives = 22/35 (62%) Query: 41 ANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 N + A+ P EIGG G +PTR+GDWE G DF Sbjct: 39 GNRRPAQPPGEIGGPAGPEPTRYGDWESKGRCSDF 73 >gi|254448790|ref|ZP_05062247.1| conserved hypothetical protein [gamma proteobacterium HTCC5015] gi|198261631|gb|EDY85919.1| conserved hypothetical protein [gamma proteobacterium HTCC5015] Length = 73 Score = 42.7 bits (99), Expect = 0.015, Method: Compositional matrix adjust. Identities = 18/25 (72%), Positives = 20/25 (80%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG KGL+PTR+GDWEK G IDF Sbjct: 49 EHGGPKGLEPTRYGDWEKAGRCIDF 73 >gi|15892132|ref|NP_359846.1| hypothetical protein RC0209 [Rickettsia conorii str. Malish 7] gi|81528504|sp|Q92J60|Y209_RICCN RecName: Full=UPF0369 protein RC0209 gi|15619260|gb|AAL02747.1| unknown [Rickettsia conorii str. Malish 7] Length = 93 Score = 42.7 bits (99), Expect = 0.017, Method: Compositional matrix adjust. Identities = 32/69 (46%), Positives = 37/69 (53%), Gaps = 13/69 (18%) Query: 11 LMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAK--LPIE--IGGRKGLDPTRFGDW 66 L + ST TS PL EAK K +NN K LP E IGG KGL+PTR+GDW Sbjct: 34 LEDVSTGSTSKLPL---------EAKFVKISNNISEKENLPKEKEIGGVKGLEPTRYGDW 84 Query: 67 EKNGISIDF 75 + G DF Sbjct: 85 QHKGKVTDF 93 >gi|154245750|ref|YP_001416708.1| hypothetical protein Xaut_1806 [Xanthobacter autotrophicus Py2] gi|154159835|gb|ABS67051.1| protein of unknown function DUF1674 [Xanthobacter autotrophicus Py2] Length = 65 Score = 42.7 bits (99), Expect = 0.018, Method: Compositional matrix adjust. Identities = 31/65 (47%), Positives = 40/65 (61%), Gaps = 1/65 (1%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKL-PIEIGGRKGLDPTRFGDWEKNG 70 M++ T PLS AKRAL EA+ R++A + K P EI GR G +P R+GDWE G Sbjct: 1 MSDETPAPPRKPLSEAAKRALAEAEARRAAIDAATKARPKEINGRDGPEPVRYGDWEVGG 60 Query: 71 ISIDF 75 I+ DF Sbjct: 61 IASDF 65 >gi|56118809|ref|NP_001008179.1| chromosome 6 open reading frame 57 [Xenopus (Silurana) tropicalis] gi|51950109|gb|AAH82498.1| MGC89089 protein [Xenopus (Silurana) tropicalis] gi|89267210|emb|CAJ81416.1| novel protein [Xenopus (Silurana) tropicalis] gi|89272858|emb|CAJ82144.1| novel protein [Xenopus (Silurana) tropicalis] Length = 118 Score = 42.4 bits (98), Expect = 0.019, Method: Compositional matrix adjust. Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 11/80 (13%) Query: 7 NIRGLMNNS--TIKTSHDPL--SSIAKRALEEAKQRKSANNKDAKLPIEI-------GGR 55 + R L +NS IK + PL + + ++++Q N K P +I GG Sbjct: 39 SCRALSHNSQHNIKGTKQPLKKPTTPQGKFDDSEQTTLEKNPLEKFPDDINPVTKEKGGP 98 Query: 56 KGLDPTRFGDWEKNGISIDF 75 +G +PTR+GDWE+ G IDF Sbjct: 99 RGPEPTRYGDWERKGRCIDF 118 >gi|194857068|ref|XP_001968889.1| GG24253 [Drosophila erecta] gi|190660756|gb|EDV57948.1| GG24253 [Drosophila erecta] Length = 93 Score = 42.4 bits (98), Expect = 0.019, Method: Compositional matrix adjust. Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 5/60 (8%) Query: 20 SHDPLSSIAKRALEEAKQRKS----ANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 S PL S+ + A A +++ NN + EIGG+ G +PTR+GDWE+ G DF Sbjct: 35 SEAPLESLPECAPHPAHEKEPLKPWPNNTNPYT-GEIGGQAGPEPTRYGDWERKGRVTDF 93 >gi|238651022|ref|YP_002916878.1| hypothetical protein RPR_06695 [Rickettsia peacockii str. Rustic] gi|238625120|gb|ACR47826.1| hypothetical protein RPR_06695 [Rickettsia peacockii str. Rustic] Length = 94 Score = 42.4 bits (98), Expect = 0.021, Method: Compositional matrix adjust. Identities = 25/46 (54%), Positives = 29/46 (63%), Gaps = 4/46 (8%) Query: 34 EAKQRKSANNKDAK--LPIE--IGGRKGLDPTRFGDWEKNGISIDF 75 EAK K +NN K LP E IGG KGL+PTR+GDW+ G DF Sbjct: 49 EAKFVKISNNISEKENLPKEKEIGGVKGLEPTRYGDWQHKGKVTDF 94 >gi|34580837|ref|ZP_00142317.1| hypothetical protein [Rickettsia sibirica 246] gi|229586409|ref|YP_002844910.1| hypothetical protein RAF_ORF0200 [Rickettsia africae ESF-5] gi|28262222|gb|EAA25726.1| unknown [Rickettsia sibirica 246] gi|228021459|gb|ACP53167.1| Unknown [Rickettsia africae ESF-5] Length = 93 Score = 42.4 bits (98), Expect = 0.022, Method: Compositional matrix adjust. Identities = 34/77 (44%), Positives = 41/77 (53%), Gaps = 15/77 (19%) Query: 3 TVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAK--LPIE--IGGRKGL 58 T ++IR + ST TS PL EAK K +NN K LP E IGG KGL Sbjct: 28 TAYMDIR--EDVSTGSTSKLPL---------EAKFVKISNNISEKENLPKEKEIGGVKGL 76 Query: 59 DPTRFGDWEKNGISIDF 75 +PTR+GDW+ G DF Sbjct: 77 EPTRYGDWQHKGKVTDF 93 >gi|298293741|ref|YP_003695680.1| hypothetical protein Snov_3791 [Starkeya novella DSM 506] gi|296930252|gb|ADH91061.1| protein of unknown function DUF1674 [Starkeya novella DSM 506] Length = 67 Score = 42.4 bits (98), Expect = 0.022, Method: Compositional matrix adjust. Identities = 24/65 (36%), Positives = 32/65 (49%), Gaps = 7/65 (10%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSAN-------NKDAKLPIEIGGRKGLDPTRFGDWEKNG 70 KT P + +R L A +R + A+ P EI GR G +P R+GDWE G Sbjct: 3 KTDPTPPAPAERRPLTPAAKRALEEAAARRAASTQAQAPKEIDGRNGPEPVRYGDWEVKG 62 Query: 71 ISIDF 75 I+ DF Sbjct: 63 IASDF 67 >gi|75674354|ref|YP_316775.1| hypothetical protein Nwi_0155 [Nitrobacter winogradskyi Nb-255] gi|74419224|gb|ABA03423.1| hypothetical protein Nwi_0155 [Nitrobacter winogradskyi Nb-255] Length = 88 Score = 42.4 bits (98), Expect = 0.022, Method: Compositional matrix adjust. Identities = 17/27 (62%), Positives = 21/27 (77%) Query: 49 PIEIGGRKGLDPTRFGDWEKNGISIDF 75 P EI G +G +PTRFGDWE+ GI+ DF Sbjct: 62 PKEIQGPEGPEPTRFGDWERGGIASDF 88 >gi|328766712|gb|EGF76765.1| hypothetical protein BATDEDRAFT_92333 [Batrachochytrium dendrobatidis JAM81] Length = 123 Score = 42.4 bits (98), Expect = 0.023, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 20/25 (80%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+GG KG++PTR+GDWE+ G DF Sbjct: 99 EVGGPKGVEPTRYGDWERKGRVFDF 123 >gi|299133156|ref|ZP_07026351.1| protein of unknown function DUF1674 [Afipia sp. 1NLS2] gi|298593293|gb|EFI53493.1| protein of unknown function DUF1674 [Afipia sp. 1NLS2] Length = 82 Score = 42.4 bits (98), Expect = 0.023, Method: Compositional matrix adjust. Identities = 22/46 (47%), Positives = 29/46 (63%), Gaps = 2/46 (4%) Query: 30 RALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 +A E+ K+ A+ D P EI G KG +PTR+GDWE GI+ DF Sbjct: 39 KAREKNKENDPAS--DPNDPKEINGPKGPEPTRYGDWEIKGIASDF 82 >gi|281212459|gb|EFA86619.1| hypothetical protein PPL_00420 [Polysphondylium pallidum PN500] Length = 95 Score = 42.0 bits (97), Expect = 0.027, Method: Compositional matrix adjust. Identities = 17/25 (68%), Positives = 20/25 (80%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG KG +PTRFGDWE+ G + DF Sbjct: 71 EIGGPKGPEPTRFGDWERKGRTSDF 95 >gi|296285188|ref|ZP_06863186.1| hypothetical protein CbatJ_16282 [Citromicrobium bathyomarinum JL354] Length = 68 Score = 42.0 bits (97), Expect = 0.031, Method: Compositional matrix adjust. Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 7/57 (12%) Query: 26 SIAKRALEEAKQ-RKSANNKD----AKLPIE--IGGRKGLDPTRFGDWEKNGISIDF 75 S KRA E + +K A+ KD A PI+ + KGL PTR+GDW K+GI+IDF Sbjct: 12 SHMKRATERPEDFKKPAHWKDDPAPAPEPIDASVEDPKGLSPTRYGDWVKDGIAIDF 68 >gi|332285733|ref|YP_004417644.1| hypothetical protein PT7_2480 [Pusillimonas sp. T7-7] gi|330429686|gb|AEC21020.1| hypothetical protein PT7_2480 [Pusillimonas sp. T7-7] Length = 51 Score = 41.6 bits (96), Expect = 0.035, Method: Compositional matrix adjust. Identities = 16/19 (84%), Positives = 17/19 (89%) Query: 57 GLDPTRFGDWEKNGISIDF 75 GLDPTR+GDWEKNG IDF Sbjct: 33 GLDPTRYGDWEKNGRCIDF 51 >gi|296116778|ref|ZP_06835385.1| putative cytoplasmic protein [Gluconacetobacter hansenii ATCC 23769] gi|295976700|gb|EFG83471.1| putative cytoplasmic protein [Gluconacetobacter hansenii ATCC 23769] Length = 78 Score = 41.6 bits (96), Expect = 0.038, Method: Compositional matrix adjust. Identities = 26/57 (45%), Positives = 33/57 (57%), Gaps = 5/57 (8%) Query: 19 TSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 T +PL+S ++ALEEA + A K P E GG KG +PTR+ DW G IDF Sbjct: 27 THPEPLTS--EKALEEADK---ARLKQPAEPNERGGPKGPEPTRYNDWTVKGRCIDF 78 >gi|157964234|ref|YP_001499058.1| hypothetical protein RMA_0217 [Rickettsia massiliae MTU5] gi|157844010|gb|ABV84511.1| hypothetical protein RMA_0217 [Rickettsia massiliae MTU5] Length = 106 Score = 41.6 bits (96), Expect = 0.039, Method: Compositional matrix adjust. Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 3/53 (5%) Query: 26 SIAKRALEEAKQRKSAN-NKDAKLPIE--IGGRKGLDPTRFGDWEKNGISIDF 75 S +K LE + S N +++ LP E IGG KGL+PTR+GDW+ G DF Sbjct: 54 STSKLPLEAKFVKMSINISEEENLPKEKEIGGVKGLEPTRYGDWQYKGKVTDF 106 >gi|50744814|ref|XP_419887.1| PREDICTED: hypothetical protein isoform 2 [Gallus gallus] Length = 95 Score = 41.6 bits (96), Expect = 0.039, Method: Compositional matrix adjust. Identities = 17/25 (68%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG KG +PTRFGDWE+ G IDF Sbjct: 71 ERGGPKGPEPTRFGDWERKGRCIDF 95 >gi|195034843|ref|XP_001988987.1| GH10282 [Drosophila grimshawi] gi|193904987|gb|EDW03854.1| GH10282 [Drosophila grimshawi] Length = 119 Score = 41.6 bits (96), Expect = 0.041, Method: Compositional matrix adjust. Identities = 21/58 (36%), Positives = 29/58 (50%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 KT L ++ +E + K N+ EIGG G +PTR+GDWE+ G DF Sbjct: 62 KTPLGKLDEFSRHPYQETEPLKPWPNQTNPYTGEIGGPAGPEPTRYGDWERKGRVSDF 119 >gi|165932785|ref|YP_001649574.1| hypothetical protein RrIowa_0257 [Rickettsia rickettsii str. Iowa] gi|165907872|gb|ABY72168.1| hypothetical cytosolic protein [Rickettsia rickettsii str. Iowa] Length = 64 Score = 41.6 bits (96), Expect = 0.042, Method: Compositional matrix adjust. Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 5/54 (9%) Query: 26 SIAKRALEEAKQRKSANNKDAK--LPIE--IGGRKGLDPTRFGDWEKNGISIDF 75 S++K LE K K +NN K LP E IGG KGL+PTR+GDW+ G DF Sbjct: 12 SMSKLPLE-TKFVKISNNISEKENLPKEKEIGGVKGLEPTRYGDWQHKGKVTDF 64 >gi|194759883|ref|XP_001962176.1| GF14571 [Drosophila ananassae] gi|190615873|gb|EDV31397.1| GF14571 [Drosophila ananassae] Length = 118 Score = 41.2 bits (95), Expect = 0.043, Method: Compositional matrix adjust. Identities = 21/58 (36%), Positives = 29/58 (50%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 KT L ++ +E + K N+ EIGG G +PTR+GDWE+ G DF Sbjct: 61 KTPLGKLDEFSRHPFQEKEPLKPWPNQTNPYTGEIGGPSGPEPTRYGDWERKGRVSDF 118 >gi|312072639|ref|XP_003139156.1| hypothetical protein LOAG_03571 [Loa loa] gi|307765672|gb|EFO24906.1| hypothetical protein LOAG_03571 [Loa loa] Length = 99 Score = 41.2 bits (95), Expect = 0.045, Method: Compositional matrix adjust. Identities = 17/25 (68%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG G +PTRFGDWE+ G IDF Sbjct: 75 EIGGPAGPEPTRFGDWERKGRCIDF 99 >gi|157828085|ref|YP_001494327.1| hypothetical protein A1G_01185 [Rickettsia rickettsii str. 'Sheila Smith'] gi|157800566|gb|ABV75819.1| hypothetical protein A1G_01185 [Rickettsia rickettsii str. 'Sheila Smith'] Length = 94 Score = 41.2 bits (95), Expect = 0.045, Method: Compositional matrix adjust. Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 5/54 (9%) Query: 26 SIAKRALEEAKQRKSANNKDAK--LPIE--IGGRKGLDPTRFGDWEKNGISIDF 75 S++K LE K K +NN K LP E IGG KGL+PTR+GDW+ G DF Sbjct: 42 SMSKLPLE-TKFVKISNNISEKENLPKEKEIGGVKGLEPTRYGDWQHKGKVTDF 94 >gi|158426297|ref|YP_001527589.1| hypothetical protein AZC_4673 [Azorhizobium caulinodans ORS 571] gi|158333186|dbj|BAF90671.1| protein of unknown function [Azorhizobium caulinodans ORS 571] Length = 67 Score = 41.2 bits (95), Expect = 0.046, Method: Compositional matrix adjust. Identities = 32/67 (47%), Positives = 40/67 (59%), Gaps = 3/67 (4%) Query: 12 MNNSTIKTSHDP---LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEK 68 M N T P LS A+RAL EA+ R++A + A LP EI GR G +P R+GDWE Sbjct: 1 MANDETPTPTAPRKDLSPAAQRALAEAEARRAAIDAAANLPKEINGRGGKEPVRYGDWEV 60 Query: 69 NGISIDF 75 GI+ DF Sbjct: 61 GGIASDF 67 >gi|118088802|ref|XP_001234195.1| PREDICTED: hypothetical protein isoform 1 [Gallus gallus] Length = 92 Score = 41.2 bits (95), Expect = 0.046, Method: Compositional matrix adjust. Identities = 17/25 (68%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG KG +PTRFGDWE+ G IDF Sbjct: 68 ERGGPKGPEPTRFGDWERKGRCIDF 92 >gi|163797845|ref|ZP_02191790.1| hypothetical protein BAL199_06714 [alpha proteobacterium BAL199] gi|159176889|gb|EDP61456.1| hypothetical protein BAL199_06714 [alpha proteobacterium BAL199] Length = 72 Score = 41.2 bits (95), Expect = 0.048, Method: Compositional matrix adjust. Identities = 17/28 (60%), Positives = 18/28 (64%) Query: 48 LPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LP E GG G +PTRFGDWE G DF Sbjct: 45 LPPERGGYTGPEPTRFGDWEHKGRCTDF 72 >gi|195437031|ref|XP_002066448.1| GK18895 [Drosophila willistoni] gi|194162533|gb|EDW77434.1| GK18895 [Drosophila willistoni] Length = 82 Score = 41.2 bits (95), Expect = 0.050, Method: Compositional matrix adjust. Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 5/60 (8%) Query: 20 SHDPLSSIAKRALEEAKQRKS----ANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 S PL+ + K A A +++ NN + EIGG G +PTR+GDWE+ G DF Sbjct: 24 SEAPLADLPKGAAHPAHEKEPLQPWPNNTNPYT-GEIGGPAGPEPTRYGDWERKGRVTDF 82 >gi|292571761|gb|ADE29676.1| hypothetical protein rpr22_CDS159 [Rickettsia prowazekii Rp22] Length = 96 Score = 41.2 bits (95), Expect = 0.053, Method: Compositional matrix adjust. Identities = 16/25 (64%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG KGL+PTR+GDW+ G DF Sbjct: 72 EIGGIKGLEPTRYGDWQHKGKVTDF 96 >gi|195472867|ref|XP_002088720.1| GE18724 [Drosophila yakuba] gi|33328841|gb|AAQ09827.1| CG7224 [Drosophila yakuba] gi|194174821|gb|EDW88432.1| GE18724 [Drosophila yakuba] Length = 120 Score = 41.2 bits (95), Expect = 0.054, Method: Compositional matrix adjust. Identities = 21/58 (36%), Positives = 29/58 (50%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 KT L ++ +E + K N+ EIGG G +PTR+GDWE+ G DF Sbjct: 63 KTPLGKLDEFSRHPYQEQEPLKPWPNQTNPYTGEIGGPAGPEPTRYGDWERKGRVSDF 120 >gi|195339051|ref|XP_002036135.1| GM16654 [Drosophila sechellia] gi|194130015|gb|EDW52058.1| GM16654 [Drosophila sechellia] Length = 118 Score = 40.8 bits (94), Expect = 0.057, Method: Compositional matrix adjust. Identities = 21/58 (36%), Positives = 29/58 (50%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 KT L ++ +E + K N+ EIGG G +PTR+GDWE+ G DF Sbjct: 61 KTPLGKLDEFSRHPYQEKEPLKPWPNQTNPYTGEIGGPAGPEPTRYGDWERKGRVSDF 118 >gi|20129345|ref|NP_609170.1| CG7224, isoform A [Drosophila melanogaster] gi|10728653|gb|AAF52586.2| CG7224, isoform A [Drosophila melanogaster] gi|220897847|gb|ACL81239.1| TA01803p [Drosophila melanogaster] Length = 118 Score = 40.8 bits (94), Expect = 0.057, Method: Compositional matrix adjust. Identities = 21/58 (36%), Positives = 29/58 (50%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 KT L ++ +E + K N+ EIGG G +PTR+GDWE+ G DF Sbjct: 61 KTPLGKLDEFSRHPYQEKEPLKPWPNQTNPYTGEIGGPAGPEPTRYGDWERKGRVSDF 118 >gi|195577425|ref|XP_002078571.1| GD23496 [Drosophila simulans] gi|194190580|gb|EDX04156.1| GD23496 [Drosophila simulans] Length = 118 Score = 40.8 bits (94), Expect = 0.057, Method: Compositional matrix adjust. Identities = 21/58 (36%), Positives = 29/58 (50%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 KT L ++ +E + K N+ EIGG G +PTR+GDWE+ G DF Sbjct: 61 KTPLGKLDEFSRHPYQEKEPLKPWPNQTNPYTGEIGGPAGPEPTRYGDWERKGRVSDF 118 >gi|195114196|ref|XP_002001653.1| GI15767 [Drosophila mojavensis] gi|193912228|gb|EDW11095.1| GI15767 [Drosophila mojavensis] Length = 118 Score = 40.8 bits (94), Expect = 0.057, Method: Compositional matrix adjust. Identities = 21/58 (36%), Positives = 29/58 (50%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 KT L ++ +E + K N+ EIGG G +PTR+GDWE+ G DF Sbjct: 61 KTPLGKLDEFSRHPYQEKEPLKPWPNQTNPYTGEIGGPAGPEPTRYGDWERKGRVSDF 118 >gi|242092040|ref|XP_002436510.1| hypothetical protein SORBIDRAFT_10g003950 [Sorghum bicolor] gi|241914733|gb|EER87877.1| hypothetical protein SORBIDRAFT_10g003950 [Sorghum bicolor] Length = 117 Score = 40.8 bits (94), Expect = 0.058, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +G +PTR+GDWE+ G DF Sbjct: 93 EIGGPRGPEPTRYGDWERGGRCSDF 117 >gi|195386268|ref|XP_002051826.1| GJ10242 [Drosophila virilis] gi|194148283|gb|EDW63981.1| GJ10242 [Drosophila virilis] Length = 112 Score = 40.8 bits (94), Expect = 0.059, Method: Compositional matrix adjust. Identities = 21/58 (36%), Positives = 29/58 (50%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 KT L ++ +E + K N+ EIGG G +PTR+GDWE+ G DF Sbjct: 55 KTPLGKLDEFSRHPYQEKEPLKPWPNQTNPYTGEIGGPAGPEPTRYGDWERKGRVSDF 112 >gi|194862990|ref|XP_001970222.1| GG10505 [Drosophila erecta] gi|190662089|gb|EDV59281.1| GG10505 [Drosophila erecta] Length = 118 Score = 40.8 bits (94), Expect = 0.059, Method: Compositional matrix adjust. Identities = 21/58 (36%), Positives = 29/58 (50%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 KT L ++ +E + K N+ EIGG G +PTR+GDWE+ G DF Sbjct: 61 KTPLGKLDEFSRHPYQEKEPLKPWPNQTNPYTGEIGGPAGPEPTRYGDWERKGRVSDF 118 >gi|170590169|ref|XP_001899845.1| CG7224 [Brugia malayi] gi|158592764|gb|EDP31361.1| CG7224, putative [Brugia malayi] Length = 99 Score = 40.8 bits (94), Expect = 0.060, Method: Compositional matrix adjust. Identities = 17/25 (68%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG G +PTRFGDWE+ G IDF Sbjct: 75 EIGGPAGPEPTRFGDWERKGRCIDF 99 >gi|15604042|ref|NP_220557.1| hypothetical protein RP167 [Rickettsia prowazekii str. Madrid E] gi|6226336|sp|Q9ZDZ6|Y167_RICPR RecName: Full=UPF0369 protein RP167 gi|3860733|emb|CAA14634.1| unknown [Rickettsia prowazekii] Length = 78 Score = 40.8 bits (94), Expect = 0.060, Method: Compositional matrix adjust. Identities = 16/25 (64%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG KGL+PTR+GDW+ G DF Sbjct: 54 EIGGIKGLEPTRYGDWQHKGKVTDF 78 >gi|195433617|ref|XP_002064807.1| GK15130 [Drosophila willistoni] gi|194160892|gb|EDW75793.1| GK15130 [Drosophila willistoni] Length = 117 Score = 40.8 bits (94), Expect = 0.061, Method: Compositional matrix adjust. Identities = 21/58 (36%), Positives = 29/58 (50%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 KT L ++ +E + K N+ EIGG G +PTR+GDWE+ G DF Sbjct: 60 KTPLGKLDEFSRHPYQEKEPLKPWPNQTNPYTGEIGGPSGPEPTRYGDWERKGRVSDF 117 >gi|303286952|ref|XP_003062765.1| predicted protein [Micromonas pusilla CCMP1545] gi|226455401|gb|EEH52704.1| predicted protein [Micromonas pusilla CCMP1545] Length = 214 Score = 40.8 bits (94), Expect = 0.063, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+ G +GL+PTRFGDWE+ G DF Sbjct: 190 EVNGPRGLEPTRFGDWERGGRCSDF 214 >gi|90421554|ref|YP_529924.1| hypothetical protein RPC_0026 [Rhodopseudomonas palustris BisB18] gi|90103568|gb|ABD85605.1| protein of unknown function DUF1674 [Rhodopseudomonas palustris BisB18] Length = 77 Score = 40.8 bits (94), Expect = 0.064, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+ G KG +PTR+GDWE GI+ DF Sbjct: 53 EVNGPKGPEPTRYGDWETKGIASDF 77 >gi|224048563|ref|XP_002192669.1| PREDICTED: similar to Chromosome 6 open reading frame 57 [Taeniopygia guttata] Length = 100 Score = 40.8 bits (94), Expect = 0.065, Method: Compositional matrix adjust. Identities = 16/25 (64%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTRFGDWE+ G IDF Sbjct: 76 ERGGPRGPEPTRFGDWERKGRCIDF 100 >gi|229577372|ref|NP_080779.2| hypothetical protein LOC68002 precursor [Mus musculus] gi|109820099|sp|Q8BTE0|CF057_MOUSE RecName: Full=UPF0369 protein C6orf57 homolog; Flags: Precursor gi|12835436|dbj|BAB23255.1| unnamed protein product [Mus musculus] gi|12841765|dbj|BAB25342.1| unnamed protein product [Mus musculus] gi|22137676|gb|AAH28981.1| RIKEN cDNA 1110058L19 gene [Mus musculus] Length = 104 Score = 40.8 bits (94), Expect = 0.067, Method: Compositional matrix adjust. Identities = 16/25 (64%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG KG +PTR+GDWE+ G IDF Sbjct: 80 EKGGPKGPEPTRYGDWERKGRCIDF 104 >gi|326931669|ref|XP_003211949.1| PREDICTED: hypothetical protein LOC100551388 [Meleagris gallopavo] Length = 252 Score = 40.8 bits (94), Expect = 0.067, Method: Composition-based stats. Identities = 17/25 (68%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG KG +PTRFGDWE+ G IDF Sbjct: 228 ERGGPKGPEPTRFGDWERKGRCIDF 252 >gi|195338435|ref|XP_002035830.1| GM14795 [Drosophila sechellia] gi|194129710|gb|EDW51753.1| GM14795 [Drosophila sechellia] Length = 142 Score = 40.8 bits (94), Expect = 0.068, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 25/49 (51%) Query: 22 DPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNG 70 +PL A E + K N EIGG+ G +PTR+GDWE+ G Sbjct: 38 EPLPECAPHPAHEKEPLKPWPNNTNPYTGEIGGQAGPEPTRYGDWERKG 86 >gi|26325935|dbj|BAC25055.1| unnamed protein product [Mus musculus] Length = 103 Score = 40.8 bits (94), Expect = 0.070, Method: Compositional matrix adjust. Identities = 16/25 (64%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG KG +PTR+GDWE+ G IDF Sbjct: 79 EKGGPKGPEPTRYGDWERKGRCIDF 103 >gi|195579210|ref|XP_002079455.1| GD22004 [Drosophila simulans] gi|194191464|gb|EDX05040.1| GD22004 [Drosophila simulans] Length = 142 Score = 40.8 bits (94), Expect = 0.071, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 25/49 (51%) Query: 22 DPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNG 70 +PL A E + K N EIGG+ G +PTR+GDWE+ G Sbjct: 38 EPLPECAPHPAHEKEPLKPWPNNTNPYTGEIGGQAGPEPTRYGDWERKG 86 >gi|158296673|ref|XP_317025.4| AGAP008422-PA [Anopheles gambiae str. PEST] gi|157014824|gb|EAA12431.5| AGAP008422-PA [Anopheles gambiae str. PEST] Length = 111 Score = 40.8 bits (94), Expect = 0.072, Method: Compositional matrix adjust. Identities = 16/25 (64%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG KG +PTR+GDWE+ G DF Sbjct: 87 EIGGPKGPEPTRYGDWERKGRVTDF 111 >gi|12854311|dbj|BAB29991.1| unnamed protein product [Mus musculus] Length = 104 Score = 40.8 bits (94), Expect = 0.072, Method: Compositional matrix adjust. Identities = 16/25 (64%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG KG +PTR+GDWE+ G IDF Sbjct: 80 EKGGPKGPEPTRYGDWERKGRCIDF 104 >gi|125986221|ref|XP_001356874.1| GA20193 [Drosophila pseudoobscura pseudoobscura] gi|54645200|gb|EAL33940.1| GA20193 [Drosophila pseudoobscura pseudoobscura] Length = 118 Score = 40.4 bits (93), Expect = 0.072, Method: Compositional matrix adjust. Identities = 20/58 (34%), Positives = 29/58 (50%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 KT L ++ +E + K N+ E+GG G +PTR+GDWE+ G DF Sbjct: 61 KTPLGKLDEFSRHPYQEKEPLKQWPNQTNPYTGEVGGPAGPEPTRYGDWERKGRVSDF 118 >gi|144897279|emb|CAM74143.1| hypothetical protein MGR_2987 [Magnetospirillum gryphiswaldense MSR-1] gi|144897553|emb|CAM74417.1| hypothetical protein MGR_0987 [Magnetospirillum gryphiswaldense MSR-1] Length = 48 Score = 40.4 bits (93), Expect = 0.073, Method: Compositional matrix adjust. Identities = 20/38 (52%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Query: 39 KSANNKDAKLPIE-IGGRKGLDPTRFGDWEKNGISIDF 75 + A + K P E IGG G +PTRFGDWEK G DF Sbjct: 11 EPAPTAEPKQPAEEIGGPAGPEPTRFGDWEKAGRCSDF 48 >gi|195148623|ref|XP_002015267.1| GL19610 [Drosophila persimilis] gi|194107220|gb|EDW29263.1| GL19610 [Drosophila persimilis] Length = 118 Score = 40.4 bits (93), Expect = 0.074, Method: Compositional matrix adjust. Identities = 20/58 (34%), Positives = 29/58 (50%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 KT L ++ +E + K N+ E+GG G +PTR+GDWE+ G DF Sbjct: 61 KTPLGKLDEFSRHPYQEKEPLKQWPNQTNPYTGEVGGPAGPEPTRYGDWERKGRVSDF 118 >gi|148682459|gb|EDL14406.1| RIKEN cDNA 1110058L19 [Mus musculus] Length = 104 Score = 40.4 bits (93), Expect = 0.076, Method: Compositional matrix adjust. Identities = 16/25 (64%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG KG +PTR+GDWE+ G IDF Sbjct: 80 EKGGPKGPEPTRYGDWERKGRCIDF 104 >gi|115522059|ref|YP_778970.1| hypothetical protein RPE_0029 [Rhodopseudomonas palustris BisA53] gi|115516006|gb|ABJ03990.1| protein of unknown function DUF1674 [Rhodopseudomonas palustris BisA53] Length = 82 Score = 40.4 bits (93), Expect = 0.081, Method: Compositional matrix adjust. Identities = 15/24 (62%), Positives = 20/24 (83%) Query: 52 IGGRKGLDPTRFGDWEKNGISIDF 75 + G KGL+PTR+GDWE+ GI+ DF Sbjct: 59 VDGPKGLEPTRYGDWERKGIASDF 82 >gi|157825351|ref|YP_001493071.1| ABC-type multidrug transport system, ATPase and permease components [Rickettsia akari str. Hartford] gi|157799309|gb|ABV74563.1| ABC-type multidrug transport system, ATPase and permease components [Rickettsia akari str. Hartford] Length = 86 Score = 40.4 bits (93), Expect = 0.083, Method: Compositional matrix adjust. Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 14/67 (20%) Query: 9 RGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEK 68 R + + + + P+SS A+ +AK EIGG KGL+PTR+ DW+ Sbjct: 34 RTYVREYRLNSKNSPVSSFVNDAVPKAK--------------EIGGVKGLEPTRYDDWQH 79 Query: 69 NGISIDF 75 G DF Sbjct: 80 KGKVTDF 86 >gi|301780992|ref|XP_002925913.1| PREDICTED: UPF0369 protein C6orf57-like [Ailuropoda melanoleuca] Length = 209 Score = 40.4 bits (93), Expect = 0.090, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWE+ G IDF Sbjct: 185 EKGGPRGPEPTRYGDWERKGRCIDF 209 >gi|326506524|dbj|BAJ86580.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326527587|dbj|BAK08068.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 117 Score = 40.0 bits (92), Expect = 0.095, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +G +PTR+GDWE+ G DF Sbjct: 93 EIGGPRGPEPTRYGDWERGGRCSDF 117 >gi|149898776|gb|ABR27851.1| hypothetical protein [Triatoma infestans] Length = 102 Score = 40.0 bits (92), Expect = 0.096, Method: Compositional matrix adjust. Identities = 16/25 (64%), Positives = 20/25 (80%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG KG++PTR+GDWE+ G DF Sbjct: 78 EIGGPKGVEPTRYGDWERKGRVSDF 102 >gi|304320445|ref|YP_003854088.1| hypothetical protein PB2503_04357 [Parvularcula bermudensis HTCC2503] gi|303299347|gb|ADM08946.1| hypothetical protein PB2503_04357 [Parvularcula bermudensis HTCC2503] Length = 86 Score = 40.0 bits (92), Expect = 0.11, Method: Compositional matrix adjust. Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 2/53 (3%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGR-KGLDPTRFGDWEKNGISIDF 75 LS AL EA+ R+ A ++ + E+GG + +PTR+GDWEK G +IDF Sbjct: 34 LSETEITALREARDRRDAIAREDQA-REVGGAARDTNPTRYGDWEKAGRAIDF 85 >gi|255544992|ref|XP_002513557.1| conserved hypothetical protein [Ricinus communis] gi|223547465|gb|EEF48960.1| conserved hypothetical protein [Ricinus communis] Length = 106 Score = 40.0 bits (92), Expect = 0.11, Method: Compositional matrix adjust. Identities = 17/25 (68%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG KG +PTR+GDWE NG DF Sbjct: 82 EIGGPKGPEPTRYGDWELNGRCSDF 106 >gi|115466524|ref|NP_001056861.1| Os06g0157800 [Oryza sativa Japonica Group] gi|55296597|dbj|BAD69195.1| unknown protein [Oryza sativa Japonica Group] gi|55296714|dbj|BAD69432.1| unknown protein [Oryza sativa Japonica Group] gi|113594901|dbj|BAF18775.1| Os06g0157800 [Oryza sativa Japonica Group] gi|215768294|dbj|BAH00523.1| unnamed protein product [Oryza sativa Japonica Group] gi|218197622|gb|EEC80049.1| hypothetical protein OsI_21750 [Oryza sativa Indica Group] gi|222634992|gb|EEE65124.1| hypothetical protein OsJ_20192 [Oryza sativa Japonica Group] Length = 122 Score = 40.0 bits (92), Expect = 0.11, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +G +PTR+GDWE+ G DF Sbjct: 98 EIGGPRGPEPTRYGDWERGGRCSDF 122 >gi|66816745|ref|XP_642377.1| hypothetical protein DDB_G0278459 [Dictyostelium discoideum AX4] gi|74856601|sp|Q54Y25|U369_DICDI RecName: Full=UPF0369 protein gi|60470422|gb|EAL68402.1| hypothetical protein DDB_G0278459 [Dictyostelium discoideum AX4] Length = 108 Score = 40.0 bits (92), Expect = 0.11, Method: Compositional matrix adjust. Identities = 16/25 (64%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG KG +PTR+ DWE+NG DF Sbjct: 84 EIGGPKGPEPTRYNDWERNGRVSDF 108 >gi|72016290|ref|XP_782052.1| PREDICTED: similar to MGC89089 protein [Strongylocentrotus purpuratus] gi|115976620|ref|XP_001178432.1| PREDICTED: similar to MGC89089 protein [Strongylocentrotus purpuratus] Length = 125 Score = 40.0 bits (92), Expect = 0.12, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWE+ G IDF Sbjct: 101 EKGGPRGPEPTRYGDWERKGRCIDF 125 >gi|73973683|ref|XP_853554.1| PREDICTED: similar to CG7224-PA [Canis familiaris] Length = 107 Score = 40.0 bits (92), Expect = 0.12, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWE+ G IDF Sbjct: 83 EKGGPRGPEPTRYGDWERKGRCIDF 107 >gi|217977605|ref|YP_002361752.1| protein of unknown function DUF1674 [Methylocella silvestris BL2] gi|217502981|gb|ACK50390.1| protein of unknown function DUF1674 [Methylocella silvestris BL2] Length = 98 Score = 39.7 bits (91), Expect = 0.12, Method: Compositional matrix adjust. Identities = 16/27 (59%), Positives = 19/27 (70%) Query: 49 PIEIGGRKGLDPTRFGDWEKNGISIDF 75 P EI GR G +P R+GDWE GI+ DF Sbjct: 72 PKEINGRDGPEPARYGDWEVKGIASDF 98 >gi|302564657|ref|NP_001181325.1| chromosome 6 open reading frame 57 [Macaca mulatta] Length = 108 Score = 39.7 bits (91), Expect = 0.13, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWE+ G IDF Sbjct: 84 EKGGPRGPEPTRYGDWERKGRCIDF 108 >gi|153870732|ref|ZP_02000071.1| shikimate 5-dehydrogenase [Beggiatoa sp. PS] gi|152072801|gb|EDN69928.1| shikimate 5-dehydrogenase [Beggiatoa sp. PS] Length = 328 Score = 39.7 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 16/26 (61%), Positives = 20/26 (76%) Query: 50 IEIGGRKGLDPTRFGDWEKNGISIDF 75 IEIGG +G + TR+GDWE+ G IDF Sbjct: 303 IEIGGPQGQEHTRYGDWERKGRCIDF 328 >gi|126310363|ref|XP_001373171.1| PREDICTED: hypothetical protein [Monodelphis domestica] Length = 96 Score = 39.7 bits (91), Expect = 0.14, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG KG +PTR+GDWE+ G +DF Sbjct: 72 EKGGPKGPEPTRYGDWERKGRCVDF 96 >gi|328865582|gb|EGG13968.1| hypothetical protein DFA_11729 [Dictyostelium fasciculatum] Length = 108 Score = 39.7 bits (91), Expect = 0.14, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 20/25 (80%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +G +PTR+GDWE+ G + DF Sbjct: 84 EIGGVRGPEPTRYGDWERKGRTSDF 108 >gi|281344880|gb|EFB20464.1| hypothetical protein PANDA_015493 [Ailuropoda melanoleuca] Length = 85 Score = 39.7 bits (91), Expect = 0.14, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWE+ G IDF Sbjct: 61 EKGGPRGPEPTRYGDWERKGRCIDF 85 >gi|189237031|ref|XP_001809515.1| PREDICTED: similar to CG7224 CG7224-PA [Tribolium castaneum] gi|270007378|gb|EFA03826.1| hypothetical protein TcasGA2_TC013941 [Tribolium castaneum] Length = 106 Score = 39.7 bits (91), Expect = 0.14, Method: Compositional matrix adjust. Identities = 14/25 (56%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+GG +G +PTR+GDWE+ G DF Sbjct: 82 EVGGPRGPEPTRYGDWERKGRVTDF 106 >gi|239948516|ref|ZP_04700269.1| ABC-type multidrug transport system, ATPase and permease component [Rickettsia endosymbiont of Ixodes scapularis] gi|239922792|gb|EER22816.1| ABC-type multidrug transport system, ATPase and permease component [Rickettsia endosymbiont of Ixodes scapularis] Length = 30 Score = 39.7 bits (91), Expect = 0.14, Method: Compositional matrix adjust. Identities = 16/25 (64%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG KGL+PTR+GDW+ G DF Sbjct: 6 EIGGVKGLEPTRYGDWQHKGKVTDF 30 >gi|242092042|ref|XP_002436511.1| hypothetical protein SORBIDRAFT_10g003960 [Sorghum bicolor] gi|241914734|gb|EER87878.1| hypothetical protein SORBIDRAFT_10g003960 [Sorghum bicolor] Length = 117 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 5/53 (9%) Query: 28 AKRALEEAKQRKSANNKDAKLPI-----EIGGRKGLDPTRFGDWEKNGISIDF 75 AK A +A+ K + D + + EIGG +G +PTR+GDWE+ G DF Sbjct: 65 AKGADVDAEAGKEEDEDDGGVHVNKATGEIGGPRGPEPTRYGDWERGGRCSDF 117 >gi|195050309|ref|XP_001992866.1| GH13408 [Drosophila grimshawi] gi|193899925|gb|EDV98791.1| GH13408 [Drosophila grimshawi] Length = 119 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +GL+PTR+GDW+ G DF Sbjct: 95 EIGGPRGLEPTRYGDWQTKGRVTDF 119 >gi|148251939|ref|YP_001236524.1| hypothetical protein BBta_0326 [Bradyrhizobium sp. BTAi1] gi|146404112|gb|ABQ32618.1| hypothetical protein BBta_0326 [Bradyrhizobium sp. BTAi1] Length = 76 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 16/27 (59%), Positives = 19/27 (70%) Query: 49 PIEIGGRKGLDPTRFGDWEKNGISIDF 75 P E+ G KG +PTR+GDWE GI DF Sbjct: 50 PKELQGPKGPEPTRYGDWENKGIISDF 76 >gi|332243970|ref|XP_003271143.1| PREDICTED: UPF0369 protein C6orf57-like [Nomascus leucogenys] Length = 108 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWE+ G IDF Sbjct: 84 EKGGPRGPEPTRYGDWERKGRCIDF 108 >gi|46275839|ref|NP_660310.2| hypothetical protein LOC135154 precursor [Homo sapiens] gi|114608101|ref|XP_527430.2| PREDICTED: UPF0369 protein C6orf57-like [Pan troglodytes] gi|74747126|sp|Q5VUM1|CF057_HUMAN RecName: Full=UPF0369 protein C6orf57; Flags: Precursor gi|55664968|emb|CAH70444.1| chromosome 6 open reading frame 57 [Homo sapiens] gi|75775194|gb|AAI04650.1| Chromosome 6 open reading frame 57 [Homo sapiens] gi|119569195|gb|EAW48810.1| chromosome 6 open reading frame 57, isoform CRA_a [Homo sapiens] gi|119569197|gb|EAW48812.1| chromosome 6 open reading frame 57, isoform CRA_a [Homo sapiens] gi|254071337|gb|ACT64428.1| chromosome 6 open reading frame 57 protein [synthetic construct] gi|254071339|gb|ACT64429.1| chromosome 6 open reading frame 57 protein [synthetic construct] Length = 108 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWE+ G IDF Sbjct: 84 EKGGPRGPEPTRYGDWERKGRCIDF 108 >gi|195397945|ref|XP_002057588.1| GJ18212 [Drosophila virilis] gi|194141242|gb|EDW57661.1| GJ18212 [Drosophila virilis] Length = 110 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +G +PTR+GDWE G DF Sbjct: 86 EIGGPRGPEPTRYGDWESKGRVTDF 110 >gi|17390188|gb|AAH18085.1| Chromosome 6 open reading frame 57 [Homo sapiens] Length = 108 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWE+ G IDF Sbjct: 84 EKGGPRGPEPTRYGDWERKGRCIDF 108 >gi|312153304|gb|ADQ33164.1| chromosome 6 open reading frame 57 [synthetic construct] Length = 108 Score = 39.7 bits (91), Expect = 0.16, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWE+ G IDF Sbjct: 84 EKGGPRGPEPTRYGDWERKGRCIDF 108 >gi|226503875|ref|NP_001143165.1| human viral protein homolog1 [Zea mays] gi|195615278|gb|ACG29469.1| hypothetical protein [Zea mays] Length = 117 Score = 39.7 bits (91), Expect = 0.16, Method: Compositional matrix adjust. Identities = 14/25 (56%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+GG +G +PTR+GDWE+ G DF Sbjct: 93 EVGGPRGPEPTRYGDWERAGRCSDF 117 >gi|149069177|gb|EDM18618.1| rCG43539, isoform CRA_a [Rattus norvegicus] Length = 104 Score = 39.3 bits (90), Expect = 0.16, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWE+ G IDF Sbjct: 80 EKGGPRGPEPTRYGDWERKGRCIDF 104 >gi|307180266|gb|EFN68299.1| UPF0369 protein C6orf57-like protein [Camponotus floridanus] Length = 106 Score = 39.3 bits (90), Expect = 0.16, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +G +PTR+GDWE+ G DF Sbjct: 82 EIGGPRGPEPTRYGDWERKGRVTDF 106 >gi|291396453|ref|XP_002714458.1| PREDICTED: Chromosome 6 open reading frame 57-like [Oryctolagus cuniculus] Length = 119 Score = 39.3 bits (90), Expect = 0.17, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWE+ G IDF Sbjct: 95 EKGGPRGPEPTRYGDWERKGRCIDF 119 >gi|71834512|ref|NP_001025355.1| hypothetical protein LOC563956 [Danio rerio] gi|37606032|emb|CAE50906.1| novel protein [Danio rerio] Length = 107 Score = 39.3 bits (90), Expect = 0.18, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWE+ G IDF Sbjct: 83 EKGGPRGPEPTRYGDWERKGRCIDF 107 >gi|322790185|gb|EFZ15184.1| hypothetical protein SINV_01384 [Solenopsis invicta] Length = 110 Score = 39.3 bits (90), Expect = 0.18, Method: Compositional matrix adjust. Identities = 14/25 (56%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+GG +G +PTR+GDWE+ G DF Sbjct: 86 EVGGPRGPEPTRYGDWERKGRVTDF 110 >gi|328793682|ref|XP_001121933.2| PREDICTED: UPF0369 protein C6orf57 homolog [Apis mellifera] Length = 70 Score = 39.3 bits (90), Expect = 0.19, Method: Compositional matrix adjust. Identities = 18/35 (51%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Query: 41 ANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 NN + K EIGG +G +PTR+GDWE+ G DF Sbjct: 37 PNNTNPKT-GEIGGPRGPEPTRYGDWERKGRVTDF 70 >gi|198476520|ref|XP_001357378.2| GA13625 [Drosophila pseudoobscura pseudoobscura] gi|198137734|gb|EAL34447.2| GA13625 [Drosophila pseudoobscura pseudoobscura] Length = 225 Score = 39.3 bits (90), Expect = 0.19, Method: Compositional matrix adjust. Identities = 14/25 (56%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+GG G +PTR+GDWE+ G DF Sbjct: 201 EVGGPAGPEPTRYGDWERKGRVTDF 225 >gi|307207940|gb|EFN85499.1| UPF0369 protein C6orf57-like protein [Harpegnathos saltator] Length = 114 Score = 39.3 bits (90), Expect = 0.20, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +G +PTR+GDWE+ G DF Sbjct: 90 EIGGPRGPEPTRYGDWERKGRVTDF 114 >gi|297794225|ref|XP_002864997.1| hypothetical protein ARALYDRAFT_919953 [Arabidopsis lyrata subsp. lyrata] gi|297310832|gb|EFH41256.1| hypothetical protein ARALYDRAFT_919953 [Arabidopsis lyrata subsp. lyrata] Length = 108 Score = 39.3 bits (90), Expect = 0.20, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +G +PTR+GDWE+ G DF Sbjct: 84 EIGGPRGPEPTRYGDWEQRGRCSDF 108 >gi|194758559|ref|XP_001961529.1| GF15011 [Drosophila ananassae] gi|190615226|gb|EDV30750.1| GF15011 [Drosophila ananassae] Length = 127 Score = 39.3 bits (90), Expect = 0.20, Method: Compositional matrix adjust. Identities = 14/25 (56%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+GG G +PTR+GDWE+ G DF Sbjct: 103 EVGGPAGPEPTRYGDWERKGRVTDF 127 >gi|122891180|emb|CAM12934.1| novel protein [Danio rerio] Length = 107 Score = 39.3 bits (90), Expect = 0.20, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWE+ G IDF Sbjct: 83 EKGGPRGPEPTRYGDWERKGRCIDF 107 >gi|157135180|ref|XP_001656560.1| hypothetical protein AaeL_AAEL013256 [Aedes aegypti] gi|108870290|gb|EAT34515.1| conserved hypothetical protein [Aedes aegypti] Length = 111 Score = 39.3 bits (90), Expect = 0.20, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +G +PTR+GDWE+ G DF Sbjct: 87 EIGGPRGPEPTRYGDWERKGRVSDF 111 >gi|67459504|ref|YP_247128.1| hypothetical protein RF_1112 [Rickettsia felis URRWXCal2] gi|75536089|sp|Q4UKG8|Y1112_RICFE RecName: Full=UPF0369 protein RF_1112 gi|67005037|gb|AAY61963.1| unknown [Rickettsia felis URRWXCal2] Length = 78 Score = 38.9 bits (89), Expect = 0.22, Method: Compositional matrix adjust. Identities = 15/24 (62%), Positives = 18/24 (75%) Query: 52 IGGRKGLDPTRFGDWEKNGISIDF 75 IGG KGL+PTR+GDW+ G DF Sbjct: 55 IGGVKGLEPTRYGDWQHKGKVTDF 78 >gi|195155787|ref|XP_002018782.1| GL25766 [Drosophila persimilis] gi|194114935|gb|EDW36978.1| GL25766 [Drosophila persimilis] Length = 195 Score = 38.9 bits (89), Expect = 0.23, Method: Compositional matrix adjust. Identities = 14/25 (56%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+GG G +PTR+GDWE+ G DF Sbjct: 171 EVGGPAGPEPTRYGDWERKGRVTDF 195 >gi|37606067|emb|CAE49440.1| novel protein [Danio rerio] Length = 83 Score = 38.9 bits (89), Expect = 0.24, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWE+ G IDF Sbjct: 59 EKGGPRGPEPTRYGDWERKGRCIDF 83 >gi|149069179|gb|EDM18620.1| rCG43539, isoform CRA_c [Rattus norvegicus] Length = 121 Score = 38.9 bits (89), Expect = 0.25, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWE+ G IDF Sbjct: 97 EKGGPRGPEPTRYGDWERKGRCIDF 121 >gi|313236855|emb|CBY12106.1| unnamed protein product [Oikopleura dioica] Length = 97 Score = 38.9 bits (89), Expect = 0.26, Method: Compositional matrix adjust. Identities = 23/55 (41%), Positives = 30/55 (54%), Gaps = 5/55 (9%) Query: 23 PLSSIAKRALEEAKQRKSAN--NKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 P S K +EEA +K N D+ E GG G++PTR+GDWE+ G DF Sbjct: 46 PASKKGKLYMEEAPIQKHPGGINPDSG---ERGGPGGVEPTRYGDWERKGRVTDF 97 >gi|312374460|gb|EFR22011.1| hypothetical protein AND_15877 [Anopheles darlingi] Length = 276 Score = 38.9 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 27/49 (55%) Query: 27 IAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + K +E + ++ N EIGG +G +PTR+GDWE+ G DF Sbjct: 228 VGKHPYQEKEPLQAWPNNTNPNTGEIGGPRGPEPTRYGDWERKGRVTDF 276 >gi|149186385|ref|ZP_01864698.1| hypothetical protein ED21_22888 [Erythrobacter sp. SD-21] gi|148829974|gb|EDL48412.1| hypothetical protein ED21_22888 [Erythrobacter sp. SD-21] Length = 60 Score = 38.9 bits (89), Expect = 0.27, Method: Compositional matrix adjust. Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 3/59 (5%) Query: 20 SHDPLSSIAKRAL---EEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 +H S AKRA E ++ + +++ P ++ + L PTR+GDW K+GI+IDF Sbjct: 2 THSTRSGQAKRATKRPETFEKPEHWSSEPPPKPQKVDNEEDLSPTRYGDWVKDGIAIDF 60 >gi|296198537|ref|XP_002746747.1| PREDICTED: UPF0369 protein C6orf57-like [Callithrix jacchus] Length = 101 Score = 38.9 bits (89), Expect = 0.27, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWE+ G IDF Sbjct: 77 EKGGPRGPEPTRYGDWERKGRCIDF 101 >gi|47192873|emb|CAG13725.1| unnamed protein product [Tetraodon nigroviridis] Length = 101 Score = 38.9 bits (89), Expect = 0.27, Method: Compositional matrix adjust. Identities = 14/25 (56%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWE+ G +DF Sbjct: 77 EKGGPRGPEPTRYGDWERKGRCVDF 101 >gi|170037305|ref|XP_001846499.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167880408|gb|EDS43791.1| conserved hypothetical protein [Culex quinquefasciatus] Length = 112 Score = 38.5 bits (88), Expect = 0.28, Method: Compositional matrix adjust. Identities = 14/25 (56%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+GG +G +PTR+GDWE+ G DF Sbjct: 88 EVGGPRGPEPTRYGDWERKGRVSDF 112 >gi|289740649|gb|ADD19072.1| uncharacterized conserved protein [Glossina morsitans morsitans] Length = 110 Score = 38.5 bits (88), Expect = 0.30, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG G +PTR+GDWE+ G DF Sbjct: 86 EIGGPSGPEPTRYGDWERKGRVSDF 110 >gi|195116789|ref|XP_002002934.1| GI17647 [Drosophila mojavensis] gi|193913509|gb|EDW12376.1| GI17647 [Drosophila mojavensis] Length = 118 Score = 38.5 bits (88), Expect = 0.30, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 17/25 (68%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG G +PTR+GDWE G DF Sbjct: 94 EIGGPPGPEPTRYGDWESKGRVTDF 118 >gi|159487193|ref|XP_001701618.1| predicted protein [Chlamydomonas reinhardtii] gi|158280837|gb|EDP06593.1| predicted protein [Chlamydomonas reinhardtii] Length = 151 Score = 38.5 bits (88), Expect = 0.31, Method: Compositional matrix adjust. Identities = 14/25 (56%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+ G +G +PTR+GDWE G IDF Sbjct: 127 ELYGPRGREPTRYGDWENKGKCIDF 151 >gi|154251781|ref|YP_001412605.1| hypothetical protein Plav_1328 [Parvibaculum lavamentivorans DS-1] gi|154155731|gb|ABS62948.1| protein of unknown function DUF1674 [Parvibaculum lavamentivorans DS-1] Length = 70 Score = 38.5 bits (88), Expect = 0.32, Method: Compositional matrix adjust. Identities = 16/25 (64%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EI GR G +PTR+GDWE GI+ DF Sbjct: 46 EIAGRGGNEPTRYGDWEVKGITSDF 70 >gi|27754403|gb|AAO22650.1| unknown protein [Arabidopsis thaliana] Length = 108 Score = 38.5 bits (88), Expect = 0.32, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +G +PTR+GDWE+ G DF Sbjct: 84 EIGGPRGPEPTRYGDWEQRGRCSDF 108 >gi|18425195|ref|NP_569049.1| unknown protein [Arabidopsis thaliana] gi|21554347|gb|AAM63454.1| unknown [Arabidopsis thaliana] gi|56236114|gb|AAV84513.1| At5g67490 [Arabidopsis thaliana] gi|56381905|gb|AAV85671.1| At5g67490 [Arabidopsis thaliana] gi|114050697|gb|ABI49498.1| At5g67490 [Arabidopsis thaliana] gi|332010968|gb|AED98351.1| uncharacterized protein [Arabidopsis thaliana] Length = 108 Score = 38.5 bits (88), Expect = 0.33, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +G +PTR+GDWE+ G DF Sbjct: 84 EIGGPRGPEPTRYGDWEQRGRCSDF 108 >gi|168060970|ref|XP_001782465.1| predicted protein [Physcomitrella patens subsp. patens] gi|162666075|gb|EDQ52740.1| predicted protein [Physcomitrella patens subsp. patens] Length = 52 Score = 38.1 bits (87), Expect = 0.37, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+GG G +PTR+GDWEK G DF Sbjct: 28 EVGGPHGPEPTRYGDWEKGGRCYDF 52 >gi|149632421|ref|XP_001510539.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus] Length = 278 Score = 38.1 bits (87), Expect = 0.37, Method: Composition-based stats. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG KG +PTR+GDWE+ G +DF Sbjct: 254 EKGGPKGPEPTRYGDWERKGRCVDF 278 >gi|309364568|emb|CAP24841.2| hypothetical protein CBG_04049 [Caenorhabditis briggsae AF16] Length = 89 Score = 38.1 bits (87), Expect = 0.39, Method: Compositional matrix adjust. Identities = 14/25 (56%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+GG G +PTR+GDWE+ G DF Sbjct: 65 EVGGPAGPEPTRYGDWERKGRVTDF 89 >gi|116788769|gb|ABK24993.1| unknown [Picea sitchensis] Length = 129 Score = 37.7 bits (86), Expect = 0.47, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWEK G DF Sbjct: 105 ERGGPRGPEPTRYGDWEKGGRCSDF 129 >gi|332018146|gb|EGI58755.1| UPF0369 protein C6orf57-like protein [Acromyrmex echinatior] Length = 94 Score = 37.7 bits (86), Expect = 0.48, Method: Compositional matrix adjust. Identities = 14/25 (56%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+GG +G +PTR+GDWE+ G DF Sbjct: 70 EVGGPRGPEPTRYGDWERKGRVSDF 94 >gi|326432991|gb|EGD78561.1| hypothetical protein PTSG_09255 [Salpingoeca sp. ATCC 50818] Length = 114 Score = 37.7 bits (86), Expect = 0.53, Method: Compositional matrix adjust. Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 10/45 (22%) Query: 41 ANNKDAKLPI----------EIGGRKGLDPTRFGDWEKNGISIDF 75 +NK AK P E GG KG +PTR+GDWE+ G DF Sbjct: 70 GDNKKAKAPSPHEVLKQKEGEQGGPKGPEPTRYGDWERKGRVSDF 114 >gi|198431213|ref|XP_002126719.1| PREDICTED: similar to MGC89089 protein [Ciona intestinalis] Length = 113 Score = 37.7 bits (86), Expect = 0.54, Method: Compositional matrix adjust. Identities = 14/25 (56%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EI G +G +PTR+GDWE+ G DF Sbjct: 89 EINGPRGPEPTRYGDWERKGRVTDF 113 >gi|268565469|ref|XP_002639454.1| Hypothetical protein CBG04049 [Caenorhabditis briggsae] Length = 60 Score = 37.7 bits (86), Expect = 0.55, Method: Compositional matrix adjust. Identities = 23/64 (35%), Positives = 31/64 (48%), Gaps = 4/64 (6%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 M N T K S D + + + K+ NK E+GG G +PTR+GDWE+ G Sbjct: 1 MANKTPKGSLD-KTDVPQYEDPHLKKHPGGVNKKTG---EVGGPAGPEPTRYGDWERKGR 56 Query: 72 SIDF 75 DF Sbjct: 57 VTDF 60 >gi|296533926|ref|ZP_06896450.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957] gi|296265743|gb|EFH11844.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957] Length = 63 Score = 37.7 bits (86), Expect = 0.57, Method: Compositional matrix adjust. Identities = 16/25 (64%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG G +PTRFGDWE+ G DF Sbjct: 39 EIGGPAGPEPTRFGDWERKGRVSDF 63 >gi|25151100|ref|NP_740875.1| hypothetical protein W02D3.12 [Caenorhabditis elegans] gi|21328382|gb|AAM48550.1|AF003141_5 Hypothetical protein W02D3.12 [Caenorhabditis elegans] Length = 89 Score = 37.4 bits (85), Expect = 0.64, Method: Compositional matrix adjust. Identities = 14/25 (56%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+GG G +PTR+GDWE+ G DF Sbjct: 65 EVGGPAGPEPTRYGDWERKGRVSDF 89 >gi|308498531|ref|XP_003111452.1| hypothetical protein CRE_03974 [Caenorhabditis remanei] gi|308241000|gb|EFO84952.1| hypothetical protein CRE_03974 [Caenorhabditis remanei] Length = 89 Score = 37.4 bits (85), Expect = 0.72, Method: Compositional matrix adjust. Identities = 14/25 (56%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+GG G +PTR+GDWE+ G DF Sbjct: 65 EVGGPAGPEPTRYGDWERKGRVTDF 89 >gi|256081856|ref|XP_002577183.1| hypothetical protein [Schistosoma mansoni] gi|238662480|emb|CAZ33420.1| conserved hypothetical protein [Schistosoma mansoni] Length = 104 Score = 37.4 bits (85), Expect = 0.78, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG G +PTR+GDWE+ G IDF Sbjct: 80 ERGGPCGPEPTRYGDWERKGRCIDF 104 >gi|307102856|gb|EFN51122.1| hypothetical protein CHLNCDRAFT_141306 [Chlorella variabilis] Length = 740 Score = 37.0 bits (84), Expect = 0.91, Method: Composition-based stats. Identities = 22/53 (41%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Query: 23 PLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 P SS + A +EA A LP +IGG G +PTR+ DWE G DF Sbjct: 690 PASSADQPAGDEAPS--PAQELPLDLPRKIGGYAGPEPTRYQDWEIKGRCSDF 740 >gi|91975196|ref|YP_567855.1| hypothetical protein RPD_0716 [Rhodopseudomonas palustris BisB5] gi|91681652|gb|ABE37954.1| protein of unknown function DUF1674 [Rhodopseudomonas palustris BisB5] Length = 73 Score = 37.0 bits (84), Expect = 0.93, Method: Compositional matrix adjust. Identities = 14/22 (63%), Positives = 17/22 (77%) Query: 54 GRKGLDPTRFGDWEKNGISIDF 75 G KG +PTR+GDWE GI+ DF Sbjct: 52 GPKGPEPTRYGDWEVKGIASDF 73 >gi|196002241|ref|XP_002110988.1| hypothetical protein TRIADDRAFT_22086 [Trichoplax adhaerens] gi|190586939|gb|EDV26992.1| hypothetical protein TRIADDRAFT_22086 [Trichoplax adhaerens] Length = 63 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 15/25 (60%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EI G +G +PTRFGDWE+ G DF Sbjct: 39 EINGPRGPEPTRFGDWERGGRVSDF 63 >gi|85710226|ref|ZP_01041291.1| hypothetical protein NAP1_15113 [Erythrobacter sp. NAP1] gi|85688936|gb|EAQ28940.1| hypothetical protein NAP1_15113 [Erythrobacter sp. NAP1] Length = 66 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 13/18 (72%), Positives = 16/18 (88%) Query: 58 LDPTRFGDWEKNGISIDF 75 + PTR+GDWEKNGI+ DF Sbjct: 49 ISPTRYGDWEKNGIAWDF 66 >gi|85375087|ref|YP_459149.1| hypothetical protein ELI_11300 [Erythrobacter litoralis HTCC2594] gi|84788170|gb|ABC64352.1| hypothetical protein ELI_11300 [Erythrobacter litoralis HTCC2594] Length = 55 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 13/19 (68%), Positives = 17/19 (89%) Query: 57 GLDPTRFGDWEKNGISIDF 75 GL PTR+GDW K+G++IDF Sbjct: 37 GLSPTRYGDWVKDGVAIDF 55 >gi|220925066|ref|YP_002500368.1| hypothetical protein Mnod_5219 [Methylobacterium nodulans ORS 2060] gi|219949673|gb|ACL60065.1| protein of unknown function DUF1674 [Methylobacterium nodulans ORS 2060] Length = 68 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 3/56 (5%) Query: 23 PLSSIAKRALEEAKQRKSANNKDAKLPIEIG---GRKGLDPTRFGDWEKNGISIDF 75 PLS A+RAL EA+ R++A + A GR GL+P R+ DWE G++ DF Sbjct: 13 PLSPAAERALAEAQARRAAIDARAAEIRRAREIDGRGGLEPVRYDDWEVKGLATDF 68 >gi|9757870|dbj|BAB08457.1| unnamed protein product [Arabidopsis thaliana] Length = 226 Score = 35.8 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 14/25 (56%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +G +PTR+GDWE+ S F Sbjct: 84 EIGGPRGPEPTRYGDWEQRACSYIF 108 >gi|156550516|ref|XP_001602183.1| PREDICTED: similar to conserved hypothetical protein [Nasonia vitripennis] Length = 96 Score = 35.8 bits (81), Expect = 2.3, Method: Compositional matrix adjust. Identities = 14/25 (56%), Positives = 17/25 (68%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E G KG +PTR+GDWE+ G DF Sbjct: 72 ESNGPKGPEPTRYGDWERKGRVTDF 96 >gi|170747458|ref|YP_001753718.1| hypothetical protein Mrad2831_1026 [Methylobacterium radiotolerans JCM 2831] gi|170653980|gb|ACB23035.1| protein of unknown function DUF1674 [Methylobacterium radiotolerans JCM 2831] Length = 92 Score = 35.8 bits (81), Expect = 2.3, Method: Compositional matrix adjust. Identities = 12/22 (54%), Positives = 17/22 (77%) Query: 54 GRKGLDPTRFGDWEKNGISIDF 75 GR GL+P R+ DWE G+++DF Sbjct: 71 GRGGLEPVRYDDWEVKGLAVDF 92 >gi|154332320|ref|XP_001562534.1| hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904] gi|134059424|emb|CAM41650.1| conserved hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904] Length = 107 Score = 35.4 bits (80), Expect = 2.5, Method: Compositional matrix adjust. Identities = 14/22 (63%), Positives = 15/22 (68%) Query: 54 GRKGLDPTRFGDWEKNGISIDF 75 G LDPTR+GDWE NG DF Sbjct: 86 GSTQLDPTRYGDWEVNGRCYDF 107 >gi|162149216|ref|YP_001603677.1| hypothetical protein GDI_3446 [Gluconacetobacter diazotrophicus PAl 5] gi|209545044|ref|YP_002277273.1| hypothetical protein Gdia_2927 [Gluconacetobacter diazotrophicus PAl 5] gi|161787793|emb|CAP57389.1| hypothetical protein GDI3446 [Gluconacetobacter diazotrophicus PAl 5] gi|209532721|gb|ACI52658.1| protein of unknown function DUF1674 [Gluconacetobacter diazotrophicus PAl 5] Length = 52 Score = 35.4 bits (80), Expect = 2.7, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 21/43 (48%) Query: 33 EEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 E + + N + P E GG K PTR+GDW G IDF Sbjct: 10 EPSVTQPQGNAEKPAEPHEYGGPKEQRPTRYGDWTVKGRCIDF 52 >gi|255084125|ref|XP_002508637.1| predicted protein [Micromonas sp. RCC299] gi|226523914|gb|ACO69895.1| predicted protein [Micromonas sp. RCC299] Length = 164 Score = 35.4 bits (80), Expect = 2.7, Method: Compositional matrix adjust. Identities = 14/25 (56%), Positives = 17/25 (68%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E G +G +PTRFGDWE+ G DF Sbjct: 140 EWNGPRGPEPTRFGDWERAGRCSDF 164 >gi|242010996|ref|XP_002426243.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212510306|gb|EEB13505.1| conserved hypothetical protein [Pediculus humanus corporis] Length = 106 Score = 35.4 bits (80), Expect = 3.0, Method: Compositional matrix adjust. Identities = 18/48 (37%), Positives = 25/48 (52%) Query: 28 AKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K +E + K N + E G KG++PTR+GDWE+ G DF Sbjct: 59 GKHPYQEKEPLKPFPNGINPVTGERNGPKGVEPTRYGDWERKGRVSDF 106 >gi|302897411|ref|XP_003047584.1| hypothetical protein NECHADRAFT_85892 [Nectria haematococca mpVI 77-13-4] gi|256728515|gb|EEU41871.1| hypothetical protein NECHADRAFT_85892 [Nectria haematococca mpVI 77-13-4] Length = 1097 Score = 35.0 bits (79), Expect = 3.1, Method: Composition-based stats. Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Query: 30 RALEEAKQRKSANNKDAKLPIEIGGRKGLDPTR-FGDWEKNGISI 73 R L++A + ++ DA+L +++ R+G P R F DWE G+ + Sbjct: 271 RLLDQADEIRATLRNDARLRVDVDAREGYTPARKFNDWELKGVPL 315 >gi|294010234|ref|YP_003543694.1| hypothetical protein SJA_C1-02480 [Sphingobium japonicum UT26S] gi|292673564|dbj|BAI95082.1| conserved hypothetical protein [Sphingobium japonicum UT26S] Length = 57 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 12/18 (66%), Positives = 15/18 (83%) Query: 58 LDPTRFGDWEKNGISIDF 75 L P R+GDWE+ GI+IDF Sbjct: 40 LSPVRYGDWERKGIAIDF 57 >gi|307294747|ref|ZP_07574589.1| protein of unknown function DUF1674 [Sphingobium chlorophenolicum L-1] gi|306879221|gb|EFN10439.1| protein of unknown function DUF1674 [Sphingobium chlorophenolicum L-1] Length = 57 Score = 35.0 bits (79), Expect = 3.9, Method: Compositional matrix adjust. Identities = 12/18 (66%), Positives = 15/18 (83%) Query: 58 LDPTRFGDWEKNGISIDF 75 L P R+GDWE+ GI+IDF Sbjct: 40 LSPVRYGDWERKGIAIDF 57 >gi|240848943|ref|NP_001155523.1| hypothetical protein LOC100162201 [Acyrthosiphon pisum] gi|239791966|dbj|BAH72380.1| ACYPI003366 [Acyrthosiphon pisum] Length = 102 Score = 34.7 bits (78), Expect = 4.2, Method: Compositional matrix adjust. Identities = 14/25 (56%), Positives = 17/25 (68%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E G KG +PTR+GDWE+ G DF Sbjct: 78 ERNGPKGPEPTRYGDWERKGRVTDF 102 >gi|330801812|ref|XP_003288917.1| hypothetical protein DICPUDRAFT_153230 [Dictyostelium purpureum] gi|325081009|gb|EGC34541.1| hypothetical protein DICPUDRAFT_153230 [Dictyostelium purpureum] Length = 100 Score = 34.7 bits (78), Expect = 4.6, Method: Compositional matrix adjust. Identities = 13/25 (52%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+GG +G +PTR+ DWE+ G DF Sbjct: 76 EVGGPRGPEPTRYNDWERAGRVSDF 100 >gi|170741153|ref|YP_001769808.1| hypothetical protein M446_2962 [Methylobacterium sp. 4-46] gi|168195427|gb|ACA17374.1| protein of unknown function DUF1674 [Methylobacterium sp. 4-46] Length = 68 Score = 34.3 bits (77), Expect = 5.6, Method: Compositional matrix adjust. Identities = 12/22 (54%), Positives = 16/22 (72%) Query: 54 GRKGLDPTRFGDWEKNGISIDF 75 GR GL+P R+ DWE G++ DF Sbjct: 47 GRGGLEPVRYDDWEVKGLATDF 68 >gi|218528532|ref|YP_002419348.1| hypothetical protein Mchl_0485 [Methylobacterium chloromethanicum CM4] gi|218520835|gb|ACK81420.1| protein of unknown function DUF1674 [Methylobacterium chloromethanicum CM4] Length = 70 Score = 34.3 bits (77), Expect = 6.2, Method: Compositional matrix adjust. Identities = 13/25 (52%), Positives = 17/25 (68%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GR GL+P R+ DWE G++ DF Sbjct: 46 ETLGRGGLEPVRYEDWEVKGLASDF 70 >gi|118395860|ref|XP_001030275.1| hypothetical protein TTHERM_01106140 [Tetrahymena thermophila] gi|89284572|gb|EAR82612.1| hypothetical protein TTHERM_01106140 [Tetrahymena thermophila SB210] Length = 417 Score = 34.3 bits (77), Expect = 6.4, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Query: 33 EEAKQRKSANNKDAKLPIEIGGR-KGLDPTRFGDWEKNGISIDF 75 E+ K+ N + +P E+G + KG +PTRFGDWE+ F Sbjct: 111 EKRKEYLENNLNEWGMPEEVGFKVKGPEPTRFGDWERKAFQTKF 154 >gi|188579789|ref|YP_001923234.1| hypothetical protein Mpop_0521 [Methylobacterium populi BJ001] gi|179343287|gb|ACB78699.1| protein of unknown function DUF1674 [Methylobacterium populi BJ001] Length = 75 Score = 33.9 bits (76), Expect = 7.9, Method: Compositional matrix adjust. Identities = 12/22 (54%), Positives = 16/22 (72%) Query: 54 GRKGLDPTRFGDWEKNGISIDF 75 GR GL+P R+ DWE G++ DF Sbjct: 54 GRGGLEPVRYEDWEVKGLASDF 75 >gi|163849993|ref|YP_001638036.1| hypothetical protein Mext_0550 [Methylobacterium extorquens PA1] gi|240137126|ref|YP_002961595.1| hypothetical protein MexAM1_META1p0370 [Methylobacterium extorquens AM1] gi|163661598|gb|ABY28965.1| protein of unknown function DUF1674 [Methylobacterium extorquens PA1] gi|240007092|gb|ACS38318.1| conserved hypothetical protein [Methylobacterium extorquens AM1] Length = 75 Score = 33.9 bits (76), Expect = 8.3, Method: Compositional matrix adjust. Identities = 13/25 (52%), Positives = 17/25 (68%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GR GL+P R+ DWE G++ DF Sbjct: 51 ETLGRGGLEPVRYEDWEVKGLASDF 75 >gi|46203266|ref|ZP_00051778.2| COG5508: Uncharacterized conserved small protein [Magnetospirillum magnetotacticum MS-1] Length = 79 Score = 33.9 bits (76), Expect = 8.3, Method: Compositional matrix adjust. Identities = 13/25 (52%), Positives = 17/25 (68%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GR GL+P R+ DWE G++ DF Sbjct: 55 ETLGRGGLEPVRYEDWEVKGLASDF 79 Searching..................................................done Results from round 2 >gi|254780408|ref|YP_003064821.1| hypothetical protein CLIBASIA_01465 [Candidatus Liberibacter asiaticus str. psy62] gi|254040085|gb|ACT56881.1| hypothetical protein CLIBASIA_01465 [Candidatus Liberibacter asiaticus str. psy62] Length = 75 Score = 115 bits (289), Expect = 2e-24, Method: Composition-based stats. Identities = 75/75 (100%), Positives = 75/75 (100%) Query: 1 MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDP 60 MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDP Sbjct: 1 MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDP 60 Query: 61 TRFGDWEKNGISIDF 75 TRFGDWEKNGISIDF Sbjct: 61 TRFGDWEKNGISIDF 75 >gi|315122149|ref|YP_004062638.1| hypothetical protein CKC_01995 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495551|gb|ADR52150.1| hypothetical protein CKC_01995 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 64 Score = 87.4 bits (215), Expect = 5e-16, Method: Composition-based stats. Identities = 49/64 (76%), Positives = 56/64 (87%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 MNN+T K S + LSSIAKRALEEA+QR+SA NK+AK P+EIGGR G DPTRFGDWEKNG+ Sbjct: 1 MNNNTTKKSKETLSSIAKRALEEARQRRSAENKNAKHPVEIGGRDGPDPTRFGDWEKNGL 60 Query: 72 SIDF 75 SIDF Sbjct: 61 SIDF 64 >gi|163734257|ref|ZP_02141697.1| hypothetical protein RLO149_08434 [Roseobacter litoralis Och 149] gi|161392265|gb|EDQ16594.1| hypothetical protein RLO149_08434 [Roseobacter litoralis Och 149] Length = 96 Score = 87.1 bits (214), Expect = 8e-16, Method: Composition-based stats. Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 1/75 (1%) Query: 1 MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDP 60 ++T + +S L A+RAL EA+ R+ +D LP E+GGR+G +P Sbjct: 23 IKTQARGQSEMTQDSDDTQDMSDLPPAAQRALAEAEARRK-KAQDINLPPELGGREGPEP 81 Query: 61 TRFGDWEKNGISIDF 75 R+GDWE+ GI++DF Sbjct: 82 VRYGDWERKGIAVDF 96 >gi|126727796|ref|ZP_01743626.1| hypothetical protein RB2150_10549 [Rhodobacterales bacterium HTCC2150] gi|126702923|gb|EBA02026.1| hypothetical protein RB2150_10549 [Rhodobacterales bacterium HTCC2150] Length = 84 Score = 84.0 bits (206), Expect = 6e-15, Method: Composition-based stats. Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 4/76 (5%) Query: 3 TVQINIRGLMNN---STIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLD 59 T + RGL+ + + S L AKRAL EA++R+ K +LP+E+GGR+G + Sbjct: 10 TSKSRFRGLITSLGKNMTDASDTNLPPAAKRALAEAEERRK-KAKAKELPLELGGREGPE 68 Query: 60 PTRFGDWEKNGISIDF 75 P R+GDWEK GI++DF Sbjct: 69 PVRYGDWEKKGIAVDF 84 >gi|49476253|ref|YP_034294.1| hypothetical protein BH16010 [Bartonella henselae str. Houston-1] gi|49239061|emb|CAF28364.1| hypothetical protein BH16010 [Bartonella henselae str. Houston-1] Length = 86 Score = 81.7 bits (200), Expect = 3e-14, Method: Composition-based stats. Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 1/63 (1%) Query: 13 NNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 + PLS A+RAL EA++R+ + K P+E GGR G DP+R+GDWE G + Sbjct: 25 KQNATAAKQQPLSPAAQRALNEAEERRKHETNEEK-PLENGGRGGKDPSRYGDWEIKGRA 83 Query: 73 IDF 75 IDF Sbjct: 84 IDF 86 >gi|83950713|ref|ZP_00959446.1| hypothetical protein ISM_06425 [Roseovarius nubinhibens ISM] gi|83838612|gb|EAP77908.1| hypothetical protein ISM_06425 [Roseovarius nubinhibens ISM] Length = 64 Score = 80.5 bits (197), Expect = 7e-14, Method: Composition-based stats. Identities = 30/64 (46%), Positives = 43/64 (67%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 M++ + T L A+RAL EA++R+ +A LP E+GGRKG +P R+GDWEK GI Sbjct: 1 MSDDSQPTDRKDLPPAAQRALAEAEERRRLAEAEAPLPKELGGRKGPEPVRYGDWEKKGI 60 Query: 72 SIDF 75 ++DF Sbjct: 61 AVDF 64 >gi|254472306|ref|ZP_05085706.1| conserved hypothetical protein [Pseudovibrio sp. JE062] gi|211958589|gb|EEA93789.1| conserved hypothetical protein [Pseudovibrio sp. JE062] Length = 87 Score = 79.7 bits (195), Expect = 1e-13, Method: Composition-based stats. Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 1/76 (1%) Query: 1 MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRK-SANNKDAKLPIEIGGRKGLD 59 + ++++ + + K + L A+RAL+EA++R+ + +P E+ GR GLD Sbjct: 12 FKAQEVDMSEQVEEAPKKRRFEDLPPAAQRALKEAEERRTEIDAAQKAMPKELNGRGGLD 71 Query: 60 PTRFGDWEKNGISIDF 75 P R+ DWE GI+ DF Sbjct: 72 PARYSDWEVKGITSDF 87 >gi|49474773|ref|YP_032815.1| hypothetical protein BQ12910 [Bartonella quintana str. Toulouse] gi|49240277|emb|CAF26750.1| hypothetical protein BQ12910 [Bartonella quintana str. Toulouse] Length = 86 Score = 79.4 bits (194), Expect = 1e-13, Method: Composition-based stats. Identities = 29/65 (44%), Positives = 40/65 (61%), Gaps = 1/65 (1%) Query: 11 LMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNG 70 + + PLSS A+RAL EA++R+ K+ P+E GGR G DP+R+GDWE G Sbjct: 23 ISKQNATVDKQQPLSSEAQRALNEAEERRKHE-KNKDKPLENGGRGGKDPSRYGDWEIKG 81 Query: 71 ISIDF 75 +IDF Sbjct: 82 RAIDF 86 >gi|218661145|ref|ZP_03517075.1| hypothetical protein RetlI_17123 [Rhizobium etli IE4771] Length = 91 Score = 79.4 bits (194), Expect = 2e-13, Method: Composition-based stats. Identities = 30/63 (47%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Query: 13 NNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 + LS A+RAL EA++R+ N K +LP EIGGR G +P RFGD+E NG + Sbjct: 30 MAEGSEPPRKMLSPAAQRALAEAEERRK-NQKPLELPPEIGGRGGAEPARFGDYEINGRA 88 Query: 73 IDF 75 IDF Sbjct: 89 IDF 91 >gi|327191216|gb|EGE58259.1| hypothetical protein RHECNPAF_3340058 [Rhizobium etli CNPAF512] Length = 111 Score = 78.6 bits (192), Expect = 3e-13, Method: Composition-based stats. Identities = 29/61 (47%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Query: 15 STIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISID 74 + LS A+RAL EA++R+ N K L EIGGR G +P RFGD+E NG +ID Sbjct: 52 EGSEPPRKMLSPAAQRALAEAEERRK-NQKPLDLAPEIGGRGGAEPARFGDYEINGRAID 110 Query: 75 F 75 F Sbjct: 111 F 111 >gi|255262510|ref|ZP_05341852.1| conserved domain protein [Thalassiobium sp. R2A62] gi|255104845|gb|EET47519.1| conserved domain protein [Thalassiobium sp. R2A62] Length = 62 Score = 77.4 bits (189), Expect = 7e-13, Method: Composition-based stats. Identities = 30/63 (47%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Query: 13 NNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 T + + L A+RAL EA++R++ K A LP E+GGR G +P RFGDWEK GI+ Sbjct: 1 MTDTPTNTPNDLPPAAQRALAEAEERRALEAKQA-LPKELGGRDGPEPVRFGDWEKKGIA 59 Query: 73 IDF 75 +DF Sbjct: 60 VDF 62 >gi|319899455|ref|YP_004159552.1| hypothetical protein BARCL_1319 [Bartonella clarridgeiae 73] gi|319403423|emb|CBI76991.1| conserved protein of unknown function [Bartonella clarridgeiae 73] Length = 68 Score = 76.3 bits (186), Expect = 1e-12, Method: Composition-based stats. Identities = 26/67 (38%), Positives = 39/67 (58%), Gaps = 1/67 (1%) Query: 9 RGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEK 68 + + T H L A+RAL+EA++R+ + + P+E GGR G DP R+GDWE Sbjct: 3 KKMSTQDTAIPDHTRLPPEAQRALQEAEERRKHATNENQ-PLENGGRGGKDPVRYGDWEV 61 Query: 69 NGISIDF 75 G ++DF Sbjct: 62 KGRAVDF 68 >gi|319404850|emb|CBI78451.1| conserved hypothetical protein [Bartonella rochalimae ATCC BAA-1498] Length = 71 Score = 75.9 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 28/67 (41%), Positives = 42/67 (62%), Gaps = 1/67 (1%) Query: 9 RGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEK 68 + + +T H P+ A+RAL+EA++R+ + + P+E GGR G DP R+GDWE Sbjct: 6 KKMRTQNTTIPQHTPIPPEAQRALQEAEERRKCATNENQ-PLENGGRGGKDPARYGDWEI 64 Query: 69 NGISIDF 75 NG +IDF Sbjct: 65 NGRAIDF 71 >gi|150398385|ref|YP_001328852.1| hypothetical protein Smed_3193 [Sinorhizobium medicae WSM419] gi|150029900|gb|ABR62017.1| protein of unknown function DUF1674 [Sinorhizobium medicae WSM419] Length = 66 Score = 75.5 bits (184), Expect = 2e-12, Method: Composition-based stats. Identities = 31/63 (49%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Query: 13 NNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 N+++ PLS A RAL+EA++R+ A ++P E+GGR GLDP RFGDWE G + Sbjct: 5 NDNSPDHPRRPLSPAALRALKEAEERRGAKA-PKEIPAEVGGRGGLDPARFGDWEIKGRA 63 Query: 73 IDF 75 IDF Sbjct: 64 IDF 66 >gi|121602399|ref|YP_988408.1| hypothetical protein BARBAKC583_0070 [Bartonella bacilliformis KC583] gi|120614576|gb|ABM45177.1| conserved hypothetical protein [Bartonella bacilliformis KC583] Length = 68 Score = 75.5 bits (184), Expect = 2e-12, Method: Composition-based stats. Identities = 28/65 (43%), Positives = 40/65 (61%), Gaps = 1/65 (1%) Query: 11 LMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNG 70 + N++ + LS A+RAL+EA +R+ + K P+E GGR G DP R+GDWE G Sbjct: 5 ISNDTACSRPNSSLSPAAQRALQEAAERRKREIHEKK-PLESGGRGGKDPARYGDWEIKG 63 Query: 71 ISIDF 75 +IDF Sbjct: 64 RAIDF 68 >gi|254459606|ref|ZP_05073022.1| conserved hypothetical protein [Rhodobacterales bacterium HTCC2083] gi|206676195|gb|EDZ40682.1| conserved hypothetical protein [Rhodobacteraceae bacterium HTCC2083] Length = 59 Score = 74.7 bits (182), Expect = 3e-12, Method: Composition-based stats. Identities = 27/59 (45%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Query: 17 IKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 ++ L A+RAL EA++R+ K +L E+GGR G +P R+GDWEK GI+IDF Sbjct: 2 TDIKNNELPPAAQRALAEAEERRK-TAKALELAPELGGRNGPEPVRYGDWEKKGIAIDF 59 >gi|110678029|ref|YP_681036.1| hypothetical protein RD1_0652 [Roseobacter denitrificans OCh 114] gi|109454145|gb|ABG30350.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114] Length = 64 Score = 74.7 bits (182), Expect = 4e-12, Method: Composition-based stats. Identities = 27/65 (41%), Positives = 40/65 (61%), Gaps = 1/65 (1%) Query: 11 LMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNG 70 + +S L A+RAL EA+ R+ KD +P E+GGR+G +P R+GDWE+ G Sbjct: 1 MTQDSDDTQDISDLPPAAQRALAEAEARRK-KAKDMNMPPELGGREGPEPVRYGDWERKG 59 Query: 71 ISIDF 75 I++DF Sbjct: 60 IAVDF 64 >gi|319407811|emb|CBI81462.1| conserved hypothetical protein [Bartonella sp. 1-1C] Length = 64 Score = 74.3 bits (181), Expect = 5e-12, Method: Composition-based stats. Identities = 27/65 (41%), Positives = 39/65 (60%), Gaps = 1/65 (1%) Query: 11 LMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNG 70 + +T H + A+RAL+EA++R+ + P+E GGR G DP R+GDWE NG Sbjct: 1 MRTQNTTIPQHTRIPPEAQRALQEAEERRKC-ATNKNQPLENGGRGGKDPARYGDWEVNG 59 Query: 71 ISIDF 75 +IDF Sbjct: 60 RAIDF 64 >gi|307943519|ref|ZP_07658863.1| putative cytoplasmic protein [Roseibium sp. TrichSKD4] gi|307773149|gb|EFO32366.1| putative cytoplasmic protein [Roseibium sp. TrichSKD4] Length = 86 Score = 74.3 bits (181), Expect = 5e-12, Method: Composition-based stats. Identities = 24/63 (38%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Query: 14 NSTIKTSHDPLSSIAKRALEEAKQRKS-ANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 ++ K D L A+RAL+EA+ R+ + + + E+ GR GL+PTR+ DWE G++ Sbjct: 24 SAAPKKKFDDLPPAAQRALKEAEARRKDIDARHNAMEKEVDGRGGLEPTRYDDWEIKGLT 83 Query: 73 IDF 75 +DF Sbjct: 84 VDF 86 >gi|222150169|ref|YP_002551126.1| hypothetical protein Avi_4297 [Agrobacterium vitis S4] gi|221737151|gb|ACM38114.1| conserved hypothetical protein [Agrobacterium vitis S4] Length = 76 Score = 74.3 bits (181), Expect = 5e-12, Method: Composition-based stats. Identities = 31/67 (46%), Positives = 38/67 (56%), Gaps = 1/67 (1%) Query: 9 RGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEK 68 G N+ + LS A RAL EA++R+ A P E+GGR G DP RFGDWE Sbjct: 11 SGTANSDGTDAAPKTLSPAAVRALAEAEERRKAEQAQKPAP-EVGGRGGADPARFGDWEI 69 Query: 69 NGISIDF 75 NG +IDF Sbjct: 70 NGRAIDF 76 >gi|15967079|ref|NP_387432.1| hypothetical protein SMc04092 [Sinorhizobium meliloti 1021] gi|307302541|ref|ZP_07582298.1| protein of unknown function DUF1674 [Sinorhizobium meliloti BL225C] gi|307316128|ref|ZP_07595572.1| protein of unknown function DUF1674 [Sinorhizobium meliloti AK83] gi|15076352|emb|CAC47905.1| Hypothetical protein SMc04092 [Sinorhizobium meliloti 1021] gi|306897968|gb|EFN28710.1| protein of unknown function DUF1674 [Sinorhizobium meliloti AK83] gi|306903211|gb|EFN33801.1| protein of unknown function DUF1674 [Sinorhizobium meliloti BL225C] Length = 84 Score = 74.0 bits (180), Expect = 7e-12, Method: Composition-based stats. Identities = 27/63 (42%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Query: 13 NNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 N+++ PLS A RAL+ + + +P E+GGR GLDP RFGDWE G + Sbjct: 23 NDNSPDRPKRPLSPAALRALK-EAEERRRAEAPKDMPAELGGRGGLDPARFGDWEIKGRA 81 Query: 73 IDF 75 IDF Sbjct: 82 IDF 84 >gi|254503260|ref|ZP_05115411.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11] gi|222439331|gb|EEE46010.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11] Length = 87 Score = 74.0 bits (180), Expect = 7e-12, Method: Composition-based stats. Identities = 24/62 (38%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Query: 15 STIKTSHDPLSSIAKRALEEAKQRKS-ANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISI 73 K + L A+RAL+EA+ R+ + K + E+ GR GL+PTR+ DWE G+++ Sbjct: 26 EAPKRKFEDLPPAAQRALKEAEDRRKEIDAKHNAMAPEVDGRGGLEPTRYDDWEIKGLTV 85 Query: 74 DF 75 DF Sbjct: 86 DF 87 >gi|118591349|ref|ZP_01548747.1| hypothetical protein SIAM614_26918 [Stappia aggregata IAM 12614] gi|118436021|gb|EAV42664.1| hypothetical protein SIAM614_26918 [Stappia aggregata IAM 12614] Length = 87 Score = 74.0 bits (180), Expect = 7e-12, Method: Composition-based stats. Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Query: 14 NSTIKTSHDPLSSIAKRALEEAKQRKS-ANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 K + L A+RAL EA++R+ + + LP E+ GR GL+PTR+ DWE G++ Sbjct: 25 EEAPKRKFEDLPPAAQRALMEAEERRKEIDARQQNLPEEVNGRGGLEPTRYDDWEIKGLT 84 Query: 73 IDF 75 DF Sbjct: 85 SDF 87 >gi|87201109|ref|YP_498366.1| hypothetical protein Saro_3097 [Novosphingobium aromaticivorans DSM 12444] gi|87136790|gb|ABD27532.1| protein of unknown function DUF1674 [Novosphingobium aromaticivorans DSM 12444] Length = 82 Score = 73.6 bits (179), Expect = 8e-12, Method: Composition-based stats. Identities = 28/78 (35%), Positives = 38/78 (48%), Gaps = 4/78 (5%) Query: 1 MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEI---GGRKG 57 +R + +R + I T D L+ A R + + N+ P + G Sbjct: 6 LRCPKWQLR-FASGKPICTGMDKLTPRATRRPADFTRPTHWTNEPVPAPKAVERGDDPDG 64 Query: 58 LDPTRFGDWEKNGISIDF 75 LDPTRFGDWEKNGI+IDF Sbjct: 65 LDPTRFGDWEKNGIAIDF 82 >gi|163869267|ref|YP_001610523.1| hypothetical protein Btr_2572 [Bartonella tribocorum CIP 105476] gi|161018970|emb|CAK02528.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476] Length = 71 Score = 73.6 bits (179), Expect = 9e-12, Method: Composition-based stats. Identities = 27/65 (41%), Positives = 40/65 (61%), Gaps = 1/65 (1%) Query: 11 LMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNG 70 + +T LS A+RAL+EA++R+ + + P+E GGR G DP+R+GDWE G Sbjct: 8 ISKKNTTVIKQPSLSPAAQRALKEAEERRK-DATTKEQPLENGGRGGKDPSRYGDWEIKG 66 Query: 71 ISIDF 75 +IDF Sbjct: 67 RAIDF 71 >gi|222087918|ref|YP_002546456.1| hypothetical protein Arad_4931 [Agrobacterium radiobacter K84] gi|221725366|gb|ACM28522.1| conserved hypothetical protein [Agrobacterium radiobacter K84] Length = 74 Score = 73.2 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 33/62 (53%), Positives = 39/62 (62%), Gaps = 1/62 (1%) Query: 15 STIKTSHDPLSSIAKRALEEAKQRKSA-NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISI 73 + PLS AKRAL EA++R+ A LP EIGGR G DP+RFGDWE NG +I Sbjct: 13 EAGEAPRKPLSPAAKRALAEAEERRKAQAQAQTDLPPEIGGRGGADPSRFGDWEINGRTI 72 Query: 74 DF 75 DF Sbjct: 73 DF 74 >gi|319406334|emb|CBI79971.1| conserved hypothetical protein [Bartonella sp. AR 15-3] Length = 64 Score = 72.8 bits (177), Expect = 1e-11, Method: Composition-based stats. Identities = 24/65 (36%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Query: 11 LMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNG 70 + +T A+RAL+EA++R+ + + P+E GGR G DP R+GDWE G Sbjct: 1 MSKQNTTIPQQTWFPPEAQRALQEAEERRKCATNENQ-PLENGGRGGKDPARYGDWEVKG 59 Query: 71 ISIDF 75 ++DF Sbjct: 60 RAVDF 64 >gi|240851338|ref|YP_002972741.1| hypothetical protein Bgr_19610 [Bartonella grahamii as4aup] gi|240268461|gb|ACS52049.1| hypothetical protein Bgr_19610 [Bartonella grahamii as4aup] Length = 71 Score = 72.8 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 27/65 (41%), Positives = 39/65 (60%), Gaps = 1/65 (1%) Query: 11 LMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNG 70 + LS A+RAL+EA++R+ + K + P+E GGR G DP+R+GDWE G Sbjct: 8 TSKKNATVVKQQSLSPAAQRALKEAEERRKSAAK-KEQPLENGGRGGKDPSRYGDWEIKG 66 Query: 71 ISIDF 75 +IDF Sbjct: 67 RAIDF 71 >gi|260574498|ref|ZP_05842502.1| protein of unknown function DUF1674 [Rhodobacter sp. SW2] gi|259023394|gb|EEW26686.1| protein of unknown function DUF1674 [Rhodobacter sp. SW2] Length = 56 Score = 72.0 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 2/57 (3%) Query: 19 TSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + L A+RAL EA++R+ LP E+GGR G +P R+GDWEK GI+IDF Sbjct: 2 SDAADLPPAAQRALAEAEERRK--KAQTALPPELGGRNGPEPVRYGDWEKKGIAIDF 56 >gi|126463526|ref|YP_001044640.1| hypothetical protein Rsph17029_2766 [Rhodobacter sphaeroides ATCC 17029] gi|332559579|ref|ZP_08413901.1| hypothetical protein RSWS8N_10990 [Rhodobacter sphaeroides WS8N] gi|126105190|gb|ABN77868.1| protein of unknown function DUF1674 [Rhodobacter sphaeroides ATCC 17029] gi|332277291|gb|EGJ22606.1| hypothetical protein RSWS8N_10990 [Rhodobacter sphaeroides WS8N] Length = 62 Score = 71.6 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 30/63 (47%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Query: 13 NNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 + + L A RAL EA++R+ K LP EIGGR G +P RFGDWEK GI+ Sbjct: 1 MRDMTEETRKDLPPEALRALAEAEERRR-QAKALDLPKEIGGRNGPEPVRFGDWEKKGIA 59 Query: 73 IDF 75 IDF Sbjct: 60 IDF 62 >gi|114706036|ref|ZP_01438939.1| hypothetical protein FP2506_16259 [Fulvimarina pelagi HTCC2506] gi|114538882|gb|EAU42003.1| hypothetical protein FP2506_16259 [Fulvimarina pelagi HTCC2506] Length = 80 Score = 71.3 bits (173), Expect = 4e-11, Method: Composition-based stats. Identities = 34/74 (45%), Positives = 45/74 (60%), Gaps = 6/74 (8%) Query: 7 NIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNK----DAKLPIEIGGRK-GLDPT 61 +I G M S+ +TS LS AKRAL EA++R+ LP E+ GRK G++P Sbjct: 8 DILGAMKVSS-ETSVKTLSPAAKRALAEAEERRRTRTAFKVDPDSLPSEVDGRKSGVEPV 66 Query: 62 RFGDWEKNGISIDF 75 R+GDWEK+GI DF Sbjct: 67 RYGDWEKDGIVSDF 80 >gi|84684377|ref|ZP_01012278.1| hypothetical protein 1099457000260_RB2654_12169 [Maritimibacter alkaliphilus HTCC2654] gi|84667356|gb|EAQ13825.1| hypothetical protein RB2654_12169 [Rhodobacterales bacterium HTCC2654] Length = 59 Score = 70.9 bits (172), Expect = 5e-11, Method: Composition-based stats. Identities = 27/58 (46%), Positives = 36/58 (62%), Gaps = 1/58 (1%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + L A RAL EA++R+ KLP E+GGR G +P R+GDWEK G++IDF Sbjct: 3 DETKRDLPPAAIRALAEAEERRK-KAAALKLPEELGGRDGPEPVRYGDWEKKGLAIDF 59 >gi|218670930|ref|ZP_03520601.1| hypothetical protein RetlG_04368 [Rhizobium etli GR56] Length = 74 Score = 70.5 bits (171), Expect = 7e-11, Method: Composition-based stats. Identities = 29/63 (46%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Query: 13 NNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 + LS A+RAL EA++R+ K LP EIGGR G +P RFGD+E NG + Sbjct: 13 TAEGSEPPRKMLSPAAQRALAEAEERRKH-QKPLDLPPEIGGRGGAEPARFGDYEINGRA 71 Query: 73 IDF 75 IDF Sbjct: 72 IDF 74 >gi|221640600|ref|YP_002526862.1| hypothetical protein RSKD131_2501 [Rhodobacter sphaeroides KD131] gi|221161381|gb|ACM02361.1| Hypothetical Protein RSKD131_2501 [Rhodobacter sphaeroides KD131] Length = 62 Score = 70.5 bits (171), Expect = 7e-11, Method: Composition-based stats. Identities = 29/63 (46%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Query: 13 NNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 + + A RAL EA++R+ K LP EIGGR G +P RFGDWEK GI+ Sbjct: 1 MRDMTEETRKDFPPEALRALAEAEERRR-QAKALDLPKEIGGRNGPEPVRFGDWEKKGIA 59 Query: 73 IDF 75 IDF Sbjct: 60 IDF 62 >gi|254464711|ref|ZP_05078122.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I] gi|206685619|gb|EDZ46101.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I] Length = 63 Score = 70.1 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 28/63 (44%), Positives = 35/63 (55%) Query: 13 NNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 + L A RAL EA++R+ A P E+GGR G DP R+GDWEK GI+ Sbjct: 1 MSEETAPEKKDLPPAAVRALAEAEERRKAAEAQEPRPKELGGRDGPDPARYGDWEKKGIA 60 Query: 73 IDF 75 IDF Sbjct: 61 IDF 63 >gi|85703965|ref|ZP_01035068.1| dihydrodipicolinate reductase [Roseovarius sp. 217] gi|85671285|gb|EAQ26143.1| dihydrodipicolinate reductase [Roseovarius sp. 217] Length = 63 Score = 70.1 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 27/57 (47%), Positives = 37/57 (64%), Gaps = 2/57 (3%) Query: 20 SHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGR-KGLDPTRFGDWEKNGISIDF 75 L A+RAL EA++R+ LP E+GGR +GL+P R+GDWEK G++IDF Sbjct: 8 KPRDLPPAAQRALAEAEERRKLAET-LALPKELGGRQEGLEPVRYGDWEKKGLAIDF 63 >gi|254449962|ref|ZP_05063399.1| conserved hypothetical protein [Octadecabacter antarcticus 238] gi|198264368|gb|EDY88638.1| conserved hypothetical protein [Octadecabacter antarcticus 238] Length = 58 Score = 69.7 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 1/59 (1%) Query: 17 IKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + +H +S AKRAL EA R+ K +LP E+GGR G +P RFGDWE+ GI++DF Sbjct: 1 MTQAHKDISDAAKRALAEASDRRE-KAKAMELPEELGGRDGPEPVRFGDWERKGIAVDF 58 >gi|325294197|ref|YP_004280061.1| hypothetical protein AGROH133_09299 [Agrobacterium sp. H13-3] gi|325062050|gb|ADY65741.1| hypothetical protein AGROH133_09299 [Agrobacterium sp. H13-3] Length = 66 Score = 69.3 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 28/54 (51%), Positives = 37/54 (68%), Gaps = 1/54 (1%) Query: 22 DPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LS A+RAL+EA++R+ D +LP E GGR G +P RFGD+E NG +IDF Sbjct: 14 KRLSPAAERALKEAEERRK-QQADLQLPQETGGRGGAEPVRFGDYEINGRAIDF 66 >gi|319409411|emb|CBI83057.1| conserved hypothetical protein [Bartonella schoenbuchensis R1] Length = 75 Score = 69.0 bits (167), Expect = 2e-10, Method: Composition-based stats. Identities = 28/63 (44%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Query: 13 NNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 + PL A+RAL+EA QR+ K+P+E GGR G DP R+GDWE G + Sbjct: 14 KQNAASLKQRPLPPEAQRALKEAAQRRK-QALHEKMPLENGGRGGKDPARYGDWEIKGRA 72 Query: 73 IDF 75 IDF Sbjct: 73 IDF 75 >gi|239832891|ref|ZP_04681220.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301] gi|239825158|gb|EEQ96726.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301] Length = 72 Score = 68.6 bits (166), Expect = 2e-10, Method: Composition-based stats. Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K D L A+RAL+EA+ R+ A K+A+ P EIGGR G DP R+GDWE G +IDF Sbjct: 16 KRPFDDLPPAAQRALKEAEARR-AVEKEAQAPREIGGRGGKDPARYGDWEIKGRTIDF 72 >gi|227823842|ref|YP_002827815.1| hypothetical protein NGR_c33320 [Sinorhizobium fredii NGR234] gi|227342844|gb|ACP27062.1| hypothetical protein NGR_c33320 [Sinorhizobium fredii NGR234] Length = 66 Score = 68.6 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 1/63 (1%) Query: 13 NNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 N+++ + PLS A RAL+ + + + A +P E GGR GLDP RFGDWE G + Sbjct: 5 NDNSPGHAKRPLSPAALRALK-EAEERRRAEEQAAMPQEFGGRGGLDPARFGDWEIKGRA 63 Query: 73 IDF 75 IDF Sbjct: 64 IDF 66 >gi|190893966|ref|YP_001980508.1| hypothetical protein RHECIAT_CH0004403 [Rhizobium etli CIAT 652] gi|190699245|gb|ACE93330.1| hypothetical conserved protein [Rhizobium etli CIAT 652] Length = 74 Score = 68.2 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 1/63 (1%) Query: 13 NNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 + LS A+RAL EA++R+ N K +L EIGGR G +P RFGD+E NG + Sbjct: 13 MAEGSERPRKMLSPAAQRALAEAEERRK-NQKPLELAPEIGGRGGAEPARFGDYEINGRA 71 Query: 73 IDF 75 IDF Sbjct: 72 IDF 74 >gi|114769581|ref|ZP_01447191.1| dihydrodipicolinate reductase [alpha proteobacterium HTCC2255] gi|114549286|gb|EAU52168.1| dihydrodipicolinate reductase [alpha proteobacterium HTCC2255] gi|297183947|gb|ADI20068.1| hypothetical protein [uncultured alpha proteobacterium EB080_L11F12] Length = 59 Score = 68.2 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 30/57 (52%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Query: 19 TSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + D + + A RALEEA RK ++ KL +E+GG KGL+PTRFGDWE+ GI+ DF Sbjct: 4 SKSDRIKAAAHRALEEAHNRKK-ELEETKLDLELGGPKGLEPTRFGDWERKGIASDF 59 >gi|297184253|gb|ADI20371.1| hypothetical protein [uncultured alpha proteobacterium EB080_L27A02] Length = 59 Score = 68.2 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 30/57 (52%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Query: 19 TSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + D + + A RALEEA RK + KL +E+GG KGL+PTRFGDWE+ GI+ DF Sbjct: 4 SKSDRIKAAAHRALEEAHNRKK-ELDETKLDLELGGPKGLEPTRFGDWERKGIASDF 59 >gi|297184030|gb|ADI20150.1| hypothetical protein [uncultured alpha proteobacterium EB080_L06A09] Length = 61 Score = 67.8 bits (164), Expect = 5e-10, Method: Composition-based stats. Identities = 30/58 (51%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Query: 19 TSHDPLSSIAKRALEEAKQRK-SANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + D + + A RALEEAK RK + K A +E+GG KGL+PTR+GDWE+ GI+ DF Sbjct: 4 SKSDRIKAAAIRALEEAKGRKIKIDVKKANQELELGGPKGLEPTRYGDWERKGIASDF 61 >gi|294675831|ref|YP_003576446.1| hypothetical protein RCAP_rcc00274 [Rhodobacter capsulatus SB 1003] gi|294474651|gb|ADE84039.1| protein of unknown function DUF1674 [Rhodobacter capsulatus SB 1003] Length = 59 Score = 67.8 bits (164), Expect = 5e-10, Method: Composition-based stats. Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + + L A RAL EA++R+ A K A+LP E GGR G +P RFGDWEK GI+IDF Sbjct: 3 EDAPKELPPAAIRALAEAEERRKA-AKAAELPKEFGGRDGPEPVRFGDWEKKGIAIDF 59 >gi|71275730|ref|ZP_00652015.1| conserved hypothetical protein [Xylella fastidiosa Dixon] gi|71899528|ref|ZP_00681685.1| conserved hypothetical protein [Xylella fastidiosa Ann-1] gi|170729588|ref|YP_001775021.1| hypothetical protein Xfasm12_0377 [Xylella fastidiosa M12] gi|71163621|gb|EAO13338.1| conserved hypothetical protein [Xylella fastidiosa Dixon] gi|71730748|gb|EAO32822.1| conserved hypothetical protein [Xylella fastidiosa Ann-1] gi|167964381|gb|ACA11391.1| conserved hypothetical protein [Xylella fastidiosa M12] Length = 72 Score = 67.8 bits (164), Expect = 5e-10, Method: Composition-based stats. Identities = 28/69 (40%), Positives = 37/69 (53%), Gaps = 8/69 (11%) Query: 7 NIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDW 66 N G ++ ++ D IAK A + KQR + E+GGR GLDP R+GDW Sbjct: 12 NFIGEKRMFSVCSAPDDSQEIAKNATADLKQRSNLE--------EVGGRGGLDPVRYGDW 63 Query: 67 EKNGISIDF 75 EK+G IDF Sbjct: 64 EKDGRCIDF 72 >gi|149912796|ref|ZP_01901330.1| hypothetical protein RAZWK3B_02370 [Roseobacter sp. AzwK-3b] gi|149813202|gb|EDM73028.1| hypothetical protein RAZWK3B_02370 [Roseobacter sp. AzwK-3b] Length = 59 Score = 67.8 bits (164), Expect = 5e-10, Method: Composition-based stats. Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 2/54 (3%) Query: 23 PLSSIAKRALEEAKQRKSANNKDAKLPIEIGGR-KGLDPTRFGDWEKNGISIDF 75 L A+RAL EA++R+ + LP E+GGR +GL+P R+GDWEK G++IDF Sbjct: 7 DLPPAAQRALAEAEERRR-KAEALDLPKELGGRREGLEPVRYGDWEKKGLAIDF 59 >gi|146337495|ref|YP_001202543.1| hypothetical protein BRADO0341 [Bradyrhizobium sp. ORS278] gi|146190301|emb|CAL74297.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278] Length = 63 Score = 67.4 bits (163), Expect = 5e-10, Method: Composition-based stats. Identities = 26/62 (41%), Positives = 38/62 (61%), Gaps = 1/62 (1%) Query: 15 STIKTSHDPLSSIAKRALEEAKQRKS-ANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISI 73 ++ PL+ A+RAL EA++R+ A + +P E+ G KG +PTR+GDWE GI Sbjct: 2 ASNDAPRKPLTPAAQRALAEAEERRRIAAEQAKPMPKELQGPKGPEPTRYGDWENKGIIS 61 Query: 74 DF 75 DF Sbjct: 62 DF 63 >gi|159185403|ref|NP_527922.1| hypothetical protein Atu2827 [Agrobacterium tumefaciens str. C58] gi|17741348|gb|AAL43808.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58] Length = 70 Score = 67.4 bits (163), Expect = 6e-10, Method: Composition-based stats. Identities = 28/54 (51%), Positives = 36/54 (66%), Gaps = 1/54 (1%) Query: 22 DPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LS A+RALEEA++R+ D +LP E GGR G +P RFGD+E G +IDF Sbjct: 18 RRLSPAAQRALEEAEERRR-QQADLQLPPETGGRGGAEPVRFGDYEIKGRAIDF 70 >gi|56698201|ref|YP_168573.1| hypothetical protein SPO3377 [Ruegeria pomeroyi DSS-3] gi|56679938|gb|AAV96604.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3] Length = 60 Score = 67.4 bits (163), Expect = 6e-10, Method: Composition-based stats. Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Query: 17 IKTSHDPLSSIAKRALEEAKQRK-SANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + L A+RAL EA++R+ A + LP E+GGR G DP R+GDWEK GI+IDF Sbjct: 1 MSEPRPDLPPAAQRALAEAEERRRKAEAETKPLPKELGGRDGPDPARYGDWEKKGIAIDF 60 >gi|114571461|ref|YP_758141.1| hypothetical protein Mmar10_2922 [Maricaulis maris MCS10] gi|114341923|gb|ABI67203.1| protein of unknown function DUF1674 [Maricaulis maris MCS10] Length = 75 Score = 67.0 bits (162), Expect = 7e-10, Method: Composition-based stats. Identities = 30/64 (46%), Positives = 39/64 (60%), Gaps = 1/64 (1%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 + + LS A+RAL EA++R+ + A+L E GGRKG +PTRFGDWEK GI Sbjct: 13 ATIPSPDAAPRVLSPEARRALAEAEERRKI-ARQAELAPETGGRKGPEPTRFGDWEKKGI 71 Query: 72 SIDF 75 DF Sbjct: 72 ICDF 75 >gi|218682720|ref|ZP_03530321.1| hypothetical protein RetlC8_28293 [Rhizobium etli CIAT 894] Length = 73 Score = 66.6 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 30/62 (48%), Positives = 38/62 (61%), Gaps = 1/62 (1%) Query: 14 NSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISI 73 + LS AKRAL EA++R+ N K +LP E GGR G +P RFGD+E NG +I Sbjct: 13 TAEASQPRKVLSPAAKRALAEAEERRK-NQKPLELPPETGGRGGAEPARFGDYEINGRAI 71 Query: 74 DF 75 DF Sbjct: 72 DF 73 >gi|254420487|ref|ZP_05034211.1| conserved hypothetical protein [Brevundimonas sp. BAL3] gi|196186664|gb|EDX81640.1| conserved hypothetical protein [Brevundimonas sp. BAL3] Length = 85 Score = 66.3 bits (160), Expect = 1e-09, Method: Composition-based stats. Identities = 29/60 (48%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Query: 16 TIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 T PLS +A+RAL EA R++A P E GG G +PTR+GDWEK G++IDF Sbjct: 27 PHATPEKPLSDVARRALLEAADRRAAEQVAQTDP-EHGGPSGPEPTRYGDWEKKGLAIDF 85 >gi|254436923|ref|ZP_05050417.1| conserved hypothetical protein [Octadecabacter antarcticus 307] gi|198252369|gb|EDY76683.1| conserved hypothetical protein [Octadecabacter antarcticus 307] Length = 58 Score = 66.3 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 28/59 (47%), Positives = 37/59 (62%), Gaps = 1/59 (1%) Query: 17 IKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + +S AKRAL EA R+ K +LP E+GGR G +P RFGDWE+ GI++DF Sbjct: 1 MTDKPKDISDAAKRALSEADDRRK-KAKAMELPEELGGRDGPEPVRFGDWERRGIAVDF 58 >gi|15837671|ref|NP_298359.1| hypothetical protein XF1069 [Xylella fastidiosa 9a5c] gi|9106016|gb|AAF83879.1|AE003943_10 hypothetical protein XF_1069 [Xylella fastidiosa 9a5c] Length = 72 Score = 66.3 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 26/60 (43%), Positives = 32/60 (53%), Gaps = 8/60 (13%) Query: 16 TIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 ++ + IAK A + KQR EIGGR GLDP R+GDWEK+G IDF Sbjct: 21 SVCPAPQDSQEIAKNATADLKQRSDLE--------EIGGRGGLDPVRYGDWEKDGRCIDF 72 >gi|28198266|ref|NP_778580.1| hypothetical protein PD0349 [Xylella fastidiosa Temecula1] gi|182680903|ref|YP_001829063.1| hypothetical protein XfasM23_0341 [Xylella fastidiosa M23] gi|28056336|gb|AAO28229.1| conserved hypothetical protein [Xylella fastidiosa Temecula1] gi|182631013|gb|ACB91789.1| protein of unknown function DUF1674 [Xylella fastidiosa M23] Length = 72 Score = 65.9 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 27/69 (39%), Positives = 37/69 (53%), Gaps = 8/69 (11%) Query: 7 NIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDW 66 N G ++ ++ + IAK A + KQR + E+GGR GLDP R+GDW Sbjct: 12 NFIGEKRMFSVCSAPEDSQEIAKNATADLKQRSNLE--------EVGGRGGLDPVRYGDW 63 Query: 67 EKNGISIDF 75 EK+G IDF Sbjct: 64 EKDGRCIDF 72 >gi|209551490|ref|YP_002283407.1| hypothetical protein Rleg2_3919 [Rhizobium leguminosarum bv. trifolii WSM2304] gi|209537246|gb|ACI57181.1| protein of unknown function DUF1674 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 74 Score = 65.9 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 31/75 (41%), Positives = 41/75 (54%), Gaps = 1/75 (1%) Query: 1 MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDP 60 M+ + + LS AKRAL EA++R+ N K +LP E GGR G +P Sbjct: 1 MQDADNDNSETPTAERSEPPRKMLSPAAKRALAEAEERRK-NQKPLELPPETGGRGGAEP 59 Query: 61 TRFGDWEKNGISIDF 75 RFGD+E NG +IDF Sbjct: 60 ARFGDYEINGRAIDF 74 >gi|71899437|ref|ZP_00681596.1| conserved hypothetical protein [Xylella fastidiosa Ann-1] gi|71730846|gb|EAO32918.1| conserved hypothetical protein [Xylella fastidiosa Ann-1] gi|307579371|gb|ADN63340.1| hypothetical protein XFLM_07120 [Xylella fastidiosa subsp. fastidiosa GB514] Length = 71 Score = 65.5 bits (158), Expect = 2e-09, Method: Composition-based stats. Identities = 27/69 (39%), Positives = 37/69 (53%), Gaps = 8/69 (11%) Query: 7 NIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDW 66 N G ++ ++ + IAK A + KQR + E+GGR GLDP R+GDW Sbjct: 11 NFIGEKRMFSVCSAPEDSQEIAKNATADLKQRSNLE--------EVGGRGGLDPVRYGDW 62 Query: 67 EKNGISIDF 75 EK+G IDF Sbjct: 63 EKDGRCIDF 71 >gi|330813353|ref|YP_004357592.1| hypothetical protein SAR11G3_00378 [Candidatus Pelagibacter sp. IMCC9063] gi|327486448|gb|AEA80853.1| hypothetical protein SAR11G3_00378 [Candidatus Pelagibacter sp. IMCC9063] Length = 70 Score = 65.1 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 28/54 (51%), Positives = 35/54 (64%), Gaps = 1/54 (1%) Query: 22 DPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 +AK+ALEEAK+RK + + K P EI G G +PTR+GDWEK GI DF Sbjct: 18 KNFKEMAKKALEEAKKRKKLKSVE-KAPKEINGPAGPEPTRYGDWEKKGIVSDF 70 >gi|83945682|ref|ZP_00958027.1| hypothetical protein OA2633_10839 [Oceanicaulis alexandrii HTCC2633] gi|83850883|gb|EAP88743.1| hypothetical protein OA2633_10839 [Oceanicaulis alexandrii HTCC2633] Length = 67 Score = 65.1 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 31/64 (48%), Positives = 38/64 (59%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 PLS AKRAL EA++R+ DA+ E+GG KG +PTRFGDWEK GI Sbjct: 4 AQTPEPDEPRKPLSEAAKRALAEAEERRRQAEADAEREKELGGPKGPEPTRFGDWEKKGI 63 Query: 72 SIDF 75 + DF Sbjct: 64 TYDF 67 >gi|289665882|ref|ZP_06487463.1| hypothetical protein XcampvN_23097 [Xanthomonas campestris pv. vasculorum NCPPB702] gi|289669029|ref|ZP_06490104.1| hypothetical protein XcampmN_11167 [Xanthomonas campestris pv. musacearum NCPPB4381] Length = 142 Score = 64.7 bits (156), Expect = 4e-09, Method: Composition-based stats. Identities = 21/32 (65%), Positives = 24/32 (75%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + LP EIGGR G +PTR+GDWEKNG IDF Sbjct: 111 EKKPLPKEIGGRDGPEPTRYGDWEKNGRCIDF 142 >gi|23502665|ref|NP_698792.1| hypothetical protein BR1812 [Brucella suis 1330] gi|62290677|ref|YP_222470.1| hypothetical protein BruAb1_1792 [Brucella abortus bv. 1 str. 9-941] gi|82700592|ref|YP_415166.1| hypothetical protein BAB1_1820 [Brucella melitensis biovar Abortus 2308] gi|225628366|ref|ZP_03786400.1| Hypothetical protein, conserved [Brucella ceti str. Cudo] gi|256370216|ref|YP_003107727.1| hypothetical protein BMI_I1828 [Brucella microti CCM 4915] gi|294851051|ref|ZP_06791727.1| hypothetical protein BAZG_03184 [Brucella sp. NVSL 07-0026] gi|297249069|ref|ZP_06932777.1| hypothetical protein BAYG_03111 [Brucella abortus bv. 5 str. B3196] gi|23348674|gb|AAN30707.1| conserved hypothetical protein [Brucella suis 1330] gi|62196809|gb|AAX75109.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941] gi|82616693|emb|CAJ11776.1| conserved hypothetical protein [Brucella melitensis biovar Abortus 2308] gi|225616212|gb|EEH13260.1| Hypothetical protein, conserved [Brucella ceti str. Cudo] gi|256000379|gb|ACU48778.1| hypothetical protein BMI_I1828 [Brucella microti CCM 4915] gi|294821694|gb|EFG38690.1| hypothetical protein BAZG_03184 [Brucella sp. NVSL 07-0026] gi|297174202|gb|EFH33559.1| hypothetical protein BAYG_03111 [Brucella abortus bv. 5 str. B3196] Length = 75 Score = 64.3 bits (155), Expect = 5e-09, Method: Composition-based stats. Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K + L A+RAL+ + + A K KLP EIGGR G DP R+GDWE G +IDF Sbjct: 19 KRRFEDLPPAAQRALK-EAEARRAAEKAEKLPREIGGRGGKDPARYGDWEIKGRTIDF 75 >gi|163757450|ref|ZP_02164539.1| hypothetical protein HPDFL43_18607 [Hoeflea phototrophica DFL-43] gi|162284952|gb|EDQ35234.1| hypothetical protein HPDFL43_18607 [Hoeflea phototrophica DFL-43] Length = 79 Score = 64.3 bits (155), Expect = 5e-09, Method: Composition-based stats. Identities = 30/60 (50%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Query: 17 IKTSHDPLSSIAKRALEEAKQRKSA-NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 T LS AKRAL EA +R+ A + EIGGR G DP RFGDWE +G +IDF Sbjct: 20 TDTPKRELSPAAKRALAEADERRKARDTAKISTEKEIGGRGGADPARFGDWEIDGRAIDF 79 >gi|265984819|ref|ZP_06097554.1| predicted protein [Brucella sp. 83/13] gi|264663411|gb|EEZ33672.1| predicted protein [Brucella sp. 83/13] Length = 82 Score = 64.3 bits (155), Expect = 5e-09, Method: Composition-based stats. Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K + L A+RAL+ + + A K KLP EIGGR G DP R+GDWE G +IDF Sbjct: 26 KRRFEDLPPAAQRALK-EAEARRAAEKAEKLPREIGGRGGKDPARYGDWEIKGRTIDF 82 >gi|167523026|ref|XP_001745850.1| hypothetical protein [Monosiga brevicollis MX1] gi|163775651|gb|EDQ89274.1| predicted protein [Monosiga brevicollis MX1] Length = 190 Score = 64.3 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 6/73 (8%) Query: 9 RGLMNNSTIKTSHDPLSS-----IAKRALEEAKQRKSA-NNKDAKLPIEIGGRKGLDPTR 62 RG+ + + + A EA + K A +N + +P E G KG +PTR Sbjct: 118 RGVHAAAPLARHEPGATPTEPEQAADTPDAEASEPKPASDNSQSDMPREYNGPKGPEPTR 177 Query: 63 FGDWEKNGISIDF 75 +GDWE+ G DF Sbjct: 178 YGDWERKGRVSDF 190 >gi|237816178|ref|ZP_04595173.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] gi|260755500|ref|ZP_05867848.1| predicted protein [Brucella abortus bv. 6 str. 870] gi|260758723|ref|ZP_05871071.1| predicted protein [Brucella abortus bv. 4 str. 292] gi|260762557|ref|ZP_05874894.1| predicted protein [Brucella abortus bv. 2 str. 86/8/59] gi|260884521|ref|ZP_05896135.1| predicted protein [Brucella abortus bv. 9 str. C68] gi|261214771|ref|ZP_05929052.1| predicted protein [Brucella abortus bv. 3 str. Tulya] gi|261219384|ref|ZP_05933665.1| predicted protein [Brucella ceti M13/05/1] gi|261222926|ref|ZP_05937207.1| predicted protein [Brucella ceti B1/94] gi|261315835|ref|ZP_05955032.1| predicted protein [Brucella pinnipedialis M163/99/10] gi|261316305|ref|ZP_05955502.1| predicted protein [Brucella pinnipedialis B2/94] gi|261322446|ref|ZP_05961643.1| predicted protein [Brucella ceti M644/93/1] gi|261325840|ref|ZP_05965037.1| predicted protein [Brucella neotomae 5K33] gi|261750957|ref|ZP_05994666.1| predicted protein [Brucella suis bv. 5 str. 513] gi|261754211|ref|ZP_05997920.1| predicted protein [Brucella suis bv. 3 str. 686] gi|265987372|ref|ZP_06099929.1| predicted protein [Brucella pinnipedialis M292/94/1] gi|265991838|ref|ZP_06104395.1| predicted protein [Brucella melitensis bv. 1 str. Rev.1] gi|265995676|ref|ZP_06108233.1| predicted protein [Brucella melitensis bv. 3 str. Ether] gi|265998885|ref|ZP_06111442.1| predicted protein [Brucella ceti M490/95/1] gi|237788640|gb|EEP62853.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] gi|260669041|gb|EEX55981.1| predicted protein [Brucella abortus bv. 4 str. 292] gi|260672983|gb|EEX59804.1| predicted protein [Brucella abortus bv. 2 str. 86/8/59] gi|260675608|gb|EEX62429.1| predicted protein [Brucella abortus bv. 6 str. 870] gi|260874049|gb|EEX81118.1| predicted protein [Brucella abortus bv. 9 str. C68] gi|260916378|gb|EEX83239.1| predicted protein [Brucella abortus bv. 3 str. Tulya] gi|260921510|gb|EEX88163.1| predicted protein [Brucella ceti B1/94] gi|260924473|gb|EEX91041.1| predicted protein [Brucella ceti M13/05/1] gi|261295136|gb|EEX98632.1| predicted protein [Brucella ceti M644/93/1] gi|261295528|gb|EEX99024.1| predicted protein [Brucella pinnipedialis B2/94] gi|261301820|gb|EEY05317.1| predicted protein [Brucella neotomae 5K33] gi|261304861|gb|EEY08358.1| predicted protein [Brucella pinnipedialis M163/99/10] gi|261740710|gb|EEY28636.1| predicted protein [Brucella suis bv. 5 str. 513] gi|261743964|gb|EEY31890.1| predicted protein [Brucella suis bv. 3 str. 686] gi|262553574|gb|EEZ09343.1| predicted protein [Brucella ceti M490/95/1] gi|262766960|gb|EEZ12578.1| predicted protein [Brucella melitensis bv. 3 str. Ether] gi|263002794|gb|EEZ15197.1| predicted protein [Brucella melitensis bv. 1 str. Rev.1] gi|264659569|gb|EEZ29830.1| predicted protein [Brucella pinnipedialis M292/94/1] Length = 82 Score = 63.9 bits (154), Expect = 6e-09, Method: Composition-based stats. Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K + L A+RAL+ + + A K KLP EIGGR G DP R+GDWE G +IDF Sbjct: 26 KRRFEDLPPAAQRALK-EAEARRAAEKAEKLPREIGGRGGKDPARYGDWEIKGRTIDF 82 >gi|77748629|ref|NP_642395.2| hypothetical protein XAC2073 [Xanthomonas axonopodis pv. citri str. 306] Length = 142 Score = 63.6 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 21/32 (65%), Positives = 24/32 (75%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + LP EIGGR G +PTR+GDWEKNG IDF Sbjct: 111 EKKPLPKEIGGRDGPEPTRYGDWEKNGRCIDF 142 >gi|148559813|ref|YP_001259651.1| hypothetical protein BOV_1745 [Brucella ovis ATCC 25840] gi|148371070|gb|ABQ61049.1| conserved hypothetical protein [Brucella ovis ATCC 25840] Length = 72 Score = 63.2 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K + L A+RAL+ + + A K KLP EIGGR G DP R+GDWE G +IDF Sbjct: 16 KRRFEDLPPAAQRALK-EAEARRAAEKAEKLPREIGGRGGKDPARYGDWEIKGRTIDF 72 >gi|254295348|ref|YP_003061371.1| hypothetical protein Hbal_3006 [Hirschia baltica ATCC 49814] gi|254043879|gb|ACT60674.1| protein of unknown function DUF1674 [Hirschia baltica ATCC 49814] Length = 87 Score = 63.2 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 27/63 (42%), Positives = 34/63 (53%), Gaps = 3/63 (4%) Query: 16 TIKTSHDPLSSIAKRALEEAKQRKSANNKDA---KLPIEIGGRKGLDPTRFGDWEKNGIS 72 L+ AKRALEEA R+ A + KL E G G +PTR+GDWE+ GI+ Sbjct: 25 PGAAPGKVLTDAAKRALEEAAIRREAEMAETAKKKLVEEWNGPAGEEPTRYGDWERKGIT 84 Query: 73 IDF 75 DF Sbjct: 85 YDF 87 >gi|58426528|gb|AAW75565.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae KACC10331] Length = 384 Score = 63.2 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 21/32 (65%), Positives = 24/32 (75%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + LP EIGGR G +PTR+GDWEKNG IDF Sbjct: 353 EKKPLPKEIGGRDGPEPTRYGDWEKNGRCIDF 384 >gi|254719800|ref|ZP_05181611.1| hypothetical protein Bru83_09683 [Brucella sp. 83/13] gi|306839496|ref|ZP_07472304.1| cytoplasmic protein [Brucella sp. NF 2653] gi|306841591|ref|ZP_07474288.1| cytoplasmic protein [Brucella sp. BO2] gi|306844792|ref|ZP_07477377.1| cytoplasmic protein [Brucella sp. BO1] gi|306274964|gb|EFM56734.1| cytoplasmic protein [Brucella sp. BO1] gi|306288337|gb|EFM59700.1| cytoplasmic protein [Brucella sp. BO2] gi|306405441|gb|EFM61712.1| cytoplasmic protein [Brucella sp. NF 2653] Length = 72 Score = 62.8 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K + L A+RAL+ + + A K KLP EIGGR G DP R+GDWE G +IDF Sbjct: 16 KRRFEDLPPAAQRALK-EAEARRAAEKAEKLPREIGGRGGKDPARYGDWEIKGRTIDF 72 >gi|17986521|ref|NP_539155.1| putative cytoplasmic protein [Brucella melitensis bv. 1 str. 16M] gi|161619732|ref|YP_001593619.1| hypothetical protein BCAN_A1850 [Brucella canis ATCC 23365] gi|163845390|ref|YP_001623045.1| hypothetical protein BSUIS_B1290 [Brucella suis ATCC 23445] gi|189024889|ref|YP_001935657.1| hypothetical protein BAbS19_I17010 [Brucella abortus S19] gi|225853256|ref|YP_002733489.1| hypothetical protein BMEA_A1862 [Brucella melitensis ATCC 23457] gi|254689965|ref|ZP_05153219.1| hypothetical protein Babob68_07309 [Brucella abortus bv. 6 str. 870] gi|254694457|ref|ZP_05156285.1| hypothetical protein Babob3T_07312 [Brucella abortus bv. 3 str. Tulya] gi|254698116|ref|ZP_05159944.1| hypothetical protein Babob28_10503 [Brucella abortus bv. 2 str. 86/8/59] gi|254700456|ref|ZP_05162284.1| hypothetical protein Bsuib55_06329 [Brucella suis bv. 5 str. 513] gi|254703578|ref|ZP_05165406.1| hypothetical protein Bsuib36_06574 [Brucella suis bv. 3 str. 686] gi|254708335|ref|ZP_05170163.1| hypothetical protein BpinM_15630 [Brucella pinnipedialis M163/99/10] gi|254708812|ref|ZP_05170623.1| hypothetical protein BpinB_00846 [Brucella pinnipedialis B2/94] gi|254714652|ref|ZP_05176463.1| hypothetical protein BcetM6_15207 [Brucella ceti M644/93/1] gi|254717550|ref|ZP_05179361.1| hypothetical protein BcetM_14336 [Brucella ceti M13/05/1] gi|254731000|ref|ZP_05189578.1| hypothetical protein Babob42_07342 [Brucella abortus bv. 4 str. 292] gi|256030338|ref|ZP_05443952.1| hypothetical protein BpinM2_06766 [Brucella pinnipedialis M292/94/1] gi|256045411|ref|ZP_05448303.1| hypothetical protein Bmelb1R_13019 [Brucella melitensis bv. 1 str. Rev.1] gi|256061835|ref|ZP_05451970.1| hypothetical protein Bneo5_15958 [Brucella neotomae 5K33] gi|256114376|ref|ZP_05455109.1| hypothetical protein Bmelb3E_16225 [Brucella melitensis bv. 3 str. Ether] gi|256160509|ref|ZP_05458198.1| hypothetical protein BcetM4_16024 [Brucella ceti M490/95/1] gi|256255715|ref|ZP_05461251.1| hypothetical protein BcetB_15853 [Brucella ceti B1/94] gi|256258220|ref|ZP_05463756.1| hypothetical protein Babob9C_12916 [Brucella abortus bv. 9 str. C68] gi|256263256|ref|ZP_05465788.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] gi|260168012|ref|ZP_05754823.1| hypothetical protein BruF5_06522 [Brucella sp. F5/99] gi|260547087|ref|ZP_05822825.1| conserved hypothetical protein [Brucella abortus NCTC 8038] gi|260565700|ref|ZP_05836183.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|260568883|ref|ZP_05839351.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|261757457|ref|ZP_06001166.1| conserved hypothetical protein [Brucella sp. F5/99] gi|17982125|gb|AAL51419.1| hypothetical cytosolic protein [Brucella melitensis bv. 1 str. 16M] gi|161336543|gb|ABX62848.1| protein of unknown function DUF1674 [Brucella canis ATCC 23365] gi|163676113|gb|ABY40223.1| Hypothetical protein, conserved [Brucella suis ATCC 23445] gi|189020461|gb|ACD73183.1| hypothetical protein BAbS19_I17010 [Brucella abortus S19] gi|225641621|gb|ACO01535.1| protein of unknown function DUF1674 [Brucella melitensis ATCC 23457] gi|260095452|gb|EEW79330.1| conserved hypothetical protein [Brucella abortus NCTC 8038] gi|260151073|gb|EEW86168.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|260154267|gb|EEW89349.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|261737441|gb|EEY25437.1| conserved hypothetical protein [Brucella sp. F5/99] gi|263093220|gb|EEZ17317.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] gi|326409815|gb|ADZ66880.1| conserved hypothetical protein [Brucella melitensis M28] gi|326539534|gb|ADZ87749.1| conserved hypothetical protein [Brucella melitensis M5-90] Length = 72 Score = 62.8 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K + L A+RAL+ + + A K KLP EIGGR G DP R+GDWE G +IDF Sbjct: 16 KRRFEDLPPAAQRALK-EAEARRAAEKAEKLPREIGGRGGKDPARYGDWEIKGRTIDF 72 >gi|21231577|ref|NP_637494.1| hypothetical protein XCC2134 [Xanthomonas campestris pv. campestris str. ATCC 33913] gi|21113264|gb|AAM41418.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] Length = 88 Score = 62.8 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 21/32 (65%), Positives = 24/32 (75%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + LP EIGGR G +PTR+GDWEKNG IDF Sbjct: 57 EKKPLPKEIGGRDGPEPTRYGDWEKNGRCIDF 88 >gi|66768301|ref|YP_243063.1| hypothetical protein XC_1979 [Xanthomonas campestris pv. campestris str. 8004] gi|66573633|gb|AAY49043.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris str. 8004] Length = 88 Score = 62.4 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 21/32 (65%), Positives = 24/32 (75%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + LP EIGGR G +PTR+GDWEKNG IDF Sbjct: 57 EKKPLPKEIGGRDGPEPTRYGDWEKNGRCIDF 88 >gi|166712289|ref|ZP_02243496.1| hypothetical protein Xoryp_12750 [Xanthomonas oryzae pv. oryzicola BLS256] Length = 142 Score = 62.4 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 20/32 (62%), Positives = 24/32 (75%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + LP EIGGR G +PTR+GDWEKNG +DF Sbjct: 111 EKKPLPKEIGGRDGPEPTRYGDWEKNGRCVDF 142 >gi|300024957|ref|YP_003757568.1| hypothetical protein Hden_3456 [Hyphomicrobium denitrificans ATCC 51888] gi|299526778|gb|ADJ25247.1| protein of unknown function DUF1674 [Hyphomicrobium denitrificans ATCC 51888] Length = 73 Score = 62.0 bits (149), Expect = 2e-08, Method: Composition-based stats. Identities = 27/55 (49%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Query: 21 HDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 PL+ A+RAL EA+ R+ + P E+GGR G +PTRFGDWE GI+ DF Sbjct: 20 PRPLTPEAQRALAEAEARRQ-QAANQTRPPEVGGRSGPEPTRFGDWETGGIASDF 73 >gi|328541768|ref|YP_004301877.1| hypothetical protein SL003B_0144 [polymorphum gilvum SL003B-26A1] gi|326411520|gb|ADZ68583.1| hypothetical protein SL003B_0144 [Polymorphum gilvum SL003B-26A1] Length = 82 Score = 62.0 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 25/62 (40%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Query: 15 STIKTSHDPLSSIAKRALEEAKQRKS-ANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISI 73 + + L A+RAL+EA+ R+ + + LP EI GR GL+PTR+ DWE G++ Sbjct: 21 PAPRRRFEDLPPAAQRALKEAEARRKEIDERQKVLPREIDGRGGLEPTRYEDWEIKGLTA 80 Query: 74 DF 75 DF Sbjct: 81 DF 82 >gi|21108299|gb|AAM36931.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] Length = 88 Score = 61.6 bits (148), Expect = 3e-08, Method: Composition-based stats. Identities = 21/32 (65%), Positives = 24/32 (75%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + LP EIGGR G +PTR+GDWEKNG IDF Sbjct: 57 EKKPLPKEIGGRDGPEPTRYGDWEKNGRCIDF 88 >gi|99079929|ref|YP_612083.1| hypothetical protein TM1040_0088 [Ruegeria sp. TM1040] gi|99036209|gb|ABF62821.1| protein of unknown function DUF1674 [Ruegeria sp. TM1040] Length = 64 Score = 61.6 bits (148), Expect = 3e-08, Method: Composition-based stats. Identities = 30/64 (46%), Positives = 43/64 (67%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 M+++ L + A+RAL EA++R+ A + + LP E+GGR G DP R+GDWEK GI Sbjct: 1 MSDTPESNRAKDLPAAAQRALAEAEERRKARDAEKPLPTELGGRDGPDPARYGDWEKKGI 60 Query: 72 SIDF 75 +IDF Sbjct: 61 AIDF 64 >gi|188576490|ref|YP_001913419.1| hypothetical protein PXO_00605 [Xanthomonas oryzae pv. oryzae PXO99A] gi|188520942|gb|ACD58887.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae PXO99A] Length = 88 Score = 60.9 bits (146), Expect = 6e-08, Method: Composition-based stats. Identities = 21/32 (65%), Positives = 24/32 (75%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + LP EIGGR G +PTR+GDWEKNG IDF Sbjct: 57 EKKPLPKEIGGRDGPEPTRYGDWEKNGRCIDF 88 >gi|110635744|ref|YP_675952.1| hypothetical protein Meso_3416 [Mesorhizobium sp. BNC1] gi|110286728|gb|ABG64787.1| protein of unknown function DUF1674 [Chelativorans sp. BNC1] Length = 70 Score = 60.9 bits (146), Expect = 6e-08, Method: Composition-based stats. Identities = 30/61 (49%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Query: 16 TIKTSHDPLSSIAKRALEEAKQRKSA-NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISID 74 + LS AKRALEEA+ R+ + A P EIGGR G DP R+GDWE GI+ D Sbjct: 10 PSRRDPATLSPAAKRALEEAEDRRKRRAAQQADAPREIGGRDGPDPARYGDWEVKGIATD 69 Query: 75 F 75 F Sbjct: 70 F 70 >gi|188991440|ref|YP_001903450.1| hypothetical protein xccb100_2045 [Xanthomonas campestris pv. campestris str. B100] gi|167733200|emb|CAP51398.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris] Length = 79 Score = 60.9 bits (146), Expect = 6e-08, Method: Composition-based stats. Identities = 21/32 (65%), Positives = 24/32 (75%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + LP EIGGR G +PTR+GDWEKNG IDF Sbjct: 48 EKKPLPKEIGGRDGPEPTRYGDWEKNGRCIDF 79 >gi|39933111|ref|NP_945387.1| hypothetical protein RPA0031 [Rhodopseudomonas palustris CGA009] gi|39652736|emb|CAE25475.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009] Length = 72 Score = 60.5 bits (145), Expect = 8e-08, Method: Composition-based stats. Identities = 26/58 (44%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Query: 19 TSHDPLSSIAKRALEEAKQRKSANNKDAKL-PIEIGGRKGLDPTRFGDWEKNGISIDF 75 + L AKRAL EA+ R+ K A+ E+ G KG +PTR+GDWE GI+ DF Sbjct: 15 SPRKDLPEAAKRALAEAEARRVEAAKHAEARAKEVQGPKGPEPTRYGDWEVKGIASDF 72 >gi|288957513|ref|YP_003447854.1| hypothetical protein AZL_006720 [Azospirillum sp. B510] gi|288909821|dbj|BAI71310.1| hypothetical protein AZL_006720 [Azospirillum sp. B510] Length = 81 Score = 60.5 bits (145), Expect = 8e-08, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 31/64 (48%), Gaps = 4/64 (6%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 M K D ++A + EA + K K P EIGG KG +PTR+GDWE G Sbjct: 22 MMTEPTKPQQDAAEAVADTTITEAAEPKGPEQK----PGEIGGPKGPEPTRYGDWEFKGR 77 Query: 72 SIDF 75 DF Sbjct: 78 CSDF 81 >gi|195034843|ref|XP_001988987.1| GH10282 [Drosophila grimshawi] gi|193904987|gb|EDW03854.1| GH10282 [Drosophila grimshawi] Length = 119 Score = 60.5 bits (145), Expect = 8e-08, Method: Composition-based stats. Identities = 22/74 (29%), Positives = 32/74 (43%) Query: 2 RTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPT 61 +T + KT L ++ +E + K N+ EIGG G +PT Sbjct: 46 KTPSEKLMAFQKKLRAKTPLGKLDEFSRHPYQETEPLKPWPNQTNPYTGEIGGPAGPEPT 105 Query: 62 RFGDWEKNGISIDF 75 R+GDWE+ G DF Sbjct: 106 RYGDWERKGRVSDF 119 >gi|149203490|ref|ZP_01880460.1| hypothetical protein RTM1035_02695 [Roseovarius sp. TM1035] gi|149143323|gb|EDM31362.1| hypothetical protein RTM1035_02695 [Roseovarius sp. TM1035] Length = 63 Score = 60.5 bits (145), Expect = 8e-08, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 36/64 (56%), Gaps = 2/64 (3%) Query: 13 NNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGR-KGLDPTRFGDWEKNGI 71 +T L A+RAL + + + LP E+GGR +GL+P R+GDWEK G+ Sbjct: 1 MTDDTQTPSRDLPPAAQRALA-EAEARRKAAEALDLPRELGGRREGLEPVRYGDWEKKGL 59 Query: 72 SIDF 75 +IDF Sbjct: 60 AIDF 63 >gi|259417089|ref|ZP_05741008.1| conserved domain protein [Silicibacter sp. TrichCH4B] gi|259345995|gb|EEW57809.1| conserved domain protein [Silicibacter sp. TrichCH4B] Length = 64 Score = 60.1 bits (144), Expect = 9e-08, Method: Composition-based stats. Identities = 29/64 (45%), Positives = 40/64 (62%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 M+++ L + A+RAL EA++R+ A P E+GGR G DP R+GDWEK GI Sbjct: 1 MSDAPESQRAKDLPAAAQRALAEAEERRKAREAQHPQPTELGGRDGPDPARYGDWEKKGI 60 Query: 72 SIDF 75 +IDF Sbjct: 61 AIDF 64 >gi|153008425|ref|YP_001369640.1| hypothetical protein Oant_1091 [Ochrobactrum anthropi ATCC 49188] gi|151560313|gb|ABS13811.1| protein of unknown function DUF1674 [Ochrobactrum anthropi ATCC 49188] Length = 69 Score = 60.1 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 1/58 (1%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K + + L A+RAL+E + + A K + P EIGGR G DP RFGDWE G SIDF Sbjct: 13 KRTFEDLPPAAQRALKE-AEARRAAEKANEAPREIGGRGGKDPARFGDWEIKGRSIDF 69 >gi|192288465|ref|YP_001989070.1| hypothetical protein Rpal_0032 [Rhodopseudomonas palustris TIE-1] gi|192282214|gb|ACE98594.1| protein of unknown function DUF1674 [Rhodopseudomonas palustris TIE-1] Length = 72 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 26/58 (44%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Query: 19 TSHDPLSSIAKRALEEAKQRKSANNKDAKL-PIEIGGRKGLDPTRFGDWEKNGISIDF 75 L AKRAL EA+ R+ K A+ E+ G KG +PTR+GDWE GI+ DF Sbjct: 15 PPRKDLPEAAKRALAEAEARRVEAAKHAEARAKEVQGPKGPEPTRYGDWEVKGIASDF 72 >gi|84515083|ref|ZP_01002446.1| hypothetical protein SKA53_12703 [Loktanella vestfoldensis SKA53] gi|84511242|gb|EAQ07696.1| hypothetical protein SKA53_12703 [Loktanella vestfoldensis SKA53] Length = 81 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 20/30 (66%), Positives = 23/30 (76%) Query: 46 AKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LP E+GGR G +P RFGDWEK GI+IDF Sbjct: 52 LDLPPELGGRDGPEPVRFGDWEKKGIAIDF 81 >gi|242010996|ref|XP_002426243.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212510306|gb|EEB13505.1| conserved hypothetical protein [Pediculus humanus corporis] Length = 106 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 13/75 (17%) Query: 13 NNSTIKTSHDPLSSIAK--RALEEAKQRKSANNKDAKLPI----------EIGGRKGLDP 60 N +T L A+ R L+E ++ K + L E G KG++P Sbjct: 33 NANTSCPGEK-LQRAAQKLRKLDELEEGKHPYQEKEPLKPFPNGINPVTGERNGPKGVEP 91 Query: 61 TRFGDWEKNGISIDF 75 TR+GDWE+ G DF Sbjct: 92 TRYGDWERKGRVSDF 106 >gi|158426297|ref|YP_001527589.1| hypothetical protein AZC_4673 [Azorhizobium caulinodans ORS 571] gi|158333186|dbj|BAF90671.1| protein of unknown function [Azorhizobium caulinodans ORS 571] Length = 67 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 29/63 (46%), Positives = 37/63 (58%) Query: 13 NNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 T LS A+RAL EA+ R++A + A LP EI GR G +P R+GDWE GI+ Sbjct: 5 ETPTPTAPRKDLSPAAQRALAEAEARRAAIDAAANLPKEINGRGGKEPVRYGDWEVGGIA 64 Query: 73 IDF 75 DF Sbjct: 65 SDF 67 >gi|260432195|ref|ZP_05786166.1| conserved domain protein [Silicibacter lacuscaerulensis ITI-1157] gi|260416023|gb|EEX09282.1| conserved domain protein [Silicibacter lacuscaerulensis ITI-1157] Length = 86 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 21/36 (58%), Positives = 25/36 (69%) Query: 40 SANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 A + LP E+GGR G DP R+GDWEK GI+IDF Sbjct: 51 KAEAEAKPLPKELGGRDGPDPARYGDWEKKGIAIDF 86 >gi|27375689|ref|NP_767218.1| hypothetical protein bsl0578 [Bradyrhizobium japonicum USDA 110] gi|27348827|dbj|BAC45843.1| bsl0578 [Bradyrhizobium japonicum USDA 110] Length = 69 Score = 59.3 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 28/69 (40%), Positives = 40/69 (57%), Gaps = 5/69 (7%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSA-----NNKDAKLPIEIGGRKGLDPTRFGDW 66 M++ + PLS A+RAL EA+ R+ A + P E+ G KG +PTR+GDW Sbjct: 1 MSDQPPVSDRKPLSPAAQRALAEAEARRQAAAIQAEDDAKATPKELQGPKGPEPTRYGDW 60 Query: 67 EKNGISIDF 75 E+ GI+ DF Sbjct: 61 ERKGIASDF 69 >gi|159045574|ref|YP_001534368.1| hypothetical protein Dshi_3034 [Dinoroseobacter shibae DFL 12] gi|157913334|gb|ABV94767.1| protein of unknown function DUF1674 [Dinoroseobacter shibae DFL 12] Length = 74 Score = 58.9 bits (141), Expect = 2e-07, Method: Composition-based stats. Identities = 29/56 (51%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Query: 20 SHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L A+RAL EA RK A K + P E+GGR G +P R+GDWEK GI+IDF Sbjct: 20 RRAALPEPARRALAEADARK-AKEKAREFPPELGGRNGPEPVRYGDWEKKGIAIDF 74 >gi|182679036|ref|YP_001833182.1| hypothetical protein Bind_2072 [Beijerinckia indica subsp. indica ATCC 9039] gi|182634919|gb|ACB95693.1| protein of unknown function DUF1674 [Beijerinckia indica subsp. indica ATCC 9039] Length = 75 Score = 58.2 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 27/74 (36%), Positives = 37/74 (50%), Gaps = 9/74 (12%) Query: 11 LMNNSTIKTSHDPLSSIAKRALEEAK---------QRKSANNKDAKLPIEIGGRKGLDPT 61 + S+ P + A + L EA +RK + + LP EI GR G +P Sbjct: 2 TSDKQPPSESNQPADAAAAKPLSEAAKRALAEAAERRKLHDAQHNTLPKEINGRDGPEPV 61 Query: 62 RFGDWEKNGISIDF 75 R+GDWEKNGI+ DF Sbjct: 62 RYGDWEKNGIASDF 75 >gi|195114196|ref|XP_002001653.1| GI15767 [Drosophila mojavensis] gi|193912228|gb|EDW11095.1| GI15767 [Drosophila mojavensis] Length = 118 Score = 58.2 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 22/74 (29%), Positives = 31/74 (41%) Query: 2 RTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPT 61 +T KT L ++ +E + K N+ EIGG G +PT Sbjct: 45 KTTSEKFIAFQKKLRAKTPLGKLDEFSRHPYQEKEPLKPWPNQTNPYTGEIGGPAGPEPT 104 Query: 62 RFGDWEKNGISIDF 75 R+GDWE+ G DF Sbjct: 105 RYGDWERKGRVSDF 118 >gi|289740649|gb|ADD19072.1| uncharacterized conserved protein [Glossina morsitans morsitans] Length = 110 Score = 57.8 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 18/74 (24%), Positives = 29/74 (39%) Query: 2 RTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPT 61 + K ++++ +E + + N EIGG G +PT Sbjct: 37 KAKSTRFIEFQKKLREKAPFASFVELSRQPFQEIEALRPWPNNTNPYTGEIGGPSGPEPT 96 Query: 62 RFGDWEKNGISIDF 75 R+GDWE+ G DF Sbjct: 97 RYGDWERKGRVSDF 110 >gi|86747214|ref|YP_483710.1| hypothetical protein RPB_0087 [Rhodopseudomonas palustris HaA2] gi|86570242|gb|ABD04799.1| Protein of unknown function DUF1674 [Rhodopseudomonas palustris HaA2] Length = 73 Score = 57.8 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 26/62 (41%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Query: 15 STIKTSHDPLSSIAKRALEEAKQRK-SANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISI 73 + + L AKRAL EA R+ A A E G KG +PTR+GDWE GI+ Sbjct: 12 APTEPPRRELPDAAKRALAEADARRVEAAQHAAARAKEYQGPKGPEPTRYGDWEVKGIAS 71 Query: 74 DF 75 DF Sbjct: 72 DF 73 >gi|195148623|ref|XP_002015267.1| GL19610 [Drosophila persimilis] gi|194107220|gb|EDW29263.1| GL19610 [Drosophila persimilis] Length = 118 Score = 57.8 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 21/74 (28%), Positives = 32/74 (43%) Query: 2 RTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPT 61 +T + KT L ++ +E + K N+ E+GG G +PT Sbjct: 45 KTRTEKLMAFQKKLRAKTPLGKLDEFSRHPYQEKEPLKQWPNQTNPYTGEVGGPAGPEPT 104 Query: 62 RFGDWEKNGISIDF 75 R+GDWE+ G DF Sbjct: 105 RYGDWERKGRVSDF 118 >gi|262277841|ref|ZP_06055634.1| conserved hypothetical protein [alpha proteobacterium HIMB114] gi|262224944|gb|EEY75403.1| conserved hypothetical protein [alpha proteobacterium HIMB114] Length = 100 Score = 57.8 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 25/65 (38%), Positives = 32/65 (49%), Gaps = 3/65 (4%) Query: 14 NSTIKTSHDPLS--SIAKRALEEAKQR-KSANNKDAKLPIEIGGRKGLDPTRFGDWEKNG 70 N TI P+S AL E ++ K + E GG +G +PTR+GDWEK G Sbjct: 36 NETISKYPAPISKCDAQFNALLEQRESVTKEVTKLMQTQKEYGGPEGPEPTRYGDWEKKG 95 Query: 71 ISIDF 75 I DF Sbjct: 96 IVSDF 100 >gi|194759883|ref|XP_001962176.1| GF14571 [Drosophila ananassae] gi|190615873|gb|EDV31397.1| GF14571 [Drosophila ananassae] Length = 118 Score = 57.8 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 22/74 (29%), Positives = 32/74 (43%) Query: 2 RTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPT 61 +T + KT L ++ +E + K N+ EIGG G +PT Sbjct: 45 KTRSEKLMAFQKKLRAKTPLGKLDEFSRHPFQEKEPLKPWPNQTNPYTGEIGGPSGPEPT 104 Query: 62 RFGDWEKNGISIDF 75 R+GDWE+ G DF Sbjct: 105 RYGDWERKGRVSDF 118 >gi|125986221|ref|XP_001356874.1| GA20193 [Drosophila pseudoobscura pseudoobscura] gi|54645200|gb|EAL33940.1| GA20193 [Drosophila pseudoobscura pseudoobscura] Length = 118 Score = 57.8 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 21/74 (28%), Positives = 32/74 (43%) Query: 2 RTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPT 61 +T + KT L ++ +E + K N+ E+GG G +PT Sbjct: 45 KTRTEKLMAFQKKLRAKTPLGKLDEFSRHPYQEKEPLKQWPNQTNPYTGEVGGPAGPEPT 104 Query: 62 RFGDWEKNGISIDF 75 R+GDWE+ G DF Sbjct: 105 RYGDWERKGRVSDF 118 >gi|195433617|ref|XP_002064807.1| GK15130 [Drosophila willistoni] gi|194160892|gb|EDW75793.1| GK15130 [Drosophila willistoni] Length = 117 Score = 57.8 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 22/74 (29%), Positives = 31/74 (41%) Query: 2 RTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPT 61 +T KT L ++ +E + K N+ EIGG G +PT Sbjct: 44 KTKTEKFMAFQKKLRAKTPLGKLDEFSRHPYQEKEPLKPWPNQTNPYTGEIGGPSGPEPT 103 Query: 62 RFGDWEKNGISIDF 75 R+GDWE+ G DF Sbjct: 104 RYGDWERKGRVSDF 117 >gi|316931427|ref|YP_004106409.1| hypothetical protein Rpdx1_0032 [Rhodopseudomonas palustris DX-1] gi|315599141|gb|ADU41676.1| protein of unknown function DUF1674 [Rhodopseudomonas palustris DX-1] Length = 72 Score = 57.4 bits (137), Expect = 6e-07, Method: Composition-based stats. Identities = 25/58 (43%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Query: 19 TSHDPLSSIAKRALEEAKQRK-SANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L AKRAL EA+ R+ A E+ G KG +PTR+GDWE GI+ DF Sbjct: 15 PPRKDLPEAAKRALAEAEARRVEAARHAEARAKEVQGPKGPEPTRYGDWEVKGIASDF 72 >gi|66816745|ref|XP_642377.1| hypothetical protein DDB_G0278459 [Dictyostelium discoideum AX4] gi|74856601|sp|Q54Y25|U369_DICDI RecName: Full=UPF0369 protein gi|60470422|gb|EAL68402.1| hypothetical protein DDB_G0278459 [Dictyostelium discoideum AX4] Length = 108 Score = 57.0 bits (136), Expect = 8e-07, Method: Composition-based stats. Identities = 16/29 (55%), Positives = 20/29 (68%) Query: 47 KLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + EIGG KG +PTR+ DWE+NG DF Sbjct: 80 PITKEIGGPKGPEPTRYNDWERNGRVSDF 108 >gi|147807683|emb|CAN66554.1| hypothetical protein VITISV_018915 [Vitis vinifera] Length = 123 Score = 57.0 bits (136), Expect = 9e-07, Method: Composition-based stats. Identities = 17/25 (68%), Positives = 20/25 (80%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG KG +PTR+GDWE+NG DF Sbjct: 99 EIGGPKGPEPTRYGDWERNGRCSDF 123 >gi|195386268|ref|XP_002051826.1| GJ10242 [Drosophila virilis] gi|194148283|gb|EDW63981.1| GJ10242 [Drosophila virilis] Length = 112 Score = 57.0 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 22/74 (29%), Positives = 32/74 (43%) Query: 2 RTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPT 61 +T + KT L ++ +E + K N+ EIGG G +PT Sbjct: 39 KTPSEKLMAFQKKLRAKTPLGKLDEFSRHPYQEKEPLKPWPNQTNPYTGEIGGPAGPEPT 98 Query: 62 RFGDWEKNGISIDF 75 R+GDWE+ G DF Sbjct: 99 RYGDWERKGRVSDF 112 >gi|89067212|ref|ZP_01154725.1| hypothetical protein OG2516_10246 [Oceanicola granulosus HTCC2516] gi|89046781|gb|EAR52835.1| hypothetical protein OG2516_10246 [Oceanicola granulosus HTCC2516] Length = 57 Score = 56.6 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 18/32 (56%), Positives = 25/32 (78%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 +D LP E+GGR G +P R+GDWE+ GI++DF Sbjct: 26 QDTPLPTELGGRDGPEPVRYGDWERKGIAVDF 57 >gi|195472867|ref|XP_002088720.1| GE18724 [Drosophila yakuba] gi|33328841|gb|AAQ09827.1| CG7224 [Drosophila yakuba] gi|194174821|gb|EDW88432.1| GE18724 [Drosophila yakuba] Length = 120 Score = 56.6 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 22/74 (29%), Positives = 32/74 (43%) Query: 2 RTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPT 61 +T + KT L ++ +E + K N+ EIGG G +PT Sbjct: 47 KTRTEKLMAFQKKLRAKTPLGKLDEFSRHPYQEQEPLKPWPNQTNPYTGEIGGPAGPEPT 106 Query: 62 RFGDWEKNGISIDF 75 R+GDWE+ G DF Sbjct: 107 RYGDWERKGRVSDF 120 >gi|72016290|ref|XP_782052.1| PREDICTED: similar to MGC89089 protein [Strongylocentrotus purpuratus] gi|115976620|ref|XP_001178432.1| PREDICTED: similar to MGC89089 protein [Strongylocentrotus purpuratus] Length = 125 Score = 56.6 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Query: 16 TIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 T HD R E + K+ + E GG +G +PTR+GDWE+ G IDF Sbjct: 67 TPVGKHDDHMPEKHRD-AEKEALKAFPDDVNPETGEKGGPRGPEPTRYGDWERKGRCIDF 125 >gi|194862990|ref|XP_001970222.1| GG10505 [Drosophila erecta] gi|190662089|gb|EDV59281.1| GG10505 [Drosophila erecta] Length = 118 Score = 56.2 bits (134), Expect = 1e-06, Method: Composition-based stats. Identities = 22/74 (29%), Positives = 32/74 (43%) Query: 2 RTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPT 61 +T + KT L ++ +E + K N+ EIGG G +PT Sbjct: 45 KTRTEKLMAFQKKLRAKTPLGKLDEFSRHPYQEKEPLKPWPNQTNPYTGEIGGPAGPEPT 104 Query: 62 RFGDWEKNGISIDF 75 R+GDWE+ G DF Sbjct: 105 RYGDWERKGRVSDF 118 >gi|84500522|ref|ZP_00998771.1| hypothetical protein OB2597_11206 [Oceanicola batsensis HTCC2597] gi|84391475|gb|EAQ03807.1| hypothetical protein OB2597_11206 [Oceanicola batsensis HTCC2597] Length = 60 Score = 56.2 bits (134), Expect = 1e-06, Method: Composition-based stats. Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Query: 16 TIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + T L A+RA + + LP E+GGR G +P R+GDWEK GI++DF Sbjct: 2 SDDTVRKDLPPAAQRA-LAEAEERRRAAAAEALPPELGGRDGPEPVRYGDWEKKGIAVDF 60 >gi|225455088|ref|XP_002264465.1| PREDICTED: hypothetical protein [Vitis vinifera] Length = 123 Score = 56.2 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 17/25 (68%), Positives = 20/25 (80%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG KG +PTR+GDWE+NG DF Sbjct: 99 EIGGPKGPEPTRYGDWERNGRCSDF 123 >gi|195339051|ref|XP_002036135.1| GM16654 [Drosophila sechellia] gi|194130015|gb|EDW52058.1| GM16654 [Drosophila sechellia] Length = 118 Score = 56.2 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 22/74 (29%), Positives = 32/74 (43%) Query: 2 RTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPT 61 +T + KT L ++ +E + K N+ EIGG G +PT Sbjct: 45 KTRTEKLMAFQKKLRAKTPLGKLDEFSRHPYQEKEPLKPWPNQTNPYTGEIGGPAGPEPT 104 Query: 62 RFGDWEKNGISIDF 75 R+GDWE+ G DF Sbjct: 105 RYGDWERKGRVSDF 118 >gi|20129345|ref|NP_609170.1| CG7224, isoform A [Drosophila melanogaster] gi|10728653|gb|AAF52586.2| CG7224, isoform A [Drosophila melanogaster] gi|220897847|gb|ACL81239.1| TA01803p [Drosophila melanogaster] Length = 118 Score = 56.2 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 22/74 (29%), Positives = 32/74 (43%) Query: 2 RTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPT 61 +T + KT L ++ +E + K N+ EIGG G +PT Sbjct: 45 KTRTEKLMAFQKKLRAKTPLGKLDEFSRHPYQEKEPLKPWPNQTNPYTGEIGGPAGPEPT 104 Query: 62 RFGDWEKNGISIDF 75 R+GDWE+ G DF Sbjct: 105 RYGDWERKGRVSDF 118 >gi|281212459|gb|EFA86619.1| hypothetical protein PPL_00420 [Polysphondylium pallidum PN500] Length = 95 Score = 56.2 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 27/71 (38%), Positives = 35/71 (49%), Gaps = 6/71 (8%) Query: 11 LMNNSTIKTSHDPLSS---IAKRALEEAKQRKSA---NNKDAKLPIEIGGRKGLDPTRFG 64 + NN++ TS L KR L E + A + EIGG KG +PTRFG Sbjct: 25 VQNNNSGNTSQQDLEESMSEEKRRLMEELEELEAQYSKEHVNEKTGEIGGPKGPEPTRFG 84 Query: 65 DWEKNGISIDF 75 DWE+ G + DF Sbjct: 85 DWERKGRTSDF 95 >gi|195577425|ref|XP_002078571.1| GD23496 [Drosophila simulans] gi|194190580|gb|EDX04156.1| GD23496 [Drosophila simulans] Length = 118 Score = 56.2 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 22/74 (29%), Positives = 32/74 (43%) Query: 2 RTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPT 61 +T + KT L ++ +E + K N+ EIGG G +PT Sbjct: 45 KTRTEKLMAFQKKLRAKTPLGKLDEFSRHPYQEKEPLKPWPNQTNPYTGEIGGPAGPEPT 104 Query: 62 RFGDWEKNGISIDF 75 R+GDWE+ G DF Sbjct: 105 RYGDWERKGRVSDF 118 >gi|291396453|ref|XP_002714458.1| PREDICTED: Chromosome 6 open reading frame 57-like [Oryctolagus cuniculus] Length = 119 Score = 55.9 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 24/42 (57%) Query: 34 EAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 E + K + + E GG +G +PTR+GDWE+ G IDF Sbjct: 78 EKEPLKKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF 119 >gi|304392690|ref|ZP_07374630.1| hypothetical protein R2A130_2290 [Ahrensia sp. R2A130] gi|303295320|gb|EFL89680.1| hypothetical protein R2A130_2290 [Ahrensia sp. R2A130] Length = 76 Score = 55.9 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 35/64 (54%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 MN+ +T A + E + + A K+ +L EI GRKG +PTR+GDWE GI Sbjct: 13 MNDDMNETEAKRDLPAAAKRALEEAEARRAAEKELELAREIDGRKGPEPTRYGDWENKGI 72 Query: 72 SIDF 75 + DF Sbjct: 73 TSDF 76 >gi|296198537|ref|XP_002746747.1| PREDICTED: UPF0369 protein C6orf57-like [Callithrix jacchus] Length = 101 Score = 55.9 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 24/42 (57%) Query: 34 EAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 E + + + + E GG +G +PTR+GDWE+ G IDF Sbjct: 60 EKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF 101 >gi|78047796|ref|YP_363971.1| hypothetical protein XCV2240 [Xanthomonas campestris pv. vesicatoria str. 85-10] gi|78036226|emb|CAJ23917.1| conserved hypothetical protein [Xanthomonas campestris pv. vesicatoria str. 85-10] Length = 56 Score = 55.9 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 21/32 (65%), Positives = 25/32 (78%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + +LP EIGGR G +PTR+GDWEKNG IDF Sbjct: 25 EKKQLPKEIGGRDGPEPTRYGDWEKNGRCIDF 56 >gi|194365312|ref|YP_002027922.1| hypothetical protein Smal_1534 [Stenotrophomonas maltophilia R551-3] gi|194348116|gb|ACF51239.1| protein of unknown function DUF1674 [Stenotrophomonas maltophilia R551-3] Length = 56 Score = 55.9 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 26/68 (38%), Positives = 31/68 (45%), Gaps = 12/68 (17%) Query: 8 IRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWE 67 + G + S PL A +E+ K E GGR GLDP R+GDWE Sbjct: 1 MIGQTTPTPDDESEAPLVPAAPVPVEQEKA------------EEFGGRGGLDPVRYGDWE 48 Query: 68 KNGISIDF 75 KNG IDF Sbjct: 49 KNGRCIDF 56 >gi|89056530|ref|YP_511981.1| hypothetical protein Jann_4039 [Jannaschia sp. CCS1] gi|88866079|gb|ABD56956.1| protein of unknown function DUF1674 [Jannaschia sp. CCS1] Length = 57 Score = 55.9 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 26/34 (76%) Query: 42 NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K ++PIE+GGR G +P R+GDWE+ GI++DF Sbjct: 24 KAKAQEMPIELGGRDGPEPVRYGDWERKGIAVDF 57 >gi|154245750|ref|YP_001416708.1| hypothetical protein Xaut_1806 [Xanthobacter autotrophicus Py2] gi|154159835|gb|ABS67051.1| protein of unknown function DUF1674 [Xanthobacter autotrophicus Py2] Length = 65 Score = 55.9 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 29/65 (44%), Positives = 38/65 (58%), Gaps = 1/65 (1%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKS-ANNKDAKLPIEIGGRKGLDPTRFGDWEKNG 70 M++ T PLS AKRAL EA+ R++ + P EI GR G +P R+GDWE G Sbjct: 1 MSDETPAPPRKPLSEAAKRALAEAEARRAAIDAATKARPKEINGRDGPEPVRYGDWEVGG 60 Query: 71 ISIDF 75 I+ DF Sbjct: 61 IASDF 65 >gi|256081856|ref|XP_002577183.1| hypothetical protein [Schistosoma mansoni] gi|238662480|emb|CAZ33420.1| conserved hypothetical protein [Schistosoma mansoni] Length = 104 Score = 55.5 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 15/25 (60%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG G +PTR+GDWE+ G IDF Sbjct: 80 ERGGPCGPEPTRYGDWERKGRCIDF 104 >gi|56118809|ref|NP_001008179.1| chromosome 6 open reading frame 57 [Xenopus (Silurana) tropicalis] gi|51950109|gb|AAH82498.1| MGC89089 protein [Xenopus (Silurana) tropicalis] gi|89267210|emb|CAJ81416.1| novel protein [Xenopus (Silurana) tropicalis] gi|89272858|emb|CAJ82144.1| novel protein [Xenopus (Silurana) tropicalis] Length = 118 Score = 55.1 bits (131), Expect = 3e-06, Method: Composition-based stats. Identities = 15/29 (51%), Positives = 20/29 (68%) Query: 47 KLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + E GG +G +PTR+GDWE+ G IDF Sbjct: 90 PVTKEKGGPRGPEPTRYGDWERKGRCIDF 118 >gi|126736248|ref|ZP_01751991.1| hypothetical protein RCCS2_10935 [Roseobacter sp. CCS2] gi|126714414|gb|EBA11282.1| hypothetical protein RCCS2_10935 [Roseobacter sp. CCS2] Length = 58 Score = 55.1 bits (131), Expect = 3e-06, Method: Composition-based stats. Identities = 18/37 (48%), Positives = 24/37 (64%) Query: 39 KSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + LP E+GGR G +P R+GDWEK G++IDF Sbjct: 22 RRKKADAQTLPPELGGRDGPEPVRYGDWEKKGLAIDF 58 >gi|326931669|ref|XP_003211949.1| PREDICTED: hypothetical protein LOC100551388 [Meleagris gallopavo] Length = 252 Score = 55.1 bits (131), Expect = 3e-06, Method: Composition-based stats. Identities = 17/29 (58%), Positives = 19/29 (65%) Query: 47 KLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 E GG KG +PTRFGDWE+ G IDF Sbjct: 224 PATKERGGPKGPEPTRFGDWERKGRCIDF 252 >gi|149898776|gb|ABR27851.1| hypothetical protein [Triatoma infestans] Length = 102 Score = 55.1 bits (131), Expect = 3e-06, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Query: 18 KTSHDPLSS-IAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 KT D L + E + N EIGG KG++PTR+GDWE+ G DF Sbjct: 44 KTPIDKLDEIEGQHPFAEKEPLPEWENGVNPHTGEIGGPKGVEPTRYGDWERKGRVSDF 102 >gi|254476553|ref|ZP_05089939.1| conserved hypothetical protein [Ruegeria sp. R11] gi|214030796|gb|EEB71631.1| conserved hypothetical protein [Ruegeria sp. R11] Length = 64 Score = 55.1 bits (131), Expect = 3e-06, Method: Composition-based stats. Identities = 19/30 (63%), Positives = 22/30 (73%) Query: 46 AKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 P E+GGR G DP R+GDWEK GI+IDF Sbjct: 35 QSQPKELGGRDGPDPARYGDWEKKGIAIDF 64 >gi|218510861|ref|ZP_03508739.1| hypothetical protein RetlB5_27692 [Rhizobium etli Brasil 5] Length = 44 Score = 55.1 bits (131), Expect = 3e-06, Method: Composition-based stats. Identities = 24/45 (53%), Positives = 30/45 (66%), Gaps = 1/45 (2%) Query: 31 ALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 AL EA++R+ N K L EI GR G +P RFGD+E NG +IDF Sbjct: 1 ALAEAEERRK-NQKPLDLAPEISGRGGAEPARFGDYEINGRAIDF 44 >gi|312374460|gb|EFR22011.1| hypothetical protein AND_15877 [Anopheles darlingi] Length = 276 Score = 55.1 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 1/70 (1%) Query: 7 NIRGLMNNSTIKTSHDPLSSI-AKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGD 65 + KT L I K +E + ++ N EIGG +G +PTR+GD Sbjct: 207 RMEEFQKKLREKTPIGKLDEIVGKHPYQEKEPLQAWPNNTNPNTGEIGGPRGPEPTRYGD 266 Query: 66 WEKNGISIDF 75 WE+ G DF Sbjct: 267 WERKGRVTDF 276 >gi|281365006|ref|NP_652574.3| CG15283 [Drosophila melanogaster] gi|68051341|gb|AAY84934.1| IP09907p [Drosophila melanogaster] gi|272407041|gb|AAF53398.3| CG15283 [Drosophila melanogaster] Length = 126 Score = 55.1 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 28/58 (48%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + +PL A E + K N EIGG+ G +PTR+GDWE+ G DF Sbjct: 69 EAPLEPLPECAPHPAHEKEPLKPWPNNTNPYTGEIGGQAGPEPTRYGDWERKGRVTDF 126 >gi|197304917|pdb|2K5K|A Chain A, Solution Structure Of Rhr2 From Rhodobacter Sphaeroides. Northeast Structural Genomics Consortium Length = 70 Score = 54.7 bits (130), Expect = 4e-06, Method: Composition-based stats. Identities = 22/32 (68%), Positives = 24/32 (75%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K LP EIGGR G +P RFGDWEK GI+IDF Sbjct: 31 KALDLPKEIGGRNGPEPVRFGDWEKKGIAIDF 62 >gi|114326939|ref|YP_744096.1| putative cytoplasmic protein [Granulibacter bethesdensis CGDNIH1] gi|114315113|gb|ABI61173.1| hypothetical cytosolic protein [Granulibacter bethesdensis CGDNIH1] Length = 68 Score = 54.7 bits (130), Expect = 4e-06, Method: Composition-based stats. Identities = 21/35 (60%), Positives = 24/35 (68%) Query: 41 ANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 A D P+E GG KG +PTRFGDWE+NG IDF Sbjct: 34 ATIADTAQPVEHGGPKGPEPTRFGDWERNGRCIDF 68 >gi|126738335|ref|ZP_01754056.1| hypothetical protein RSK20926_07362 [Roseobacter sp. SK209-2-6] gi|126720832|gb|EBA17537.1| hypothetical protein RSK20926_07362 [Roseobacter sp. SK209-2-6] Length = 102 Score = 54.7 bits (130), Expect = 4e-06, Method: Composition-based stats. Identities = 32/64 (50%), Positives = 38/64 (59%), Gaps = 1/64 (1%) Query: 13 NNSTIKTSHDP-LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 N ++ DP L A+RAL EA R+ A P E GGR GLDP R+GDWEK GI Sbjct: 39 NAASESPEIDPSLPPAAQRALAEAAARRKEAQTKAPPPTEYGGRDGLDPARYGDWEKKGI 98 Query: 72 SIDF 75 +IDF Sbjct: 99 AIDF 102 >gi|77464686|ref|YP_354190.1| hypothetical protein RSP_1104 [Rhodobacter sphaeroides 2.4.1] gi|77389104|gb|ABA80289.1| hypothetical protein RSP_1104 [Rhodobacter sphaeroides 2.4.1] Length = 62 Score = 54.7 bits (130), Expect = 4e-06, Method: Composition-based stats. Identities = 22/32 (68%), Positives = 24/32 (75%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K LP EIGGR G +P RFGDWEK GI+IDF Sbjct: 31 KALDLPKEIGGRNGPEPVRFGDWEKKGIAIDF 62 >gi|126310363|ref|XP_001373171.1| PREDICTED: hypothetical protein [Monodelphis domestica] Length = 96 Score = 54.3 bits (129), Expect = 5e-06, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 24/42 (57%) Query: 34 EAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 E + + + L E GG KG +PTR+GDWE+ G +DF Sbjct: 55 EQEPLEKFPDDVNPLTKEKGGPKGPEPTRYGDWERKGRCVDF 96 >gi|114797835|ref|YP_762039.1| hypothetical protein HNE_3366 [Hyphomonas neptunium ATCC 15444] gi|114738009|gb|ABI76134.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444] Length = 69 Score = 54.3 bits (129), Expect = 5e-06, Method: Composition-based stats. Identities = 27/64 (42%), Positives = 37/64 (57%), Gaps = 2/64 (3%) Query: 14 NSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPI--EIGGRKGLDPTRFGDWEKNGI 71 + L A+RALEEA+ RK+ + DA E GG K ++PTR+GDWE+ GI Sbjct: 6 SEEETARRAALPETARRALEEAEARKAKDAADAAALPKDEFGGPKSIEPTRYGDWERKGI 65 Query: 72 SIDF 75 + DF Sbjct: 66 AYDF 69 >gi|255631818|gb|ACU16276.1| unknown [Glycine max] Length = 106 Score = 54.3 bits (129), Expect = 5e-06, Method: Composition-based stats. Identities = 28/78 (35%), Positives = 38/78 (48%), Gaps = 11/78 (14%) Query: 9 RGLMNNSTIKTSHDPLSSIAKRALEEA-----KQRKSANNKD------AKLPIEIGGRKG 57 R L ++ST +P+ + +E+ KQR D K EIGG KG Sbjct: 29 RLLCSSSTQPQHENPVREQTQTPPQESLHDENKQRYEPKEDDGDGDSINKETGEIGGPKG 88 Query: 58 LDPTRFGDWEKNGISIDF 75 +PTR+GDWE+NG DF Sbjct: 89 PEPTRYGDWERNGRCSDF 106 >gi|170037305|ref|XP_001846499.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167880408|gb|EDS43791.1| conserved hypothetical protein [Culex quinquefasciatus] Length = 112 Score = 54.3 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 22/75 (29%), Positives = 32/75 (42%), Gaps = 1/75 (1%) Query: 2 RTVQINIRGLMNNSTIKTSHDPLSSI-AKRALEEAKQRKSANNKDAKLPIEIGGRKGLDP 60 +T + KT L I K +E + + N E+GG +G +P Sbjct: 38 KTPSPRMEEFQKKLREKTPIGKLDEIVGKHPYQEKEPLPAWPNNTNPNTGEVGGPRGPEP 97 Query: 61 TRFGDWEKNGISIDF 75 TR+GDWE+ G DF Sbjct: 98 TRYGDWERKGRVSDF 112 >gi|240848943|ref|NP_001155523.1| hypothetical protein LOC100162201 [Acyrthosiphon pisum] gi|239791966|dbj|BAH72380.1| ACYPI003366 [Acyrthosiphon pisum] Length = 102 Score = 54.3 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 20/72 (27%), Positives = 29/72 (40%), Gaps = 1/72 (1%) Query: 4 VQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRF 63 + +++ + T D L K +E K E G KG +PTR+ Sbjct: 32 SKEDLKEKIKMKTPIGKLDEL-EAGKHPFQEKDPLKEWPEGRNPATGERNGPKGPEPTRY 90 Query: 64 GDWEKNGISIDF 75 GDWE+ G DF Sbjct: 91 GDWERKGRVTDF 102 >gi|297794225|ref|XP_002864997.1| hypothetical protein ARALYDRAFT_919953 [Arabidopsis lyrata subsp. lyrata] gi|297310832|gb|EFH41256.1| hypothetical protein ARALYDRAFT_919953 [Arabidopsis lyrata subsp. lyrata] Length = 108 Score = 54.3 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +G +PTR+GDWE+ G DF Sbjct: 84 EIGGPRGPEPTRYGDWEQRGRCSDF 108 >gi|312113707|ref|YP_004011303.1| hypothetical protein Rvan_0928 [Rhodomicrobium vannielii ATCC 17100] gi|311218836|gb|ADP70204.1| protein of unknown function DUF1674 [Rhodomicrobium vannielii ATCC 17100] Length = 70 Score = 53.9 bits (128), Expect = 7e-06, Method: Composition-based stats. Identities = 30/55 (54%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Query: 21 HDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 AKRAL EA R+ A + + P EIG RKGL+PTRFGDWEK GI+ DF Sbjct: 17 ERRRKEAAKRALAEADARRLAAGEP-ERPREIGARKGLEPTRFGDWEKKGIASDF 70 >gi|328766712|gb|EGF76765.1| hypothetical protein BATDEDRAFT_92333 [Batrachochytrium dendrobatidis JAM81] Length = 123 Score = 53.9 bits (128), Expect = 7e-06, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 17/59 (28%) Query: 34 EAKQR-------KSANNKDAKLPI----------EIGGRKGLDPTRFGDWEKNGISIDF 75 EA+ R K + + LP E+GG KG++PTR+GDWE+ G DF Sbjct: 65 EAETRSRLNTDEKHPDAERHPLPRFPNNCNPVTGEVGGPKGVEPTRYGDWERKGRVFDF 123 >gi|312072639|ref|XP_003139156.1| hypothetical protein LOAG_03571 [Loa loa] gi|307765672|gb|EFO24906.1| hypothetical protein LOAG_03571 [Loa loa] Length = 99 Score = 53.9 bits (128), Expect = 7e-06, Method: Composition-based stats. Identities = 17/25 (68%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG G +PTRFGDWE+ G IDF Sbjct: 75 EIGGPAGPEPTRFGDWERKGRCIDF 99 >gi|149632421|ref|XP_001510539.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus] Length = 278 Score = 53.9 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 15/29 (51%), Positives = 20/29 (68%) Query: 47 KLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + E GG KG +PTR+GDWE+ G +DF Sbjct: 250 PITKEKGGPKGPEPTRYGDWERKGRCVDF 278 >gi|195474031|ref|XP_002089295.1| GE24984 [Drosophila yakuba] gi|194175396|gb|EDW89007.1| GE24984 [Drosophila yakuba] Length = 126 Score = 53.5 bits (127), Expect = 8e-06, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 28/58 (48%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + +PL A E + K N EIGG+ G +PTR+GDWE+ G DF Sbjct: 69 EAPLEPLPECAPHPAHEKEPLKPWPNNTNPYTGEIGGQAGPEPTRYGDWERKGRVTDF 126 >gi|83855203|ref|ZP_00948733.1| hypothetical protein NAS141_10746 [Sulfitobacter sp. NAS-14.1] gi|83941725|ref|ZP_00954187.1| hypothetical protein EE36_05813 [Sulfitobacter sp. EE-36] gi|83843046|gb|EAP82213.1| hypothetical protein NAS141_10746 [Sulfitobacter sp. NAS-14.1] gi|83847545|gb|EAP85420.1| hypothetical protein EE36_05813 [Sulfitobacter sp. EE-36] Length = 91 Score = 53.5 bits (127), Expect = 8e-06, Method: Composition-based stats. Identities = 18/32 (56%), Positives = 24/32 (75%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + LP E+GGR G +P R+GDWEK GI++DF Sbjct: 60 QALDLPTELGGRDGPEPVRYGDWEKKGIAVDF 91 >gi|170590169|ref|XP_001899845.1| CG7224 [Brugia malayi] gi|158592764|gb|EDP31361.1| CG7224, putative [Brugia malayi] Length = 99 Score = 53.5 bits (127), Expect = 9e-06, Method: Composition-based stats. Identities = 17/25 (68%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG G +PTRFGDWE+ G IDF Sbjct: 75 EIGGPAGPEPTRFGDWERKGRCIDF 99 >gi|197106964|ref|YP_002132341.1| hypothetical protein PHZ_c3503 [Phenylobacterium zucineum HLK1] gi|196480384|gb|ACG79912.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1] Length = 67 Score = 53.5 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 1/68 (1%) Query: 8 IRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWE 67 ++ + LS A+RALEEA+ R+ A + + P E GG +G +PTRFGDWE Sbjct: 1 MQAMDETLPNAAPGKALSPAARRALEEAEARRKAAAEAERAP-EQGGPRGPEPTRFGDWE 59 Query: 68 KNGISIDF 75 + GI++DF Sbjct: 60 RKGIAVDF 67 >gi|116788769|gb|ABK24993.1| unknown [Picea sitchensis] Length = 129 Score = 53.5 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/25 (60%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWEK G DF Sbjct: 105 ERGGPRGPEPTRYGDWEKGGRCSDF 129 >gi|47192873|emb|CAG13725.1| unnamed protein product [Tetraodon nigroviridis] Length = 101 Score = 53.5 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 20/29 (68%) Query: 47 KLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + E GG +G +PTR+GDWE+ G +DF Sbjct: 73 PVTKEKGGPRGPEPTRYGDWERKGRCVDF 101 >gi|158296673|ref|XP_317025.4| AGAP008422-PA [Anopheles gambiae str. PEST] gi|157014824|gb|EAA12431.5| AGAP008422-PA [Anopheles gambiae str. PEST] Length = 111 Score = 53.5 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 18/43 (41%), Positives = 24/43 (55%) Query: 33 EEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 +E + + N EIGG KG +PTR+GDWE+ G DF Sbjct: 69 QEKEPLEPWPNNTNPNTGEIGGPKGPEPTRYGDWERKGRVTDF 111 >gi|153870732|ref|ZP_02000071.1| shikimate 5-dehydrogenase [Beggiatoa sp. PS] gi|152072801|gb|EDN69928.1| shikimate 5-dehydrogenase [Beggiatoa sp. PS] Length = 328 Score = 53.2 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +G + TR+GDWE+ G IDF Sbjct: 304 EIGGPQGQEHTRYGDWERKGRCIDF 328 >gi|209883489|ref|YP_002287346.1| hypothetical protein OCAR_4334 [Oligotropha carboxidovorans OM5] gi|209871685|gb|ACI91481.1| conserved domain protein [Oligotropha carboxidovorans OM5] Length = 70 Score = 53.2 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 27/63 (42%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Query: 14 NSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKL-PIEIGGRKGLDPTRFGDWEKNGIS 72 + + PL A+RAL EA+ R++A A P E+ G KG +PTR+GDWE GI+ Sbjct: 8 DKADAAARRPLPPAAQRALAEAEARRTAAQAQAVTAPKEVNGPKGPEPTRYGDWENKGIA 67 Query: 73 IDF 75 DF Sbjct: 68 SDF 70 >gi|229577372|ref|NP_080779.2| hypothetical protein LOC68002 precursor [Mus musculus] gi|109820099|sp|Q8BTE0|CF057_MOUSE RecName: Full=UPF0369 protein C6orf57 homolog; Flags: Precursor gi|12835436|dbj|BAB23255.1| unnamed protein product [Mus musculus] gi|12841765|dbj|BAB25342.1| unnamed protein product [Mus musculus] gi|22137676|gb|AAH28981.1| RIKEN cDNA 1110058L19 gene [Mus musculus] Length = 104 Score = 52.8 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 18/44 (40%), Positives = 25/44 (56%) Query: 32 LEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 EE + + + + E GG KG +PTR+GDWE+ G IDF Sbjct: 61 PEEREPLQKFPDDVNPVTKEKGGPKGPEPTRYGDWERKGRCIDF 104 >gi|157135180|ref|XP_001656560.1| hypothetical protein AaeL_AAEL013256 [Aedes aegypti] gi|108870290|gb|EAT34515.1| conserved hypothetical protein [Aedes aegypti] Length = 111 Score = 52.8 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 24/43 (55%) Query: 33 EEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 +E + + N EIGG +G +PTR+GDWE+ G DF Sbjct: 69 QEKEPLEPWPNNTNPNTGEIGGPRGPEPTRYGDWERKGRVSDF 111 >gi|163744096|ref|ZP_02151462.1| hypothetical protein RG210_08094 [Phaeobacter gallaeciensis 2.10] gi|161382643|gb|EDQ07046.1| hypothetical protein RG210_08094 [Phaeobacter gallaeciensis 2.10] Length = 64 Score = 52.8 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 20/32 (62%), Positives = 25/32 (78%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + A P+E+GGR G DP R+GDWEK GI+IDF Sbjct: 33 EAANRPVELGGRDGPDPARYGDWEKKGIAIDF 64 >gi|12854311|dbj|BAB29991.1| unnamed protein product [Mus musculus] Length = 104 Score = 52.8 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 18/44 (40%), Positives = 25/44 (56%) Query: 32 LEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 EE + + + + E GG KG +PTR+GDWE+ G IDF Sbjct: 61 PEEREPLQKFPDDVNPVTKEKGGPKGPEPTRYGDWERKGRCIDF 104 >gi|254486787|ref|ZP_05099992.1| conserved hypothetical protein [Roseobacter sp. GAI101] gi|214043656|gb|EEB84294.1| conserved hypothetical protein [Roseobacter sp. GAI101] Length = 92 Score = 52.4 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 26/34 (76%) Query: 42 NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 ++ +LP E+GGR G +P R+GDWEK GI++DF Sbjct: 59 KAQELELPPELGGRDGPEPVRYGDWEKKGIAVDF 92 >gi|26325935|dbj|BAC25055.1| unnamed protein product [Mus musculus] Length = 103 Score = 52.4 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 18/44 (40%), Positives = 25/44 (56%) Query: 32 LEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 EE + + + + E GG KG +PTR+GDWE+ G IDF Sbjct: 60 PEEREPLQKFPDDVNPVTKEKGGPKGPEPTRYGDWERKGRCIDF 103 >gi|27754403|gb|AAO22650.1| unknown protein [Arabidopsis thaliana] Length = 108 Score = 52.4 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +G +PTR+GDWE+ G DF Sbjct: 84 EIGGPRGPEPTRYGDWEQRGRCSDF 108 >gi|148682459|gb|EDL14406.1| RIKEN cDNA 1110058L19 [Mus musculus] Length = 104 Score = 52.4 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Query: 32 LEEAKQRKSANNK----DAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LE++ + + K + E GG KG +PTR+GDWE+ G IDF Sbjct: 57 LEDSPEERDPLQKFPDDVNPVTKEKGGPKGPEPTRYGDWERKGRCIDF 104 >gi|260428493|ref|ZP_05782472.1| conserved domain protein [Citreicella sp. SE45] gi|260422985|gb|EEX16236.1| conserved domain protein [Citreicella sp. SE45] Length = 65 Score = 52.4 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 42 NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + P E GGR GLDP R+GDWEK G++IDF Sbjct: 32 AEAKSPTPKEYGGRDGLDPARYGDWEKKGLAIDF 65 >gi|242092042|ref|XP_002436511.1| hypothetical protein SORBIDRAFT_10g003960 [Sorghum bicolor] gi|241914734|gb|EER87878.1| hypothetical protein SORBIDRAFT_10g003960 [Sorghum bicolor] Length = 117 Score = 52.4 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 5/55 (9%) Query: 26 SIAKRALEEAKQRKSANNKD-----AKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + AK A +A+ K + D K EIGG +G +PTR+GDWE+ G DF Sbjct: 63 AEAKGADVDAEAGKEEDEDDGGVHVNKATGEIGGPRGPEPTRYGDWERGGRCSDF 117 >gi|310816802|ref|YP_003964766.1| hypothetical protein EIO_2378 [Ketogulonicigenium vulgare Y25] gi|308755537|gb|ADO43466.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25] Length = 59 Score = 52.4 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 25/34 (73%) Query: 42 NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + A + E+GGR GL+P R+GDWEK G++IDF Sbjct: 26 DEAAAAMAPELGGRDGLEPVRYGDWEKKGLAIDF 59 >gi|163739807|ref|ZP_02147214.1| bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase [Phaeobacter gallaeciensis BS107] gi|161386841|gb|EDQ11203.1| bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase [Phaeobacter gallaeciensis BS107] Length = 64 Score = 52.0 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 19/29 (65%), Positives = 23/29 (79%) Query: 47 KLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 P+E+GGR G DP R+GDWEK GI+IDF Sbjct: 36 NRPVELGGRDGPDPARYGDWEKKGIAIDF 64 >gi|319786899|ref|YP_004146374.1| hypothetical protein Psesu_1295 [Pseudoxanthomonas suwonensis 11-1] gi|317465411|gb|ADV27143.1| protein of unknown function DUF1674 [Pseudoxanthomonas suwonensis 11-1] Length = 56 Score = 52.0 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 24/34 (70%) Query: 42 NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + P EIGGR+G +PTR+GDWEKNG IDF Sbjct: 23 QDAGKPTPREIGGREGPEPTRYGDWEKNGRCIDF 56 >gi|292571761|gb|ADE29676.1| hypothetical protein rpr22_CDS159 [Rickettsia prowazekii Rp22] Length = 96 Score = 52.0 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%) Query: 42 NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 ++ EIGG KGL+PTR+GDW+ G DF Sbjct: 63 EEENLSKEKEIGGIKGLEPTRYGDWQHKGKVTDF 96 >gi|15604042|ref|NP_220557.1| hypothetical protein RP167 [Rickettsia prowazekii str. Madrid E] gi|6226336|sp|Q9ZDZ6|Y167_RICPR RecName: Full=UPF0369 protein RP167 gi|3860733|emb|CAA14634.1| unknown [Rickettsia prowazekii] Length = 78 Score = 52.0 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%) Query: 42 NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 ++ EIGG KGL+PTR+GDW+ G DF Sbjct: 45 EEENLSKEKEIGGIKGLEPTRYGDWQHKGKVTDF 78 >gi|86139372|ref|ZP_01057941.1| hypothetical protein MED193_13018 [Roseobacter sp. MED193] gi|85823875|gb|EAQ44081.1| hypothetical protein MED193_13018 [Roseobacter sp. MED193] Length = 70 Score = 52.0 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 6/70 (8%) Query: 12 MNNSTIKTSH------DPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGD 65 M++ T L A+RAL EA +R+ A + AK P+E+GGR GLDP R+GD Sbjct: 1 MSDETPGPKEAEPQINPDLPPAAQRALAEAAERRKAADAKAKPPVELGGRDGLDPARYGD 60 Query: 66 WEKNGISIDF 75 WEK GI+IDF Sbjct: 61 WEKKGIAIDF 70 >gi|307102856|gb|EFN51122.1| hypothetical protein CHLNCDRAFT_141306 [Chlorella variabilis] Length = 740 Score = 51.6 bits (122), Expect = 3e-05, Method: Composition-based stats. Identities = 22/53 (41%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Query: 23 PLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 P SS + A +EA A LP +IGG G +PTR+ DWE G DF Sbjct: 690 PASSADQPAGDEA--PSPAQELPLDLPRKIGGYAGPEPTRYQDWEIKGRCSDF 740 >gi|114767263|ref|ZP_01446113.1| hypothetical protein 1100011001213_R2601_08621 [Pelagibaca bermudensis HTCC2601] gi|114540616|gb|EAU43688.1| hypothetical protein R2601_08621 [Roseovarius sp. HTCC2601] Length = 65 Score = 51.6 bits (122), Expect = 3e-05, Method: Composition-based stats. Identities = 20/29 (68%), Positives = 22/29 (75%) Query: 47 KLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 P E GGR GLDP R+GDWEK GI+IDF Sbjct: 37 PTPKEYGGRDGLDPARYGDWEKKGIAIDF 65 >gi|330801812|ref|XP_003288917.1| hypothetical protein DICPUDRAFT_153230 [Dictyostelium purpureum] gi|325081009|gb|EGC34541.1| hypothetical protein DICPUDRAFT_153230 [Dictyostelium purpureum] Length = 100 Score = 51.6 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 13/25 (52%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+GG +G +PTR+ DWE+ G DF Sbjct: 76 EVGGPRGPEPTRYNDWERAGRVSDF 100 >gi|86359689|ref|YP_471581.1| hypothetical protein RHE_CH04111 [Rhizobium etli CFN 42] gi|86283791|gb|ABC92854.1| hypothetical conserved protein [Rhizobium etli CFN 42] Length = 74 Score = 51.6 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 21/37 (56%), Positives = 26/37 (70%) Query: 39 KSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + N K +LP EIGGR G +P RFGD+E NG +IDF Sbjct: 38 RRKNQKPLELPPEIGGRGGAEPARFGDYEINGRAIDF 74 >gi|18425195|ref|NP_569049.1| unknown protein [Arabidopsis thaliana] gi|21554347|gb|AAM63454.1| unknown [Arabidopsis thaliana] gi|56236114|gb|AAV84513.1| At5g67490 [Arabidopsis thaliana] gi|56381905|gb|AAV85671.1| At5g67490 [Arabidopsis thaliana] gi|114050697|gb|ABI49498.1| At5g67490 [Arabidopsis thaliana] gi|332010968|gb|AED98351.1| uncharacterized protein [Arabidopsis thaliana] Length = 108 Score = 51.6 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +G +PTR+GDWE+ G DF Sbjct: 84 EIGGPRGPEPTRYGDWEQRGRCSDF 108 >gi|16124358|ref|NP_418922.1| hypothetical protein CC_0103 [Caulobacter crescentus CB15] gi|221233041|ref|YP_002515477.1| cytosolic protein [Caulobacter crescentus NA1000] gi|13421208|gb|AAK22090.1| hypothetical protein CC_0103 [Caulobacter crescentus CB15] gi|220962213|gb|ACL93569.1| hypothetical cytosolic protein [Caulobacter crescentus NA1000] Length = 92 Score = 51.6 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 19/29 (65%), Positives = 23/29 (79%) Query: 47 KLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LP E GGR G +PTRFGDWEK G+++DF Sbjct: 64 SLPPEEGGRDGPEPTRFGDWEKKGVAVDF 92 >gi|224132902|ref|XP_002321437.1| predicted protein [Populus trichocarpa] gi|118483577|gb|ABK93686.1| unknown [Populus trichocarpa] gi|222868433|gb|EEF05564.1| predicted protein [Populus trichocarpa] Length = 118 Score = 51.6 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 18/25 (72%), Positives = 20/25 (80%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG KG +PTRFGDWE+NG DF Sbjct: 94 EIGGPKGPEPTRFGDWERNGRCSDF 118 >gi|167648732|ref|YP_001686395.1| hypothetical protein Caul_4777 [Caulobacter sp. K31] gi|167351162|gb|ABZ73897.1| protein of unknown function DUF1674 [Caulobacter sp. K31] Length = 71 Score = 51.6 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 26/71 (36%), Positives = 35/71 (49%), Gaps = 7/71 (9%) Query: 12 MNNSTIKTSHDPLSSIAKRALE-------EAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 M+ DPL + + L E + A A LP E GGR G +PTRFG Sbjct: 1 MSQDDTLPPQDPLGAAPDKVLTPAARRALEEAAARRAEAHAAALPTEEGGRDGPEPTRFG 60 Query: 65 DWEKNGISIDF 75 DWE+ G+++DF Sbjct: 61 DWERKGVAVDF 71 >gi|149069177|gb|EDM18618.1| rCG43539, isoform CRA_a [Rattus norvegicus] Length = 104 Score = 51.2 bits (121), Expect = 4e-05, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 24/44 (54%) Query: 32 LEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 EE + + + E GG +G +PTR+GDWE+ G IDF Sbjct: 61 PEERDPLQKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF 104 >gi|148261840|ref|YP_001235967.1| hypothetical protein Acry_2858 [Acidiphilium cryptum JF-5] gi|146403521|gb|ABQ32048.1| protein of unknown function DUF1674 [Acidiphilium cryptum JF-5] Length = 58 Score = 51.2 bits (121), Expect = 4e-05, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 21/34 (61%) Query: 42 NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 P EIGG KG +PTR+GDWE+NG DF Sbjct: 25 AGASKPWPKEIGGPKGPEPTRYGDWERNGRCTDF 58 >gi|217977605|ref|YP_002361752.1| protein of unknown function DUF1674 [Methylocella silvestris BL2] gi|217502981|gb|ACK50390.1| protein of unknown function DUF1674 [Methylocella silvestris BL2] Length = 98 Score = 51.2 bits (121), Expect = 4e-05, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 23/40 (57%) Query: 36 KQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 ++R+ P EI GR G +P R+GDWE GI+ DF Sbjct: 59 ERRRLKELAHEPRPKEINGRDGPEPARYGDWEVKGIASDF 98 >gi|319780894|ref|YP_004140370.1| hypothetical protein Mesci_1156 [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317166782|gb|ADV10320.1| protein of unknown function DUF1674 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 73 Score = 51.2 bits (121), Expect = 4e-05, Method: Composition-based stats. Identities = 18/36 (50%), Positives = 23/36 (63%) Query: 40 SANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K+A P EIGGR G +P R+GDWE G++ DF Sbjct: 38 KYLEKEASAPKEIGGRGGKEPGRYGDWEVKGLTSDF 73 >gi|157964234|ref|YP_001499058.1| hypothetical protein RMA_0217 [Rickettsia massiliae MTU5] gi|157844010|gb|ABV84511.1| hypothetical protein RMA_0217 [Rickettsia massiliae MTU5] Length = 106 Score = 51.2 bits (121), Expect = 4e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%) Query: 42 NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 ++ EIGG KGL+PTR+GDW+ G DF Sbjct: 73 EEENLPKEKEIGGVKGLEPTRYGDWQYKGKVTDF 106 >gi|17390188|gb|AAH18085.1| Chromosome 6 open reading frame 57 [Homo sapiens] Length = 108 Score = 51.2 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 24/42 (57%) Query: 34 EAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 E + + + + E GG +G +PTR+GDWE+ G IDF Sbjct: 67 EKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF 108 >gi|296447349|ref|ZP_06889276.1| protein of unknown function DUF1674 [Methylosinus trichosporium OB3b] gi|296255128|gb|EFH02228.1| protein of unknown function DUF1674 [Methylosinus trichosporium OB3b] Length = 69 Score = 51.2 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 25/61 (40%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Query: 15 STIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISID 74 + L A RAL Q + + P EIGGR GLDP R+GDWE GI+ D Sbjct: 10 EATEEPMRRLPPAALRALA-EAQERRRRAERPAPPAEIGGRGGLDPARYGDWESGGIASD 68 Query: 75 F 75 F Sbjct: 69 F 69 >gi|189237031|ref|XP_001809515.1| PREDICTED: similar to CG7224 CG7224-PA [Tribolium castaneum] gi|270007378|gb|EFA03826.1| hypothetical protein TcasGA2_TC013941 [Tribolium castaneum] Length = 106 Score = 51.2 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 2/69 (2%) Query: 7 NIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDW 66 R + +T D +S K +E + ++ + E+GG +G +PTR+GDW Sbjct: 40 EFRKKLRETTPLEKLDEIS--GKHPHQEKEPLEAWPDNTNPTTGEVGGPRGPEPTRYGDW 97 Query: 67 EKNGISIDF 75 E+ G DF Sbjct: 98 ERKGRVTDF 106 >gi|298293741|ref|YP_003695680.1| hypothetical protein Snov_3791 [Starkeya novella DSM 506] gi|296930252|gb|ADH91061.1| protein of unknown function DUF1674 [Starkeya novella DSM 506] Length = 67 Score = 51.2 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 25/62 (40%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Query: 14 NSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISI 73 PL+ AKRA E + A + A+ P EI GR G +P R+GDWE GI+ Sbjct: 7 TPPAPAERRPLTPAAKRA-LEEAAARRAASTQAQAPKEIDGRNGPEPVRYGDWEVKGIAS 65 Query: 74 DF 75 DF Sbjct: 66 DF 67 >gi|296116778|ref|ZP_06835385.1| putative cytoplasmic protein [Gluconacetobacter hansenii ATCC 23769] gi|295976700|gb|EFG83471.1| putative cytoplasmic protein [Gluconacetobacter hansenii ATCC 23769] Length = 78 Score = 50.8 bits (120), Expect = 5e-05, Method: Composition-based stats. Identities = 23/53 (43%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 23 PLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 P +++ALEEA A K P E GG KG +PTR+ DW G IDF Sbjct: 29 PEPLTSEKALEEAD---KARLKQPAEPNERGGPKGPEPTRYNDWTVKGRCIDF 78 >gi|220925066|ref|YP_002500368.1| hypothetical protein Mnod_5219 [Methylobacterium nodulans ORS 2060] gi|219949673|gb|ACL60065.1| protein of unknown function DUF1674 [Methylobacterium nodulans ORS 2060] Length = 68 Score = 50.8 bits (120), Expect = 5e-05, Method: Composition-based stats. Identities = 24/65 (36%), Positives = 34/65 (52%), Gaps = 3/65 (4%) Query: 14 NSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEI---GGRKGLDPTRFGDWEKNG 70 + PLS A+RAL EA+ R++A + A GR GL+P R+ DWE G Sbjct: 4 TKPAQAPRKPLSPAAERALAEAQARRAAIDARAAEIRRAREIDGRGGLEPVRYDDWEVKG 63 Query: 71 ISIDF 75 ++ DF Sbjct: 64 LATDF 68 >gi|148251939|ref|YP_001236524.1| hypothetical protein BBta_0326 [Bradyrhizobium sp. BTAi1] gi|146404112|gb|ABQ32618.1| hypothetical protein BBta_0326 [Bradyrhizobium sp. BTAi1] Length = 76 Score = 50.8 bits (120), Expect = 5e-05, Method: Composition-based stats. Identities = 25/62 (40%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Query: 15 STIKTSHDPLSSIAKRALEEAKQRKSANNKD-AKLPIEIGGRKGLDPTRFGDWEKNGISI 73 ++ PL+ A+RAL EA++R+ ++ P E+ G KG +PTR+GDWE GI Sbjct: 15 ASHDAPKKPLTPAAQRALAEAEERRRRAAEEAMPRPKELQGPKGPEPTRYGDWENKGIIS 74 Query: 74 DF 75 DF Sbjct: 75 DF 76 >gi|170741153|ref|YP_001769808.1| hypothetical protein M446_2962 [Methylobacterium sp. 4-46] gi|168195427|gb|ACA17374.1| protein of unknown function DUF1674 [Methylobacterium sp. 4-46] Length = 68 Score = 50.8 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 3/62 (4%) Query: 17 IKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEI---GGRKGLDPTRFGDWEKNGISI 73 + LS A+RAL EA+ R++A + A GR GL+P R+ DWE G++ Sbjct: 7 AEAPRKTLSPAAQRALAEAQARRAAIDARAAEIRRAREIDGRGGLEPVRYDDWEVKGLAT 66 Query: 74 DF 75 DF Sbjct: 67 DF 68 >gi|312153304|gb|ADQ33164.1| chromosome 6 open reading frame 57 [synthetic construct] Length = 108 Score = 50.8 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 24/42 (57%) Query: 34 EAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 E + + + + E GG +G +PTR+GDWE+ G IDF Sbjct: 67 EKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF 108 >gi|195116789|ref|XP_002002934.1| GI17647 [Drosophila mojavensis] gi|193913509|gb|EDW12376.1| GI17647 [Drosophila mojavensis] Length = 118 Score = 50.8 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 22/56 (39%) Query: 20 SHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L E + K N EIGG G +PTR+GDWE G DF Sbjct: 63 PLTNLPKTMPHPAHEKEPLKRWPNNTNPHTGEIGGPPGPEPTRYGDWESKGRVTDF 118 >gi|116254450|ref|YP_770288.1| hypothetical protein RL4726 [Rhizobium leguminosarum bv. viciae 3841] gi|115259098|emb|CAK10209.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae 3841] Length = 74 Score = 50.8 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 25/34 (73%) Query: 42 NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 N K +LP EIGGR G +P RFGD+E NG +IDF Sbjct: 41 NQKPLELPPEIGGRGGAEPARFGDYEINGRAIDF 74 >gi|332243970|ref|XP_003271143.1| PREDICTED: UPF0369 protein C6orf57-like [Nomascus leucogenys] Length = 108 Score = 50.8 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 24/42 (57%) Query: 34 EAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 E + + + + E GG +G +PTR+GDWE+ G IDF Sbjct: 67 EKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF 108 >gi|209965630|ref|YP_002298545.1| hypothetical protein RC1_2346 [Rhodospirillum centenum SW] gi|209959096|gb|ACI99732.1| conserved hypothetical protein [Rhodospirillum centenum SW] Length = 73 Score = 50.8 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 22/34 (64%) Query: 42 NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 N + A+ P EIGG G +PTR+GDWE G DF Sbjct: 40 NRRPAQPPGEIGGPAGPEPTRYGDWESKGRCSDF 73 >gi|46275839|ref|NP_660310.2| hypothetical protein LOC135154 precursor [Homo sapiens] gi|114608101|ref|XP_527430.2| PREDICTED: UPF0369 protein C6orf57-like [Pan troglodytes] gi|74747126|sp|Q5VUM1|CF057_HUMAN RecName: Full=UPF0369 protein C6orf57; Flags: Precursor gi|55664968|emb|CAH70444.1| chromosome 6 open reading frame 57 [Homo sapiens] gi|75775194|gb|AAI04650.1| Chromosome 6 open reading frame 57 [Homo sapiens] gi|119569195|gb|EAW48810.1| chromosome 6 open reading frame 57, isoform CRA_a [Homo sapiens] gi|119569197|gb|EAW48812.1| chromosome 6 open reading frame 57, isoform CRA_a [Homo sapiens] gi|254071337|gb|ACT64428.1| chromosome 6 open reading frame 57 protein [synthetic construct] gi|254071339|gb|ACT64429.1| chromosome 6 open reading frame 57 protein [synthetic construct] Length = 108 Score = 50.8 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 24/42 (57%) Query: 34 EAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 E + + + + E GG +G +PTR+GDWE+ G IDF Sbjct: 67 EKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF 108 >gi|322790185|gb|EFZ15184.1| hypothetical protein SINV_01384 [Solenopsis invicta] Length = 110 Score = 50.8 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 21/69 (30%), Positives = 29/69 (42%), Gaps = 1/69 (1%) Query: 7 NIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDW 66 R + D L K +E + K N E+GG +G +PTR+GDW Sbjct: 43 EFRKKLRERAPIEKLDEL-EEGKHPYQEKEPLKPFPNNTNPETGEVGGPRGPEPTRYGDW 101 Query: 67 EKNGISIDF 75 E+ G DF Sbjct: 102 ERKGRVTDF 110 >gi|302564657|ref|NP_001181325.1| chromosome 6 open reading frame 57 [Macaca mulatta] Length = 108 Score = 50.8 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 24/42 (57%) Query: 34 EAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 E + + + + E GG +G +PTR+GDWE+ G IDF Sbjct: 67 EKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF 108 >gi|329891247|ref|ZP_08269590.1| hypothetical protein BDIM_29600 [Brevundimonas diminuta ATCC 11568] gi|328846548|gb|EGF96112.1| hypothetical protein BDIM_29600 [Brevundimonas diminuta ATCC 11568] Length = 60 Score = 50.8 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 19/27 (70%), Positives = 24/27 (88%) Query: 49 PIEIGGRKGLDPTRFGDWEKNGISIDF 75 P E+GGRKG +PTRFGDWEK G+++DF Sbjct: 34 PNEVGGRKGPEPTRFGDWEKKGLAVDF 60 >gi|195338435|ref|XP_002035830.1| GM14795 [Drosophila sechellia] gi|194129710|gb|EDW51753.1| GM14795 [Drosophila sechellia] Length = 142 Score = 50.5 bits (119), Expect = 7e-05, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 26/54 (48%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 + +PL A E + K N EIGG+ G +PTR+GDWE+ G Sbjct: 34 EAPLEPLPECAPHPAHEKEPLKPWPNNTNPYTGEIGGQAGPEPTRYGDWERKGR 87 >gi|285018597|ref|YP_003376308.1| hypothetical protein XALc_1827 [Xanthomonas albilineans GPE PC73] gi|283473815|emb|CBA16317.1| conserved hypothetical protein [Xanthomonas albilineans] Length = 56 Score = 50.5 bits (119), Expect = 7e-05, Method: Composition-based stats. Identities = 27/64 (42%), Positives = 31/64 (48%), Gaps = 8/64 (12%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 M T +R EE + A P EIGGR GL+PTR+GDWEKNG Sbjct: 1 MIVQPTPTPESD--PETQRPAEE------TPPRPAPAPPEIGGRGGLEPTRYGDWEKNGR 52 Query: 72 SIDF 75 IDF Sbjct: 53 CIDF 56 >gi|126730444|ref|ZP_01746255.1| hypothetical protein SSE37_11829 [Sagittula stellata E-37] gi|126709177|gb|EBA08232.1| hypothetical protein SSE37_11829 [Sagittula stellata E-37] Length = 61 Score = 50.5 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Query: 17 IKTSHDPLSSIAKRALEEAKQRK-SANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 +T L A+RAL EA +R+ + P E GGR G +P R+GDWEK G++IDF Sbjct: 2 PETPESDLPPAAQRALAEAAERRAKPEAEAKAFPKEYGGRDGPEPVRYGDWEKKGLAIDF 61 >gi|122891180|emb|CAM12934.1| novel protein [Danio rerio] Length = 107 Score = 50.5 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 15/26 (57%), Positives = 19/26 (73%) Query: 50 IEIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWE+ G IDF Sbjct: 82 KEKGGPRGPEPTRYGDWERKGRCIDF 107 >gi|165932785|ref|YP_001649574.1| hypothetical protein RrIowa_0257 [Rickettsia rickettsii str. Iowa] gi|165907872|gb|ABY72168.1| hypothetical cytosolic protein [Rickettsia rickettsii str. Iowa] Length = 64 Score = 50.5 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%) Query: 42 NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 ++ EIGG KGL+PTR+GDW+ G DF Sbjct: 31 EKENLPKEKEIGGVKGLEPTRYGDWQHKGKVTDF 64 >gi|73973683|ref|XP_853554.1| PREDICTED: similar to CG7224-PA [Canis familiaris] Length = 107 Score = 50.5 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 23/42 (54%) Query: 34 EAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 E + + + E GG +G +PTR+GDWE+ G IDF Sbjct: 66 EKEPLTKFPDDINPVTKEKGGPRGPEPTRYGDWERKGRCIDF 107 >gi|163745467|ref|ZP_02152827.1| hypothetical protein OIHEL45_07750 [Oceanibulbus indolifex HEL-45] gi|161382285|gb|EDQ06694.1| hypothetical protein OIHEL45_07750 [Oceanibulbus indolifex HEL-45] Length = 101 Score = 50.5 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 18/29 (62%), Positives = 23/29 (79%) Query: 47 KLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LP E+GGR G +P R+GDWEK GI++DF Sbjct: 73 DLPAELGGRDGPEPVRYGDWEKKGIAVDF 101 >gi|301780992|ref|XP_002925913.1| PREDICTED: UPF0369 protein C6orf57-like [Ailuropoda melanoleuca] Length = 209 Score = 50.5 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 23/42 (54%) Query: 34 EAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 E + + + E GG +G +PTR+GDWE+ G IDF Sbjct: 168 EKEPLTKFPDDINPVTKEKGGPRGPEPTRYGDWERKGRCIDF 209 >gi|71834512|ref|NP_001025355.1| hypothetical protein LOC563956 [Danio rerio] gi|37606032|emb|CAE50906.1| novel protein [Danio rerio] Length = 107 Score = 50.5 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 15/26 (57%), Positives = 19/26 (73%) Query: 50 IEIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWE+ G IDF Sbjct: 82 KEKGGPRGPEPTRYGDWERKGRCIDF 107 >gi|195579210|ref|XP_002079455.1| GD22004 [Drosophila simulans] gi|194191464|gb|EDX05040.1| GD22004 [Drosophila simulans] Length = 142 Score = 50.1 bits (118), Expect = 9e-05, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 26/54 (48%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 + +PL A E + K N EIGG+ G +PTR+GDWE+ G Sbjct: 34 EAPLEPLPECAPHPAHEKEPLKPWPNNTNPYTGEIGGQAGPEPTRYGDWERKGR 87 >gi|326432991|gb|EGD78561.1| hypothetical protein PTSG_09255 [Salpingoeca sp. ATCC 50818] Length = 114 Score = 50.1 bits (118), Expect = 9e-05, Method: Composition-based stats. Identities = 15/25 (60%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E GG KG +PTR+GDWE+ G DF Sbjct: 90 EQGGPKGPEPTRYGDWERKGRVSDF 114 >gi|198431213|ref|XP_002126719.1| PREDICTED: similar to MGC89089 protein [Ciona intestinalis] Length = 113 Score = 50.1 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 14/25 (56%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EI G +G +PTR+GDWE+ G DF Sbjct: 89 EINGPRGPEPTRYGDWERKGRVTDF 113 >gi|13473482|ref|NP_105049.1| hypothetical protein msl4095 [Mesorhizobium loti MAFF303099] gi|14024231|dbj|BAB50835.1| msl4095 [Mesorhizobium loti MAFF303099] Length = 77 Score = 50.1 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 18/32 (56%), Positives = 24/32 (75%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K+A LP E+GGR G +P R+GDWE G++ DF Sbjct: 46 KEAALPKEVGGRGGKEPGRYGDWEVKGLTSDF 77 >gi|241206927|ref|YP_002978023.1| hypothetical protein Rleg_4244 [Rhizobium leguminosarum bv. trifolii WSM1325] gi|240860817|gb|ACS58484.1| protein of unknown function DUF1674 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 74 Score = 50.1 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 26/75 (34%), Positives = 36/75 (48%), Gaps = 1/75 (1%) Query: 1 MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDP 60 M+ + + LS A+RA + + K +LP EIGGR G +P Sbjct: 1 MQDADNDNSETPMAEGTEPPRKMLSPAARRA-LAEAEERRQKQKPLELPPEIGGRGGAEP 59 Query: 61 TRFGDWEKNGISIDF 75 RFGD+E NG +IDF Sbjct: 60 ARFGDYEINGRAIDF 74 >gi|195437031|ref|XP_002066448.1| GK18895 [Drosophila willistoni] gi|194162533|gb|EDW77434.1| GK18895 [Drosophila willistoni] Length = 82 Score = 50.1 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 25/58 (43%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + L A E + + N EIGG G +PTR+GDWE+ G DF Sbjct: 25 EAPLADLPKGAAHPAHEKEPLQPWPNNTNPYTGEIGGPAGPEPTRYGDWERKGRVTDF 82 >gi|194857068|ref|XP_001968889.1| GG24253 [Drosophila erecta] gi|190660756|gb|EDV57948.1| GG24253 [Drosophila erecta] Length = 93 Score = 49.7 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 27/58 (46%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + + L A E + K N EIGG+ G +PTR+GDWE+ G DF Sbjct: 36 EAPLESLPECAPHPAHEKEPLKPWPNNTNPYTGEIGGQAGPEPTRYGDWERKGRVTDF 93 >gi|328865582|gb|EGG13968.1| hypothetical protein DFA_11729 [Dictyostelium fasciculatum] Length = 108 Score = 49.7 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 15/25 (60%), Positives = 20/25 (80%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +G +PTR+GDWE+ G + DF Sbjct: 84 EIGGVRGPEPTRYGDWERKGRTSDF 108 >gi|254448790|ref|ZP_05062247.1| conserved hypothetical protein [gamma proteobacterium HTCC5015] gi|198261631|gb|EDY85919.1| conserved hypothetical protein [gamma proteobacterium HTCC5015] Length = 73 Score = 49.7 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 20/34 (58%) Query: 42 NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 E GG KGL+PTR+GDWEK G IDF Sbjct: 40 AEGPKDQVSEHGGPKGLEPTRYGDWEKAGRCIDF 73 >gi|195155787|ref|XP_002018782.1| GL25766 [Drosophila persimilis] gi|194114935|gb|EDW36978.1| GL25766 [Drosophila persimilis] Length = 195 Score = 49.7 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 23/58 (39%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + L A E N E+GG G +PTR+GDWE+ G DF Sbjct: 138 EAPVTCLPKGAPHPAHEKDPLVPWPNNTNPHTGEVGGPAGPEPTRYGDWERKGRVTDF 195 >gi|325192150|emb|CCA26607.1| AlNc14C394G11311 [Albugo laibachii Nc14] Length = 107 Score = 49.7 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 4/30 (13%) Query: 50 IEIGGR--KG--LDPTRFGDWEKNGISIDF 75 E GG G +PTR+GDWE+NG DF Sbjct: 78 PEYGGPTKGGKLPEPTRYGDWERNGRCTDF 107 >gi|168060970|ref|XP_001782465.1| predicted protein [Physcomitrella patens subsp. patens] gi|162666075|gb|EDQ52740.1| predicted protein [Physcomitrella patens subsp. patens] Length = 52 Score = 49.3 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 15/25 (60%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+GG G +PTR+GDWEK G DF Sbjct: 28 EVGGPHGPEPTRYGDWEKGGRCYDF 52 >gi|307107159|gb|EFN55403.1| hypothetical protein CHLNCDRAFT_134518 [Chlorella variabilis] Length = 137 Score = 49.3 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 25/51 (49%) Query: 25 SSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + +A A ++ ++ LP E GG G +PTR+ DWE G DF Sbjct: 87 TPVAAAAGDKQAGGEAPPQPAGGLPPEYGGYAGPEPTRYKDWEIKGRCSDF 137 >gi|255544992|ref|XP_002513557.1| conserved hypothetical protein [Ricinus communis] gi|223547465|gb|EEF48960.1| conserved hypothetical protein [Ricinus communis] Length = 106 Score = 49.3 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 17/25 (68%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG KG +PTR+GDWE NG DF Sbjct: 82 EIGGPKGPEPTRYGDWELNGRCSDF 106 >gi|320169809|gb|EFW46708.1| predicted protein [Capsaspora owczarzaki ATCC 30864] Length = 141 Score = 49.3 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 18/43 (41%), Positives = 23/43 (53%) Query: 33 EEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 E + E GG +G +PTR+GDWEKNG +IDF Sbjct: 99 AEEEDDGHEYEYINPQTGERGGPRGPEPTRYGDWEKNGRAIDF 141 >gi|308498531|ref|XP_003111452.1| hypothetical protein CRE_03974 [Caenorhabditis remanei] gi|308241000|gb|EFO84952.1| hypothetical protein CRE_03974 [Caenorhabditis remanei] Length = 89 Score = 49.3 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 7/52 (13%) Query: 31 ALEEAKQRKSANNKDAKLPI-------EIGGRKGLDPTRFGDWEKNGISIDF 75 AL++ ++++ + K P E+GG G +PTR+GDWE+ G DF Sbjct: 38 ALDKTEEKQFEDPHLKKHPGGVNKNTGEVGGPAGPEPTRYGDWERKGRVTDF 89 >gi|307207940|gb|EFN85499.1| UPF0369 protein C6orf57-like protein [Harpegnathos saltator] Length = 114 Score = 49.3 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 18/43 (41%), Positives = 24/43 (55%) Query: 33 EEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 +E + K N EIGG +G +PTR+GDWE+ G DF Sbjct: 72 QEKEPLKPFPNNTNPETGEIGGPRGPEPTRYGDWERKGRVTDF 114 >gi|75674354|ref|YP_316775.1| hypothetical protein Nwi_0155 [Nitrobacter winogradskyi Nb-255] gi|74419224|gb|ABA03423.1| hypothetical protein Nwi_0155 [Nitrobacter winogradskyi Nb-255] Length = 88 Score = 49.3 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 29/70 (41%), Positives = 41/70 (58%) Query: 6 INIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGD 65 I+ + + S LS A+RAL EA+ R++A + P EI G +G +PTRFGD Sbjct: 19 IDEPSASSRTGETRSRKQLSPEARRALAEAEARRAAQTDASAPPKEIQGPEGPEPTRFGD 78 Query: 66 WEKNGISIDF 75 WE+ GI+ DF Sbjct: 79 WERGGIASDF 88 >gi|281344880|gb|EFB20464.1| hypothetical protein PANDA_015493 [Ailuropoda melanoleuca] Length = 85 Score = 49.3 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 23/42 (54%) Query: 34 EAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 E + + + E GG +G +PTR+GDWE+ G IDF Sbjct: 44 EKEPLTKFPDDINPVTKEKGGPRGPEPTRYGDWERKGRCIDF 85 >gi|309364568|emb|CAP24841.2| hypothetical protein CBG_04049 [Caenorhabditis briggsae AF16] Length = 89 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 14/25 (56%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+GG G +PTR+GDWE+ G DF Sbjct: 65 EVGGPAGPEPTRYGDWERKGRVTDF 89 >gi|91205955|ref|YP_538310.1| hypothetical protein RBE_1140 [Rickettsia bellii RML369-C] gi|157826684|ref|YP_001495748.1| hypothetical protein A1I_01605 [Rickettsia bellii OSU 85-389] gi|91069499|gb|ABE05221.1| unknown [Rickettsia bellii RML369-C] gi|157801988|gb|ABV78711.1| hypothetical protein A1I_01605 [Rickettsia bellii OSU 85-389] Length = 47 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 18/32 (56%), Positives = 24/32 (75%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K+ ++P EIGG KGL+PTR+GDW+ G DF Sbjct: 16 KEKEMPKEIGGAKGLEPTRYGDWQHKGKVTDF 47 >gi|194758559|ref|XP_001961529.1| GF15011 [Drosophila ananassae] gi|190615226|gb|EDV30750.1| GF15011 [Drosophila ananassae] Length = 127 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 28/58 (48%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 +++ + + + E + + N E+GG G +PTR+GDWE+ G DF Sbjct: 70 ESAPELVPEVPYNPAHEKEPLQPWPNSVNPHTGEVGGPAGPEPTRYGDWERKGRVTDF 127 >gi|307180266|gb|EFN68299.1| UPF0369 protein C6orf57-like protein [Camponotus floridanus] Length = 106 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 18/43 (41%), Positives = 24/43 (55%) Query: 33 EEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 +E + K N EIGG +G +PTR+GDWE+ G DF Sbjct: 64 QEKEPLKPFPNNTNPETGEIGGPRGPEPTRYGDWERKGRVTDF 106 >gi|118088802|ref|XP_001234195.1| PREDICTED: hypothetical protein isoform 1 [Gallus gallus] Length = 92 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 17/29 (58%), Positives = 19/29 (65%) Query: 47 KLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 E GG KG +PTRFGDWE+ G IDF Sbjct: 64 PATKERGGPKGPEPTRFGDWERKGRCIDF 92 >gi|323137518|ref|ZP_08072595.1| protein of unknown function DUF1674 [Methylocystis sp. ATCC 49242] gi|322397144|gb|EFX99668.1| protein of unknown function DUF1674 [Methylocystis sp. ATCC 49242] Length = 70 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 19/37 (51%), Positives = 23/37 (62%) Query: 39 KSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + + D EIGGR GLDP RFGDWE G++ DF Sbjct: 34 RRRDAVDKAKATEIGGRGGLDPARFGDWEVKGVASDF 70 >gi|25151100|ref|NP_740875.1| hypothetical protein W02D3.12 [Caenorhabditis elegans] gi|21328382|gb|AAM48550.1|AF003141_5 Hypothetical protein W02D3.12 [Caenorhabditis elegans] Length = 89 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 7/52 (13%) Query: 31 ALEEAKQRKSANNKDAKLPI-------EIGGRKGLDPTRFGDWEKNGISIDF 75 AL++A +++ + K P E+GG G +PTR+GDWE+ G DF Sbjct: 38 ALDKADEQQYEDPHLKKHPGGVNKSTGEVGGPAGPEPTRYGDWERKGRVSDF 89 >gi|15892132|ref|NP_359846.1| hypothetical protein RC0209 [Rickettsia conorii str. Malish 7] gi|81528504|sp|Q92J60|Y209_RICCN RecName: Full=UPF0369 protein RC0209 gi|15619260|gb|AAL02747.1| unknown [Rickettsia conorii str. Malish 7] Length = 93 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%) Query: 42 NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 ++ EIGG KGL+PTR+GDW+ G DF Sbjct: 60 EKENLPKEKEIGGVKGLEPTRYGDWQHKGKVTDF 93 >gi|332018146|gb|EGI58755.1| UPF0369 protein C6orf57-like protein [Acromyrmex echinatior] Length = 94 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 21/69 (30%), Positives = 29/69 (42%), Gaps = 1/69 (1%) Query: 7 NIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDW 66 R + D L K +E + K N E+GG +G +PTR+GDW Sbjct: 27 EFRKKLRERAPIEKLDEL-EEGKHPYQEKEPLKPFPNNTNPETGEVGGPRGPEPTRYGDW 85 Query: 67 EKNGISIDF 75 E+ G DF Sbjct: 86 ERKGRVSDF 94 >gi|157828085|ref|YP_001494327.1| hypothetical protein A1G_01185 [Rickettsia rickettsii str. 'Sheila Smith'] gi|157800566|gb|ABV75819.1| hypothetical protein A1G_01185 [Rickettsia rickettsii str. 'Sheila Smith'] Length = 94 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%) Query: 42 NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 ++ EIGG KGL+PTR+GDW+ G DF Sbjct: 61 EKENLPKEKEIGGVKGLEPTRYGDWQHKGKVTDF 94 >gi|268565469|ref|XP_002639454.1| Hypothetical protein CBG04049 [Caenorhabditis briggsae] Length = 60 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 14/25 (56%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+GG G +PTR+GDWE+ G DF Sbjct: 36 EVGGPAGPEPTRYGDWERKGRVTDF 60 >gi|149069179|gb|EDM18620.1| rCG43539, isoform CRA_c [Rattus norvegicus] Length = 121 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 24/44 (54%) Query: 32 LEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 EE + + + E GG +G +PTR+GDWE+ G IDF Sbjct: 78 PEERDPLQKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF 121 >gi|118395860|ref|XP_001030275.1| hypothetical protein TTHERM_01106140 [Tetrahymena thermophila] gi|89284572|gb|EAR82612.1| hypothetical protein TTHERM_01106140 [Tetrahymena thermophila SB210] Length = 417 Score = 48.2 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 6/66 (9%) Query: 16 TIKTSHDPLSSIAKRA--LEEAKQRKSANNKDAK---LPIEIGGR-KGLDPTRFGDWEKN 69 T + L K+ + E ++RK + +P E+G + KG +PTRFGDWE+ Sbjct: 89 TPLGKFEQLQPQKKQKENMTEEEKRKEYLENNLNEWGMPEEVGFKVKGPEPTRFGDWERK 148 Query: 70 GISIDF 75 F Sbjct: 149 AFQTKF 154 >gi|198476520|ref|XP_001357378.2| GA13625 [Drosophila pseudoobscura pseudoobscura] gi|198137734|gb|EAL34447.2| GA13625 [Drosophila pseudoobscura pseudoobscura] Length = 225 Score = 48.2 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 23/58 (39%) Query: 18 KTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + L A E N E+GG G +PTR+GDWE+ G DF Sbjct: 168 EAPVTCLPKGAPHPAHEKDPLVPWPNNTNPHTGEVGGPAGPEPTRYGDWERKGRVTDF 225 >gi|226503875|ref|NP_001143165.1| human viral protein homolog1 [Zea mays] gi|195615278|gb|ACG29469.1| hypothetical protein [Zea mays] Length = 117 Score = 48.2 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 14/25 (56%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+GG +G +PTR+GDWE+ G DF Sbjct: 93 EVGGPRGPEPTRYGDWERAGRCSDF 117 >gi|156550516|ref|XP_001602183.1| PREDICTED: similar to conserved hypothetical protein [Nasonia vitripennis] Length = 96 Score = 48.2 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 10/54 (18%) Query: 32 LEEAKQRKSANNKDAKLPI----------EIGGRKGLDPTRFGDWEKNGISIDF 75 LEE ++ K + L E G KG +PTR+GDWE+ G DF Sbjct: 43 LEELEEGKHPYQEKEPLEPFPDNINPVTGESNGPKGPEPTRYGDWERKGRVTDF 96 >gi|195050309|ref|XP_001992866.1| GH13408 [Drosophila grimshawi] gi|193899925|gb|EDV98791.1| GH13408 [Drosophila grimshawi] Length = 119 Score = 48.2 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +GL+PTR+GDW+ G DF Sbjct: 95 EIGGPRGLEPTRYGDWQTKGRVTDF 119 >gi|308799611|ref|XP_003074586.1| unnamed protein product [Ostreococcus tauri] gi|116000757|emb|CAL50437.1| unnamed protein product [Ostreococcus tauri] Length = 127 Score = 48.2 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 5/52 (9%) Query: 29 KRALEEAKQRKSANNKDAKLPI-----EIGGRKGLDPTRFGDWEKNGISIDF 75 +RA EA+ R + + EIGG +GL+PTR+GDWE+ G DF Sbjct: 76 ERAKAEAEARNAEKRRAFHRARGVDVDEIGGPRGLEPTRYGDWERAGRVSDF 127 >gi|238651022|ref|YP_002916878.1| hypothetical protein RPR_06695 [Rickettsia peacockii str. Rustic] gi|238625120|gb|ACR47826.1| hypothetical protein RPR_06695 [Rickettsia peacockii str. Rustic] Length = 94 Score = 47.8 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%) Query: 42 NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 ++ EIGG KGL+PTR+GDW+ G DF Sbjct: 61 EKENLPKEKEIGGVKGLEPTRYGDWQHKGKVTDF 94 >gi|154251781|ref|YP_001412605.1| hypothetical protein Plav_1328 [Parvibaculum lavamentivorans DS-1] gi|154155731|gb|ABS62948.1| protein of unknown function DUF1674 [Parvibaculum lavamentivorans DS-1] Length = 70 Score = 47.8 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 27/62 (43%), Positives = 37/62 (59%) Query: 14 NSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISI 73 N + L+ A+RAL EA++R+ A + P EI GR G +PTR+GDWE GI+ Sbjct: 9 NPSPPAPEKELTPAARRALAEAEERRKAADAAPARPREIAGRGGNEPTRYGDWEVKGITS 68 Query: 74 DF 75 DF Sbjct: 69 DF 70 >gi|115466524|ref|NP_001056861.1| Os06g0157800 [Oryza sativa Japonica Group] gi|55296597|dbj|BAD69195.1| unknown protein [Oryza sativa Japonica Group] gi|55296714|dbj|BAD69432.1| unknown protein [Oryza sativa Japonica Group] gi|113594901|dbj|BAF18775.1| Os06g0157800 [Oryza sativa Japonica Group] gi|215768294|dbj|BAH00523.1| unnamed protein product [Oryza sativa Japonica Group] gi|218197622|gb|EEC80049.1| hypothetical protein OsI_21750 [Oryza sativa Indica Group] gi|222634992|gb|EEE65124.1| hypothetical protein OsJ_20192 [Oryza sativa Japonica Group] Length = 122 Score = 47.8 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +G +PTR+GDWE+ G DF Sbjct: 98 EIGGPRGPEPTRYGDWERGGRCSDF 122 >gi|195397945|ref|XP_002057588.1| GJ18212 [Drosophila virilis] gi|194141242|gb|EDW57661.1| GJ18212 [Drosophila virilis] Length = 110 Score = 47.8 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 15/25 (60%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +G +PTR+GDWE G DF Sbjct: 86 EIGGPRGPEPTRYGDWESKGRVTDF 110 >gi|34580837|ref|ZP_00142317.1| hypothetical protein [Rickettsia sibirica 246] gi|229586409|ref|YP_002844910.1| hypothetical protein RAF_ORF0200 [Rickettsia africae ESF-5] gi|28262222|gb|EAA25726.1| unknown [Rickettsia sibirica 246] gi|228021459|gb|ACP53167.1| Unknown [Rickettsia africae ESF-5] Length = 93 Score = 47.8 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%) Query: 42 NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 ++ EIGG KGL+PTR+GDW+ G DF Sbjct: 60 EKENLPKEKEIGGVKGLEPTRYGDWQHKGKVTDF 93 >gi|299133156|ref|ZP_07026351.1| protein of unknown function DUF1674 [Afipia sp. 1NLS2] gi|298593293|gb|EFI53493.1| protein of unknown function DUF1674 [Afipia sp. 1NLS2] Length = 82 Score = 47.4 bits (111), Expect = 6e-04, Method: Composition-based stats. Identities = 18/33 (54%), Positives = 21/33 (63%) Query: 43 NKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 D P EI G KG +PTR+GDWE GI+ DF Sbjct: 50 ASDPNDPKEINGPKGPEPTRYGDWEIKGIASDF 82 >gi|260466789|ref|ZP_05812974.1| protein of unknown function DUF1674 [Mesorhizobium opportunistum WSM2075] gi|259029401|gb|EEW30692.1| protein of unknown function DUF1674 [Mesorhizobium opportunistum WSM2075] Length = 73 Score = 47.4 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 24/34 (70%) Query: 42 NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 K+A LP EIGGR G +P R+GDWE G++ DF Sbjct: 40 RRKEAALPREIGGRGGKEPGRYGDWEVKGLTSDF 73 >gi|114320487|ref|YP_742170.1| hypothetical protein Mlg_1331 [Alkalilimnicola ehrlichii MLHE-1] gi|114226881|gb|ABI56680.1| protein of unknown function DUF1674 [Alkalilimnicola ehrlichii MLHE-1] Length = 59 Score = 47.4 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 19/35 (54%), Positives = 22/35 (62%) Query: 41 ANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 A P EIGG KG +PTR+GDWE+NG DF Sbjct: 25 AVAAGDGRPKEIGGPKGPEPTRYGDWERNGRCSDF 59 >gi|115522059|ref|YP_778970.1| hypothetical protein RPE_0029 [Rhodopseudomonas palustris BisA53] gi|115516006|gb|ABJ03990.1| protein of unknown function DUF1674 [Rhodopseudomonas palustris BisA53] Length = 82 Score = 47.4 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 15/24 (62%), Positives = 20/24 (83%) Query: 52 IGGRKGLDPTRFGDWEKNGISIDF 75 + G KGL+PTR+GDWE+ GI+ DF Sbjct: 59 VDGPKGLEPTRYGDWERKGIASDF 82 >gi|295687554|ref|YP_003591247.1| hypothetical protein Cseg_0102 [Caulobacter segnis ATCC 21756] gi|295429457|gb|ADG08629.1| protein of unknown function DUF1674 [Caulobacter segnis ATCC 21756] Length = 73 Score = 47.4 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 18/27 (66%), Positives = 23/27 (85%) Query: 49 PIEIGGRKGLDPTRFGDWEKNGISIDF 75 P E GGR+G +PTRFGDWEK G+++DF Sbjct: 47 PPEKGGREGPEPTRFGDWEKKGVAVDF 73 >gi|163797845|ref|ZP_02191790.1| hypothetical protein BAL199_06714 [alpha proteobacterium BAL199] gi|159176889|gb|EDP61456.1| hypothetical protein BAL199_06714 [alpha proteobacterium BAL199] Length = 72 Score = 47.0 bits (110), Expect = 8e-04, Method: Composition-based stats. Identities = 22/62 (35%), Positives = 25/62 (40%), Gaps = 3/62 (4%) Query: 17 IKTSHDPLSSIAKRALE---EAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISI 73 I+T AK E + LP E GG G +PTRFGDWE G Sbjct: 11 IRTPQSKAEDAAKSTSARPVEIPAQLDPRAATQDLPPERGGYTGPEPTRFGDWEHKGRCT 70 Query: 74 DF 75 DF Sbjct: 71 DF 72 >gi|224048563|ref|XP_002192669.1| PREDICTED: similar to Chromosome 6 open reading frame 57 [Taeniopygia guttata] Length = 100 Score = 47.0 bits (110), Expect = 8e-04, Method: Composition-based stats. Identities = 16/29 (55%), Positives = 19/29 (65%) Query: 47 KLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTRFGDWE+ G IDF Sbjct: 72 PTTKERGGPRGPEPTRFGDWERKGRCIDF 100 >gi|242092040|ref|XP_002436510.1| hypothetical protein SORBIDRAFT_10g003950 [Sorghum bicolor] gi|241914733|gb|EER87877.1| hypothetical protein SORBIDRAFT_10g003950 [Sorghum bicolor] Length = 117 Score = 47.0 bits (110), Expect = 9e-04, Method: Composition-based stats. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +G +PTR+GDWE+ G DF Sbjct: 93 EIGGPRGPEPTRYGDWERGGRCSDF 117 >gi|37606067|emb|CAE49440.1| novel protein [Danio rerio] Length = 83 Score = 47.0 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 15/26 (57%), Positives = 19/26 (73%) Query: 50 IEIGGRKGLDPTRFGDWEKNGISIDF 75 E GG +G +PTR+GDWE+ G IDF Sbjct: 58 KEKGGPRGPEPTRYGDWERKGRCIDF 83 >gi|9757870|dbj|BAB08457.1| unnamed protein product [Arabidopsis thaliana] Length = 226 Score = 47.0 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 14/25 (56%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +G +PTR+GDWE+ S F Sbjct: 84 EIGGPRGPEPTRYGDWEQRACSYIF 108 >gi|313236855|emb|CBY12106.1| unnamed protein product [Oikopleura dioica] Length = 97 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 21/72 (29%), Positives = 30/72 (41%), Gaps = 1/72 (1%) Query: 4 VQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRF 63 + + P S K +EEA +K + E GG G++PTR+ Sbjct: 27 PKGKFDEKSDADLEAVKRMPASKKGKLYMEEAPIQKHPGGINPD-SGERGGPGGVEPTRY 85 Query: 64 GDWEKNGISIDF 75 GDWE+ G DF Sbjct: 86 GDWERKGRVTDF 97 >gi|157864462|ref|XP_001680941.1| hypothetical protein [Leishmania major strain Friedlin] gi|68124234|emb|CAJ06996.1| conserved hypothetical protein [Leishmania major strain Friedlin] Length = 185 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 23/68 (33%), Positives = 28/68 (41%), Gaps = 10/68 (14%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGR----KGLDPTRFGDWE 67 M++ IK L S E+ K A + E GR DPTR+GDWE Sbjct: 124 MSDDDIKRFTTSLGSA------ESLFNKQAGAIPTNVVDEETGRVIGSTQPDPTRYGDWE 177 Query: 68 KNGISIDF 75 NG DF Sbjct: 178 VNGRCYDF 185 >gi|67459504|ref|YP_247128.1| hypothetical protein RF_1112 [Rickettsia felis URRWXCal2] gi|75536089|sp|Q4UKG8|Y1112_RICFE RecName: Full=UPF0369 protein RF_1112 gi|67005037|gb|AAY61963.1| unknown [Rickettsia felis URRWXCal2] Length = 78 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 15/24 (62%), Positives = 18/24 (75%) Query: 52 IGGRKGLDPTRFGDWEKNGISIDF 75 IGG KGL+PTR+GDW+ G DF Sbjct: 55 IGGVKGLEPTRYGDWQHKGKVTDF 78 >gi|50744814|ref|XP_419887.1| PREDICTED: hypothetical protein isoform 2 [Gallus gallus] Length = 95 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 17/29 (58%), Positives = 19/29 (65%) Query: 47 KLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 E GG KG +PTRFGDWE+ G IDF Sbjct: 67 PATKERGGPKGPEPTRFGDWERKGRCIDF 95 >gi|157825351|ref|YP_001493071.1| ABC-type multidrug transport system, ATPase and permease components [Rickettsia akari str. Hartford] gi|157799309|gb|ABV74563.1| ABC-type multidrug transport system, ATPase and permease components [Rickettsia akari str. Hartford] Length = 86 Score = 46.2 bits (108), Expect = 0.001, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 43 NKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 N EIGG KGL+PTR+ DW+ G DF Sbjct: 54 NDAVPKAKEIGGVKGLEPTRYDDWQHKGKVTDF 86 >gi|315497065|ref|YP_004085869.1| hypothetical protein Astex_0014 [Asticcacaulis excentricus CB 48] gi|315415077|gb|ADU11718.1| protein of unknown function DUF1674 [Asticcacaulis excentricus CB 48] Length = 79 Score = 45.8 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 18/29 (62%), Positives = 21/29 (72%) Query: 47 KLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + P E GG GL+PTRFGDWE+ GI DF Sbjct: 51 ERPFEEGGPAGLEPTRFGDWERKGIVSDF 79 >gi|296533926|ref|ZP_06896450.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957] gi|296265743|gb|EFH11844.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957] Length = 63 Score = 45.8 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 22/63 (34%), Positives = 28/63 (44%) Query: 13 NNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGIS 72 K + + A A + K A +P EIGG G +PTRFGDWE+ G Sbjct: 1 MGGMTKPEQEGTAPSADTAAAPQDSAAAPKPKPAPMPPEIGGPAGPEPTRFGDWERKGRV 60 Query: 73 IDF 75 DF Sbjct: 61 SDF 63 >gi|91975196|ref|YP_567855.1| hypothetical protein RPD_0716 [Rhodopseudomonas palustris BisB5] gi|91681652|gb|ABE37954.1| protein of unknown function DUF1674 [Rhodopseudomonas palustris BisB5] Length = 73 Score = 45.5 bits (106), Expect = 0.002, Method: Composition-based stats. Identities = 27/61 (44%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Query: 16 TIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIE-IGGRKGLDPTRFGDWEKNGISID 74 KT L AKRAL EA+ R++ K A + G KG +PTR+GDWE GI+ D Sbjct: 13 PTKTPRKELPDAAKRALAEAEARRAEAAKHAAAHAKEYQGPKGPEPTRYGDWEVKGIASD 72 Query: 75 F 75 F Sbjct: 73 F 73 >gi|302381574|ref|YP_003817397.1| hypothetical protein Bresu_0459 [Brevundimonas subvibrioides ATCC 15264] gi|302192202|gb|ADK99773.1| protein of unknown function DUF1674 [Brevundimonas subvibrioides ATCC 15264] Length = 79 Score = 45.5 bits (106), Expect = 0.002, Method: Composition-based stats. Identities = 17/27 (62%), Positives = 22/27 (81%) Query: 49 PIEIGGRKGLDPTRFGDWEKNGISIDF 75 P E GG +G +PTR+GDWEK G++IDF Sbjct: 53 PEEHGGPRGPEPTRYGDWEKKGLAIDF 79 >gi|239948516|ref|ZP_04700269.1| ABC-type multidrug transport system, ATPase and permease component [Rickettsia endosymbiont of Ixodes scapularis] gi|239922792|gb|EER22816.1| ABC-type multidrug transport system, ATPase and permease component [Rickettsia endosymbiont of Ixodes scapularis] Length = 30 Score = 45.5 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 16/30 (53%), Positives = 19/30 (63%) Query: 46 AKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG KGL+PTR+GDW+ G DF Sbjct: 1 MPKEKEIGGVKGLEPTRYGDWQHKGKVTDF 30 >gi|326506524|dbj|BAJ86580.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326527587|dbj|BAK08068.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 117 Score = 45.5 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Query: 28 AKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 A +A EE + + + EIGG +G +PTR+GDWE+ G DF Sbjct: 72 ATKAAEEEEDDGGLDINETT--GEIGGPRGPEPTRYGDWERGGRCSDF 117 >gi|322488404|emb|CBZ23650.1| conserved hypothetical protein [Leishmania mexicana MHOM/GT/2001/U1103] Length = 107 Score = 45.1 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 13/22 (59%), Positives = 14/22 (63%) Query: 54 GRKGLDPTRFGDWEKNGISIDF 75 G DPTR+GDWE NG DF Sbjct: 86 GSTQPDPTRYGDWEVNGRCYDF 107 >gi|196002241|ref|XP_002110988.1| hypothetical protein TRIADDRAFT_22086 [Trichoplax adhaerens] gi|190586939|gb|EDV26992.1| hypothetical protein TRIADDRAFT_22086 [Trichoplax adhaerens] Length = 63 Score = 45.1 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 15/25 (60%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EI G +G +PTRFGDWE+ G DF Sbjct: 39 EINGPRGPEPTRFGDWERGGRVSDF 63 >gi|328793682|ref|XP_001121933.2| PREDICTED: UPF0369 protein C6orf57 homolog [Apis mellifera] Length = 70 Score = 45.1 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 18/43 (41%), Positives = 24/43 (55%) Query: 33 EEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 +E + K N EIGG +G +PTR+GDWE+ G DF Sbjct: 28 QEKEPLKPFPNNTNPKTGEIGGPRGPEPTRYGDWERKGRVTDF 70 >gi|304320445|ref|YP_003854088.1| hypothetical protein PB2503_04357 [Parvularcula bermudensis HTCC2503] gi|303299347|gb|ADM08946.1| hypothetical protein PB2503_04357 [Parvularcula bermudensis HTCC2503] Length = 86 Score = 45.1 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 21/54 (38%), Positives = 30/54 (55%) Query: 22 DPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LS AL EA+ R+ A ++ + G + +PTR+GDWEK G +IDF Sbjct: 32 RRLSETEITALREARDRRDAIAREDQAREVGGAARDTNPTRYGDWEKAGRAIDF 85 >gi|326388833|ref|ZP_08210415.1| hypothetical protein Y88_3577 [Novosphingobium nitrogenifigens DSM 19370] gi|326206433|gb|EGD57268.1| hypothetical protein Y88_3577 [Novosphingobium nitrogenifigens DSM 19370] Length = 70 Score = 45.1 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 23/63 (36%), Positives = 27/63 (42%), Gaps = 3/63 (4%) Query: 16 TIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIG---GRKGLDPTRFGDWEKNGIS 72 I A + EE N P + GLDPTRFGDWE+NGI+ Sbjct: 8 PICKGMSEPIKRATKRPEEFTPPPHWTNPPVPEPRAVERGEDPDGLDPTRFGDWERNGIA 67 Query: 73 IDF 75 IDF Sbjct: 68 IDF 70 >gi|159487193|ref|XP_001701618.1| predicted protein [Chlamydomonas reinhardtii] gi|158280837|gb|EDP06593.1| predicted protein [Chlamydomonas reinhardtii] Length = 151 Score = 44.7 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 14/25 (56%), Positives = 18/25 (72%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E+ G +G +PTR+GDWE G IDF Sbjct: 127 ELYGPRGREPTRYGDWENKGKCIDF 151 >gi|83594907|ref|YP_428659.1| hypothetical protein Rru_A3578 [Rhodospirillum rubrum ATCC 11170] gi|83577821|gb|ABC24372.1| hypothetical protein Rru_A3578 [Rhodospirillum rubrum ATCC 11170] Length = 65 Score = 44.7 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 19/65 (29%), Positives = 28/65 (43%) Query: 11 LMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNG 70 + + P A A + A+ P+E GG +G +PTR+ DWE+NG Sbjct: 1 MTSKDPRPAPASPAQDEAVPAPLAQDEAVPASPPADPKPVEHGGPRGPEPTRYNDWERNG 60 Query: 71 ISIDF 75 DF Sbjct: 61 RCSDF 65 >gi|92115830|ref|YP_575559.1| hypothetical protein Nham_0198 [Nitrobacter hamburgensis X14] gi|91798724|gb|ABE61099.1| protein of unknown function DUF1674 [Nitrobacter hamburgensis X14] Length = 72 Score = 44.7 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 19/27 (70%), Positives = 22/27 (81%) Query: 49 PIEIGGRKGLDPTRFGDWEKNGISIDF 75 P EI G KG +PTRFGDWE+NGI+ DF Sbjct: 46 PKEIQGPKGPEPTRFGDWERNGIASDF 72 >gi|85714013|ref|ZP_01045002.1| hypothetical protein NB311A_07653 [Nitrobacter sp. Nb-311A] gi|85699139|gb|EAQ37007.1| hypothetical protein NB311A_07653 [Nitrobacter sp. Nb-311A] Length = 72 Score = 44.3 bits (103), Expect = 0.005, Method: Composition-based stats. Identities = 27/59 (45%), Positives = 38/59 (64%) Query: 17 IKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + + L A+RAL EA+ R++A + P EI G KG +PTRFGDWE+NG++ DF Sbjct: 14 TRDARRRLPPAAERALAEAEARRAARTDASARPKEILGPKGPEPTRFGDWERNGVASDF 72 >gi|301109291|ref|XP_002903726.1| conserved hypothetical protein [Phytophthora infestans T30-4] gi|262096729|gb|EEY54781.1| conserved hypothetical protein [Phytophthora infestans T30-4] Length = 97 Score = 44.3 bits (103), Expect = 0.005, Method: Composition-based stats. Identities = 22/73 (30%), Positives = 29/73 (39%), Gaps = 17/73 (23%) Query: 16 TIKTSHDPLSSIAKRALEE---------AKQRKSANNKDAKLPIEIGG--RKGL--DPTR 62 H + A R+ E A++ L +E GG R G +PTR Sbjct: 29 PSGKPHITNTPAAPRSDGENLDDLDGNDAEE----TVAIGPLGVEYGGPTRGGKLKEPTR 84 Query: 63 FGDWEKNGISIDF 75 FGDWE+ G DF Sbjct: 85 FGDWERKGRCSDF 97 >gi|255084125|ref|XP_002508637.1| predicted protein [Micromonas sp. RCC299] gi|226523914|gb|ACO69895.1| predicted protein [Micromonas sp. RCC299] Length = 164 Score = 44.3 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 14/25 (56%), Positives = 17/25 (68%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 E G +G +PTRFGDWE+ G DF Sbjct: 140 EWNGPRGPEPTRFGDWERAGRCSDF 164 >gi|298707113|emb|CBJ29905.1| conserved unknown protein [Ectocarpus siliculosus] Length = 131 Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Query: 36 KQRKSANNKDAKLPIEIGG--RKGL--DPTRFGDWEKNGISIDF 75 + ++ E GG R G+ +PTRFGDWE+ G DF Sbjct: 88 DEEMEEMLQEGPAGKEWGGPTRGGVLGEPTRFGDWERKGRCSDF 131 >gi|145492903|ref|XP_001432448.1| hypothetical protein [Paramecium tetraurelia strain d4-2] gi|124399560|emb|CAK65051.1| unnamed protein product [Paramecium tetraurelia] Length = 119 Score = 43.1 bits (100), Expect = 0.011, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Query: 36 KQRKSANNKDAKLPIEIGGR-KGLDPTRFGDWEKNGISIDF 75 +Q K +P E+G + KG +PTR+GDW G DF Sbjct: 79 EQAKPYELDKNGMPPEVGFKVKGPEPTRYGDWIGRGRVTDF 119 >gi|90421554|ref|YP_529924.1| hypothetical protein RPC_0026 [Rhodopseudomonas palustris BisB18] gi|90103568|gb|ABD85605.1| protein of unknown function DUF1674 [Rhodopseudomonas palustris BisB18] Length = 77 Score = 43.1 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 15/26 (57%), Positives = 19/26 (73%) Query: 50 IEIGGRKGLDPTRFGDWEKNGISIDF 75 E+ G KG +PTR+GDWE GI+ DF Sbjct: 52 QEVNGPKGPEPTRYGDWETKGIASDF 77 >gi|154332320|ref|XP_001562534.1| hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904] gi|134059424|emb|CAM41650.1| conserved hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904] Length = 107 Score = 42.8 bits (99), Expect = 0.015, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Query: 39 KSANNKDAKLPIEIGGR----KGLDPTRFGDWEKNGISIDF 75 K A + E GR LDPTR+GDWE NG DF Sbjct: 67 KQAGAIPTNIVDEETGRVIGSTQLDPTRYGDWEVNGRCYDF 107 >gi|303286952|ref|XP_003062765.1| predicted protein [Micromonas pusilla CCMP1545] gi|226455401|gb|EEH52704.1| predicted protein [Micromonas pusilla CCMP1545] Length = 214 Score = 42.4 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 15/26 (57%), Positives = 19/26 (73%) Query: 50 IEIGGRKGLDPTRFGDWEKNGISIDF 75 E+ G +GL+PTRFGDWE+ G DF Sbjct: 189 EEVNGPRGLEPTRFGDWERGGRCSDF 214 >gi|46203266|ref|ZP_00051778.2| COG5508: Uncharacterized conserved small protein [Magnetospirillum magnetotacticum MS-1] Length = 79 Score = 42.0 bits (97), Expect = 0.031, Method: Composition-based stats. Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 3/66 (4%) Query: 13 NNSTIKTSHDPLSSIAKRALEEAKQRK---SANNKDAKLPIEIGGRKGLDPTRFGDWEKN 69 + + PLS A+RAL EA +R+ A E GR GL+P R+ DWE Sbjct: 14 TTTNPDETRRPLSPAAQRALAEAAERRASIDARAAKIAERRETLGRGGLEPVRYEDWEVK 73 Query: 70 GISIDF 75 G++ DF Sbjct: 74 GLASDF 79 >gi|72392365|ref|XP_846983.1| hypothetical protein [Trypanosoma brucei TREU927] gi|62359347|gb|AAX79786.1| hypothetical protein, conserved [Trypanosoma brucei] gi|70803013|gb|AAZ12917.1| hypothetical protein, conserved [Trypanosoma brucei brucei strain 927/4 GUTat10.1] gi|261330172|emb|CBH13156.1| hypothetical protein, conserved [Trypanosoma brucei gambiense DAL972] Length = 103 Score = 41.6 bits (96), Expect = 0.032, Method: Composition-based stats. Identities = 22/66 (33%), Positives = 28/66 (42%), Gaps = 10/66 (15%) Query: 20 SHDPLSSIAKRAL------EEAKQRKSANNKDAKLPIEIGG-RKG---LDPTRFGDWEKN 69 PLS + L E+ K+A + + E G G LDP R+GDWE N Sbjct: 38 QQQPLSEETIQRLTTSTGSAESLFNKAAGAQPTNIVDEATGVPVGSVQLDPVRYGDWESN 97 Query: 70 GISIDF 75 G DF Sbjct: 98 GRCHDF 103 >gi|145495531|ref|XP_001433758.1| hypothetical protein [Paramecium tetraurelia strain d4-2] gi|124400878|emb|CAK66361.1| unnamed protein product [Paramecium tetraurelia] Length = 119 Score = 41.6 bits (96), Expect = 0.038, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Query: 39 KSANNKDAKLPIEIGGR-KGLDPTRFGDWEKNGISIDF 75 K +P E+G + KG +PTR+GDW G DF Sbjct: 82 KPYELDKNGMPPEVGFKVKGPEPTRYGDWIGRGRVTDF 119 >gi|170747458|ref|YP_001753718.1| hypothetical protein Mrad2831_1026 [Methylobacterium radiotolerans JCM 2831] gi|170653980|gb|ACB23035.1| protein of unknown function DUF1674 [Methylobacterium radiotolerans JCM 2831] Length = 92 Score = 41.6 bits (96), Expect = 0.039, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 18/26 (69%) Query: 50 IEIGGRKGLDPTRFGDWEKNGISIDF 75 E GR GL+P R+ DWE G+++DF Sbjct: 67 PERQGRGGLEPVRYDDWEVKGLAVDF 92 >gi|296285188|ref|ZP_06863186.1| hypothetical protein CbatJ_16282 [Citromicrobium bathyomarinum JL354] Length = 68 Score = 41.2 bits (95), Expect = 0.044, Method: Composition-based stats. Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Query: 27 IAKRALEEAKQRKSANNKDAKLPIEIGG----RKGLDPTRFGDWEKNGISIDF 75 A E+ K+ + A P I KGL PTR+GDW K+GI+IDF Sbjct: 16 RATERPEDFKKPAHWKDDPAPAPEPIDASVEDPKGLSPTRYGDWVKDGIAIDF 68 >gi|149186385|ref|ZP_01864698.1| hypothetical protein ED21_22888 [Erythrobacter sp. SD-21] gi|148829974|gb|EDL48412.1| hypothetical protein ED21_22888 [Erythrobacter sp. SD-21] Length = 60 Score = 41.2 bits (95), Expect = 0.046, Method: Composition-based stats. Identities = 16/49 (32%), Positives = 29/49 (59%) Query: 27 IAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 A + E ++ + +++ P ++ + L PTR+GDW K+GI+IDF Sbjct: 12 RATKRPETFEKPEHWSSEPPPKPQKVDNEEDLSPTRYGDWVKDGIAIDF 60 >gi|163849993|ref|YP_001638036.1| hypothetical protein Mext_0550 [Methylobacterium extorquens PA1] gi|240137126|ref|YP_002961595.1| hypothetical protein MexAM1_META1p0370 [Methylobacterium extorquens AM1] gi|163661598|gb|ABY28965.1| protein of unknown function DUF1674 [Methylobacterium extorquens PA1] gi|240007092|gb|ACS38318.1| conserved hypothetical protein [Methylobacterium extorquens AM1] Length = 75 Score = 41.2 bits (95), Expect = 0.053, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 17/26 (65%) Query: 50 IEIGGRKGLDPTRFGDWEKNGISIDF 75 E GR GL+P R+ DWE G++ DF Sbjct: 50 PETLGRGGLEPVRYEDWEVKGLASDF 75 >gi|254559137|ref|YP_003066232.1| hypothetical protein METDI0521 [Methylobacterium extorquens DM4] gi|254266415|emb|CAX22179.1| conserved hypothetical protein [Methylobacterium extorquens DM4] Length = 75 Score = 40.8 bits (94), Expect = 0.057, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 17/26 (65%) Query: 50 IEIGGRKGLDPTRFGDWEKNGISIDF 75 E GR GL+P R+ DWE G++ DF Sbjct: 50 PETLGRGGLEPVRYEDWEVKGLASDF 75 >gi|330947111|ref|XP_003306836.1| hypothetical protein PTT_20106 [Pyrenophora teres f. teres 0-1] gi|311315444|gb|EFQ85061.1| hypothetical protein PTT_20106 [Pyrenophora teres f. teres 0-1] Length = 2306 Score = 40.8 bits (94), Expect = 0.063, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 29/52 (55%), Gaps = 3/52 (5%) Query: 26 SIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDW---EKNGISID 74 +A+R++ ++ + + ++ + +P ++ R G P G E++G++ID Sbjct: 1607 PVAQRSIADSSEPRVSSARPDAIPEQVSHRAGPSPVDVGLQIIAEESGVAID 1658 >gi|300176825|emb|CBK25394.2| unnamed protein product [Blastocystis hominis] Length = 122 Score = 40.8 bits (94), Expect = 0.063, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 20/44 (45%) Query: 32 LEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 LEE + + K + G +PTR+GDWE G DF Sbjct: 79 LEEEDYVEMIDPKTGEWNPPRGVFNNAEPTRYGDWEIKGRCYDF 122 >gi|332285733|ref|YP_004417644.1| hypothetical protein PT7_2480 [Pusillimonas sp. T7-7] gi|330429686|gb|AEC21020.1| hypothetical protein PT7_2480 [Pusillimonas sp. T7-7] Length = 51 Score = 40.8 bits (94), Expect = 0.064, Method: Composition-based stats. Identities = 16/20 (80%), Positives = 17/20 (85%) Query: 56 KGLDPTRFGDWEKNGISIDF 75 GLDPTR+GDWEKNG IDF Sbjct: 32 DGLDPTRYGDWEKNGRCIDF 51 >gi|162149216|ref|YP_001603677.1| hypothetical protein GDI_3446 [Gluconacetobacter diazotrophicus PAl 5] gi|209545044|ref|YP_002277273.1| hypothetical protein Gdia_2927 [Gluconacetobacter diazotrophicus PAl 5] gi|161787793|emb|CAP57389.1| hypothetical protein GDI3446 [Gluconacetobacter diazotrophicus PAl 5] gi|209532721|gb|ACI52658.1| protein of unknown function DUF1674 [Gluconacetobacter diazotrophicus PAl 5] Length = 52 Score = 40.4 bits (93), Expect = 0.082, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 18/34 (52%) Query: 42 NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 N + P E GG K PTR+GDW G IDF Sbjct: 19 NAEKPAEPHEYGGPKEQRPTRYGDWTVKGRCIDF 52 >gi|144897279|emb|CAM74143.1| hypothetical protein MGR_2987 [Magnetospirillum gryphiswaldense MSR-1] gi|144897553|emb|CAM74417.1| hypothetical protein MGR_0987 [Magnetospirillum gryphiswaldense MSR-1] Length = 48 Score = 40.1 bits (92), Expect = 0.10, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 20/34 (58%) Query: 42 NNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + + EIGG G +PTRFGDWEK G DF Sbjct: 15 TAEPKQPAEEIGGPAGPEPTRFGDWEKAGRCSDF 48 >gi|218528532|ref|YP_002419348.1| hypothetical protein Mchl_0485 [Methylobacterium chloromethanicum CM4] gi|218520835|gb|ACK81420.1| protein of unknown function DUF1674 [Methylobacterium chloromethanicum CM4] Length = 70 Score = 40.1 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 17/26 (65%) Query: 50 IEIGGRKGLDPTRFGDWEKNGISIDF 75 E GR GL+P R+ DWE G++ DF Sbjct: 45 PETLGRGGLEPVRYEDWEVKGLASDF 70 >gi|302897411|ref|XP_003047584.1| hypothetical protein NECHADRAFT_85892 [Nectria haematococca mpVI 77-13-4] gi|256728515|gb|EEU41871.1| hypothetical protein NECHADRAFT_85892 [Nectria haematococca mpVI 77-13-4] Length = 1097 Score = 40.1 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 16 TIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTR-FGDWEKNGI 71 + S + R L++A + ++ DA+L +++ R+G P R F DWE G+ Sbjct: 257 PVGISKKTTAEEKNRLLDQADEIRATLRNDARLRVDVDAREGYTPARKFNDWELKGV 313 >gi|188579789|ref|YP_001923234.1| hypothetical protein Mpop_0521 [Methylobacterium populi BJ001] gi|179343287|gb|ACB78699.1| protein of unknown function DUF1674 [Methylobacterium populi BJ001] Length = 75 Score = 38.9 bits (89), Expect = 0.21, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 17/26 (65%) Query: 50 IEIGGRKGLDPTRFGDWEKNGISIDF 75 E GR GL+P R+ DWE G++ DF Sbjct: 50 PESLGRGGLEPVRYEDWEVKGLASDF 75 >gi|71421116|ref|XP_811711.1| hypothetical protein [Trypanosoma cruzi strain CL Brener] gi|70876406|gb|EAN89860.1| hypothetical protein, conserved [Trypanosoma cruzi] Length = 107 Score = 38.9 bits (89), Expect = 0.21, Method: Composition-based stats. Identities = 13/22 (59%), Positives = 15/22 (68%) Query: 54 GRKGLDPTRFGDWEKNGISIDF 75 G L+PTR+GDWE NG DF Sbjct: 86 GSTQLNPTRYGDWESNGRCHDF 107 >gi|322828194|gb|EFZ32108.1| hypothetical protein TCSYLVIO_1565 [Trypanosoma cruzi] Length = 107 Score = 38.9 bits (89), Expect = 0.22, Method: Composition-based stats. Identities = 13/22 (59%), Positives = 15/22 (68%) Query: 54 GRKGLDPTRFGDWEKNGISIDF 75 G L+PTR+GDWE NG DF Sbjct: 86 GSTQLNPTRYGDWESNGRCHDF 107 >gi|71656832|ref|XP_816957.1| hypothetical protein [Trypanosoma cruzi strain CL Brener] gi|70882119|gb|EAN95106.1| hypothetical protein, conserved [Trypanosoma cruzi] Length = 107 Score = 38.9 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 13/22 (59%), Positives = 14/22 (63%) Query: 54 GRKGLDPTRFGDWEKNGISIDF 75 G L PTR+GDWE NG DF Sbjct: 86 GSTQLSPTRYGDWESNGRCHDF 107 >gi|209878165|ref|XP_002140524.1| hypothetical protein [Cryptosporidium muris RN66] gi|209556130|gb|EEA06175.1| hypothetical protein CMU_019320 [Cryptosporidium muris RN66] Length = 91 Score = 38.5 bits (88), Expect = 0.33, Method: Composition-based stats. Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 56 KGLDPTRFGDWEKNGISIDF 75 +GL+PT +GDW G DF Sbjct: 72 EGLEPTTYGDWSHKGRVTDF 91 >gi|312216612|emb|CBX96562.1| hypothetical protein [Leptosphaeria maculans] Length = 778 Score = 37.7 bits (86), Expect = 0.47, Method: Composition-based stats. Identities = 9/44 (20%), Positives = 21/44 (47%) Query: 16 TIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLD 59 + H PL +A R + ++R +A ++ + P + R+ + Sbjct: 507 SETPPHQPLPPMADRGVATMEERPAAADEAPRSPRQPANREDPE 550 >gi|330977142|gb|EGH77100.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. aptata str. DSM 50252] Length = 1481 Score = 37.7 bits (86), Expect = 0.52, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 867 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 899 >gi|213969450|ref|ZP_03397587.1| glutamate synthase, large subunit [Pseudomonas syringae pv. tomato T1] gi|301382661|ref|ZP_07231079.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. tomato Max13] gi|302060645|ref|ZP_07252186.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. tomato K40] gi|302130954|ref|ZP_07256944.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. tomato NCPPB 1108] gi|213925821|gb|EEB59379.1| glutamate synthase, large subunit [Pseudomonas syringae pv. tomato T1] Length = 1481 Score = 37.7 bits (86), Expect = 0.52, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 867 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 899 >gi|331016023|gb|EGH96079.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. lachrymans str. M302278PT] Length = 1481 Score = 37.7 bits (86), Expect = 0.53, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 867 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 899 >gi|330971729|gb|EGH71795.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. aceris str. M302273PT] Length = 938 Score = 37.7 bits (86), Expect = 0.53, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 324 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 356 >gi|330964734|gb|EGH64994.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. actinidiae str. M302091] Length = 1481 Score = 37.7 bits (86), Expect = 0.53, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 867 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 899 >gi|330951310|gb|EGH51570.1| glutamate synthase subunit alpha [Pseudomonas syringae Cit 7] Length = 1047 Score = 37.7 bits (86), Expect = 0.53, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 433 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 465 >gi|330877993|gb|EGH12142.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. morsprunorum str. M302280PT] Length = 1481 Score = 37.7 bits (86), Expect = 0.53, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 867 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 899 >gi|312958546|ref|ZP_07773066.1| glutamate synthase (NADPH) large chain [Pseudomonas fluorescens WH6] gi|311287089|gb|EFQ65650.1| glutamate synthase (NADPH) large chain [Pseudomonas fluorescens WH6] Length = 1197 Score = 37.7 bits (86), Expect = 0.53, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 583 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 615 >gi|302189479|ref|ZP_07266152.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. syringae 642] Length = 1481 Score = 37.7 bits (86), Expect = 0.53, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 867 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 899 >gi|229587973|ref|YP_002870092.1| glutamate synthase subunit alpha [Pseudomonas fluorescens SBW25] gi|229359839|emb|CAY46691.1| glutamate synthase [NADPH] large chain precursor [Pseudomonas fluorescens SBW25] Length = 1481 Score = 37.7 bits (86), Expect = 0.53, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 867 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 899 >gi|28872236|ref|NP_794855.1| glutamate synthase, large subunit [Pseudomonas syringae pv. tomato str. DC3000] gi|28855490|gb|AAO58550.1| glutamate synthase, large subunit [Pseudomonas syringae pv. tomato str. DC3000] Length = 1481 Score = 37.7 bits (86), Expect = 0.53, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 867 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 899 >gi|4337008|gb|AAD18033.1| glutamate synthase large subunit [Pseudomonas fluorescens] Length = 725 Score = 37.7 bits (86), Expect = 0.53, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 111 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 143 >gi|70733957|ref|YP_257597.1| glutamate synthase subunit alpha [Pseudomonas fluorescens Pf-5] gi|68348256|gb|AAY95862.1| glutamate synthase (NADPH) large chain [Pseudomonas fluorescens Pf-5] Length = 1484 Score = 37.7 bits (86), Expect = 0.53, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 870 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 902 >gi|77456641|ref|YP_346146.1| glutamate synthase subunit alpha [Pseudomonas fluorescens Pf0-1] gi|77380644|gb|ABA72157.1| glutamate synthase [NADPH] large chain precursor [Pseudomonas fluorescens Pf0-1] Length = 1481 Score = 37.7 bits (86), Expect = 0.53, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 867 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 899 >gi|66043678|ref|YP_233519.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. syringae B728a] gi|63254385|gb|AAY35481.1| Glutamate synthase (ferredoxin) [Pseudomonas syringae pv. syringae B728a] Length = 1481 Score = 37.7 bits (86), Expect = 0.53, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 867 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 899 >gi|330984726|gb|EGH82829.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. lachrymans str. M301315] Length = 1481 Score = 37.7 bits (86), Expect = 0.54, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 867 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 899 >gi|71734670|ref|YP_272701.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. phaseolicola 1448A] gi|257483512|ref|ZP_05637553.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. tabaci ATCC 11528] gi|71555223|gb|AAZ34434.1| glutamate synthase, large subunit [Pseudomonas syringae pv. phaseolicola 1448A] gi|320330842|gb|EFW86816.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. glycinea str. race 4] gi|331009594|gb|EGH89650.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. tabaci ATCC 11528] Length = 1481 Score = 37.7 bits (86), Expect = 0.54, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 867 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 899 >gi|298485078|ref|ZP_07003174.1| Glutamate synthase [NADPH] large chain [Pseudomonas savastanoi pv. savastanoi NCPPB 3335] gi|298160330|gb|EFI01355.1| Glutamate synthase [NADPH] large chain [Pseudomonas savastanoi pv. savastanoi NCPPB 3335] Length = 1481 Score = 37.7 bits (86), Expect = 0.55, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 867 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 899 >gi|289623545|ref|ZP_06456499.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. aesculi str. NCPPB3681] gi|289648295|ref|ZP_06479638.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. aesculi str. 2250] gi|330865723|gb|EGH00432.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. aesculi str. 0893_23] Length = 1481 Score = 37.7 bits (86), Expect = 0.55, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 867 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 899 >gi|104779616|ref|YP_606114.1| glutamate synthase subunit alpha [Pseudomonas entomophila L48] gi|95108603|emb|CAK13297.1| glutamate synthase [NADPH] large chain precursor (GOGAT) [Pseudomonas entomophila L48] Length = 1481 Score = 37.7 bits (86), Expect = 0.55, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 867 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 899 >gi|330957035|gb|EGH57295.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. maculicola str. ES4326] Length = 1481 Score = 37.7 bits (86), Expect = 0.58, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 867 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 899 >gi|325119950|emb|CBZ55503.1| conserved hypothetical protein [Neospora caninum Liverpool] Length = 182 Score = 37.7 bits (86), Expect = 0.58, Method: Composition-based stats. Identities = 19/67 (28%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Query: 10 GLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGR-KGLDPTRFGDWEK 68 G N+ K+ S + + + A +R S E G + +G +PT GDW Sbjct: 116 GCSTNANEKSDGTARSEVPLKQEKNAAERPSKETGGMLKVPEYGFKYEGPEPTTHGDWSH 175 Query: 69 NGISIDF 75 NG DF Sbjct: 176 NGRVTDF 182 >gi|330872064|gb|EGH06213.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. glycinea str. race 4] Length = 1149 Score = 37.7 bits (86), Expect = 0.60, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 535 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 567 >gi|332188779|ref|ZP_08390490.1| hypothetical protein SUS17_3896 [Sphingomonas sp. S17] gi|332011178|gb|EGI53272.1| hypothetical protein SUS17_3896 [Sphingomonas sp. S17] Length = 53 Score = 37.4 bits (85), Expect = 0.62, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 17/32 (53%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + P G +P R+GDWE GI++DF Sbjct: 22 QPEAKPEPQEDPLGKNPVRYGDWELKGIAVDF 53 >gi|329847343|ref|ZP_08262371.1| hypothetical protein ABI_04070 [Asticcacaulis biprosthecum C19] gi|328842406|gb|EGF91975.1| hypothetical protein ABI_04070 [Asticcacaulis biprosthecum C19] Length = 67 Score = 37.0 bits (84), Expect = 0.80, Method: Composition-based stats. Identities = 10/15 (66%), Positives = 14/15 (93%) Query: 61 TRFGDWEKNGISIDF 75 TR+GDWE+ GI++DF Sbjct: 53 TRYGDWERKGIAVDF 67 >gi|294010234|ref|YP_003543694.1| hypothetical protein SJA_C1-02480 [Sphingobium japonicum UT26S] gi|292673564|dbj|BAI95082.1| conserved hypothetical protein [Sphingobium japonicum UT26S] Length = 57 Score = 37.0 bits (84), Expect = 0.80, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 4/38 (10%) Query: 42 NNKDAKLPIEIGGRKGLD----PTRFGDWEKNGISIDF 75 + P IG D P R+GDWE+ GI+IDF Sbjct: 20 KSPPVPQPDPIGSPSRHDEELSPVRYGDWERKGIAIDF 57 >gi|237798105|ref|ZP_04586566.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. oryzae str. 1_6] gi|331020957|gb|EGI01014.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. oryzae str. 1_6] Length = 966 Score = 37.0 bits (84), Expect = 0.85, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 867 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 899 >gi|289676474|ref|ZP_06497364.1| glutamate synthase subunit alpha [Pseudomonas syringae pv. syringae FF5] Length = 865 Score = 37.0 bits (84), Expect = 0.89, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 LS A AL EA R A G G DP R+G Sbjct: 732 LSPEAHEALAEAMNRLGA--------RSNSGEGGEDPARYG 764 >gi|307294747|ref|ZP_07574589.1| protein of unknown function DUF1674 [Sphingobium chlorophenolicum L-1] gi|306879221|gb|EFN10439.1| protein of unknown function DUF1674 [Sphingobium chlorophenolicum L-1] Length = 57 Score = 37.0 bits (84), Expect = 0.90, Method: Composition-based stats. Identities = 12/18 (66%), Positives = 15/18 (83%) Query: 58 LDPTRFGDWEKNGISIDF 75 L P R+GDWE+ GI+IDF Sbjct: 40 LSPVRYGDWERKGIAIDF 57 >gi|172036100|ref|YP_001802601.1| two-component hybrid sensor and regulator [Cyanothece sp. ATCC 51142] gi|171697554|gb|ACB50535.1| two-component hybrid sensor and regulator [Cyanothece sp. ATCC 51142] Length = 850 Score = 37.0 bits (84), Expect = 0.97, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Query: 8 IRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKL-PIEIGGRKGLDPTRFGDW 66 ++ + +K + L +RAL+EAK+ + + L E R ++ + G W Sbjct: 123 LKQGATDYVLKQRLERLVPCVERALQEAKEHRKRKAAETALRESEDRLRLAIESAQLGTW 182 Query: 67 E 67 + Sbjct: 183 D 183 >gi|94498067|ref|ZP_01304630.1| hypothetical protein SKA58_03029 [Sphingomonas sp. SKA58] gi|94422502|gb|EAT07540.1| hypothetical protein SKA58_03029 [Sphingomonas sp. SKA58] Length = 57 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 11/16 (68%), Positives = 14/16 (87%) Query: 60 PTRFGDWEKNGISIDF 75 P R+GDWE+ GI+IDF Sbjct: 42 PVRYGDWERKGIAIDF 57 >gi|327482884|gb|AEA86194.1| sensory box histidine kinase/response regulator [Pseudomonas stutzeri DSM 4166] Length = 801 Score = 36.2 bits (82), Expect = 1.4, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 8 IRGLMNNSTIKTSHDPLSSIAKRALEEA-KQRKSANNKDAKLPIEIGGRKGLDPTRFGDW 66 +R + +K + L +RAL E ++R+ + A +E+ R +D R G W Sbjct: 99 MRSGAVDYVLKQNLGFLPKAVERALGEVNERRRRLQAEQALREVEVRARLAIDAARLGMW 158 Query: 67 E 67 + Sbjct: 159 D 159 >gi|146284495|ref|YP_001174648.1| sensory box histidine kinase/response regulator [Pseudomonas stutzeri A1501] gi|145572700|gb|ABP81806.1| sensory box histidine kinase/response regulator [Pseudomonas stutzeri A1501] Length = 801 Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 8 IRGLMNNSTIKTSHDPLSSIAKRALEEA-KQRKSANNKDAKLPIEIGGRKGLDPTRFGDW 66 +R + +K + L +RAL E ++R+ + A +E+ R +D R G W Sbjct: 99 MRSGAVDYVLKQNLGFLPKAVERALGEVNERRRRLQAEQALREVEVRARLAIDAARLGMW 158 Query: 67 E 67 + Sbjct: 159 D 159 >gi|85375087|ref|YP_459149.1| hypothetical protein ELI_11300 [Erythrobacter litoralis HTCC2594] gi|84788170|gb|ABC64352.1| hypothetical protein ELI_11300 [Erythrobacter litoralis HTCC2594] Length = 55 Score = 35.8 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%) Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 + + E GL PTR+GDW K+G++IDF Sbjct: 24 EPQPIDAEEKDPDGLSPTRYGDWVKDGVAIDF 55 >gi|45190438|ref|NP_984692.1| AEL169Wp [Ashbya gossypii ATCC 10895] gi|44983380|gb|AAS52516.1| AEL169Wp [Ashbya gossypii ATCC 10895] Length = 132 Score = 35.8 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 7/67 (10%) Query: 9 RGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEK 68 + N+ +KT S + L E + K+ EIGG + DP R+GD+ Sbjct: 73 KESANSPILKTEIGSFSPEFSKTLPEFEGDKNPETG------EIGGPR-QDPLRYGDYSY 125 Query: 69 NGISIDF 75 NG DF Sbjct: 126 NGRVTDF 132 >gi|85710226|ref|ZP_01041291.1| hypothetical protein NAP1_15113 [Erythrobacter sp. NAP1] gi|85688936|gb|EAQ28940.1| hypothetical protein NAP1_15113 [Erythrobacter sp. NAP1] Length = 66 Score = 35.4 bits (80), Expect = 2.4, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 4/47 (8%) Query: 33 EEAKQRKSANNKDAKLPIEIG----GRKGLDPTRFGDWEKNGISIDF 75 ++ ++ N P + + + PTR+GDWEKNGI+ DF Sbjct: 20 KDFQKPAHWTNDPPPEPKAVDPMKDEPREISPTRYGDWEKNGIAWDF 66 >gi|78224014|ref|YP_385761.1| putative PAS/PAC sensor protein [Geobacter metallireducens GS-15] gi|78195269|gb|ABB33036.1| putative PAS/PAC sensor protein [Geobacter metallireducens GS-15] Length = 649 Score = 35.4 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 11/41 (26%), Positives = 19/41 (46%) Query: 8 IRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKL 48 +R N+ IK + L +R L+EA+ R+ + L Sbjct: 97 MRAGANDYFIKGNISRLVPAIQRELKEAELRRKKREAEEAL 137 >gi|94987297|ref|YP_595230.1| flagellar biosynthesis/type III secretory pathway protein [Lawsonia intracellularis PHE/MN1-00] gi|94731546|emb|CAJ54909.1| Flagellar biosynthesis/type III secretory pathway protein [Lawsonia intracellularis PHE/MN1-00] Length = 481 Score = 35.1 bits (79), Expect = 3.1, Method: Composition-based stats. Identities = 13/48 (27%), Positives = 24/48 (50%) Query: 15 STIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTR 62 K D L A++AL+EA++ + + +L E G R G++ + Sbjct: 90 EKTKKESDKLHKQAQQALKEAERIREEADHIRELAHEEGYRLGIEQAQ 137 >gi|271962301|ref|YP_003336497.1| ATPase-like protein [Streptosporangium roseum DSM 43021] gi|270505476|gb|ACZ83754.1| ATPase-like protein [Streptosporangium roseum DSM 43021] Length = 1118 Score = 35.1 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 18/74 (24%), Positives = 25/74 (33%), Gaps = 4/74 (5%) Query: 1 MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPI---EIGGRKG 57 +R ++ +I + + P S A RA E A R + P E G R Sbjct: 236 LRALETDILAHAGSLNRQEPAAPGSPAAIRAPERAASRGAGEAAKRDAPREGEEAGERDA 295 Query: 58 LDPTRFGDWEKNGI 71 GD E G Sbjct: 296 PREVE-GDGELIGR 308 >gi|296536730|ref|ZP_06898789.1| GTP cyclohydrolase I [Roseomonas cervicalis ATCC 49957] gi|296262943|gb|EFH09509.1| GTP cyclohydrolase I [Roseomonas cervicalis ATCC 49957] Length = 219 Score = 34.3 bits (77), Expect = 6.4, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 18/42 (42%) Query: 23 PLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFG 64 PL AKRAL E + + + + + G DP R G Sbjct: 11 PLPPAAKRALPEITAPRPSREQAEEAVRTLLLWAGDDPGREG 52 >gi|332290220|ref|YP_004421072.1| translation initiation factor IF-2 [Gallibacterium anatis UMN179] gi|330433116|gb|AEC18175.1| translation initiation factor IF-2 [Gallibacterium anatis UMN179] Length = 851 Score = 33.9 bits (76), Expect = 8.1, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 18/39 (46%) Query: 29 KRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWE 67 KR EEA+ R+ A + E + D R+ D+E Sbjct: 136 KRKAEEAEFRRRAEEAARQKAEEQARKAAEDAKRYADFE 174 >gi|296417535|ref|XP_002838411.1| hypothetical protein [Tuber melanosporum Mel28] gi|295634344|emb|CAZ82602.1| unnamed protein product [Tuber melanosporum] Length = 118 Score = 33.9 bits (76), Expect = 8.4, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Query: 50 IEIGGRKGL--DPTRFGDWEKNGISIDF 75 + G R G DP R+GDW NG DF Sbjct: 91 PKTGERGGPKNDPLRYGDWAFNGRVSDF 118 >gi|107026166|ref|YP_623677.1| penicillin-binding protein 1C [Burkholderia cenocepacia AU 1054] gi|116692650|ref|YP_838183.1| penicillin-binding protein 1C [Burkholderia cenocepacia HI2424] gi|170738100|ref|YP_001779360.1| penicillin-binding protein 1C [Burkholderia cenocepacia MC0-3] gi|105895540|gb|ABF78704.1| Penicillin-binding protein 1C [Burkholderia cenocepacia AU 1054] gi|116650650|gb|ABK11290.1| penicillin-binding protein 1C [Burkholderia cenocepacia HI2424] gi|169820288|gb|ACA94870.1| penicillin-binding protein 1C [Burkholderia cenocepacia MC0-3] Length = 747 Score = 33.5 bits (75), Expect = 9.4, Method: Composition-based stats. Identities = 16/77 (20%), Positives = 31/77 (40%), Gaps = 18/77 (23%) Query: 3 TVQINIRGLMNNSTIKTS-----HDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKG 57 + ++ G+ S + ++ H L S A RA + R+ A +D Sbjct: 574 SPMWDVSGVTGASPVWSAVVGYLHRDLPSRAPRAPAGVETRRIAFERD------------ 621 Query: 58 LDPTRFGDWEKNGISID 74 ++P R +W G ++D Sbjct: 622 IEPAR-NEWFIAGTAVD 637 >gi|206563587|ref|YP_002234350.1| putative penicillin-binding protein [Burkholderia cenocepacia J2315] gi|198039627|emb|CAR55595.1| putative penicillin-binding protein [Burkholderia cenocepacia J2315] Length = 742 Score = 33.5 bits (75), Expect = 9.5, Method: Composition-based stats. Identities = 16/77 (20%), Positives = 31/77 (40%), Gaps = 18/77 (23%) Query: 3 TVQINIRGLMNNSTIKTS-----HDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKG 57 + ++ G+ S + ++ H L S A RA + R+ A +D Sbjct: 569 SPMWDVSGVTGASPVWSAVVGYLHRDLPSRAPRAPAGVETRRIAFERD------------ 616 Query: 58 LDPTRFGDWEKNGISID 74 ++P R +W G ++D Sbjct: 617 IEPAR-NEWFIAGTAVD 632 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.300 0.133 0.389 Lambda K H 0.267 0.0409 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,349,493,140 Number of Sequences: 14124377 Number of extensions: 45148750 Number of successful extensions: 196437 Number of sequences better than 10.0: 395 Number of HSP's better than 10.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 60 Number of HSP's that attempted gapping in prelim test: 195491 Number of HSP's gapped (non-prelim): 786 length of query: 75 length of database: 4,842,793,630 effective HSP length: 46 effective length of query: 29 effective length of database: 4,193,072,288 effective search space: 121599096352 effective search space used: 121599096352 T: 11 A: 40 X1: 16 ( 6.9 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.1 bits) S2: 75 (33.5 bits)