RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780408|ref|YP_003064821.1| hypothetical protein CLIBASIA_01465 [Candidatus Liberibacter asiaticus str. psy62] (75 letters) >gnl|CDD|35067 COG5508, COG5508, Uncharacterized conserved small protein [Function unknown]. Length = 84 Score = 62.4 bits (151), Expect = 3e-11 Identities = 30/54 (55%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Query: 23 PLSSIAKRALEEAKQRKSANN-KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 L+ A+RAL+EA+ R++A+ K+ LP EIGGR GL+PTR+GDWE G IDF Sbjct: 31 DLTPAAQRALKEAEARRAASEEKNLSLPKEIGGRGGLEPTRYGDWEHKGRVIDF 84 >gnl|CDD|38455 KOG3245, KOG3245, KOG3245, Uncharacterized conserved protein [Function unknown]. Length = 106 Score = 39.7 bits (92), Expect = 2e-04 Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 51 EIGGRKGLDPTRFGDWEKNGISIDF 75 EIGG +G +PTR+GDWE+ G DF Sbjct: 82 EIGGPRGPEPTRYGDWERKGRCSDF 106 >gnl|CDD|32232 COG2049, DUR1, Allophanate hydrolase subunit 1 [Amino acid transport and metabolism]. Length = 223 Score = 29.8 bits (67), Expect = 0.16 Identities = 13/74 (17%), Positives = 28/74 (37%), Gaps = 8/74 (10%) Query: 1 MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDP 60 R++ + + L + EE + ++A + ++P+ GG G D Sbjct: 47 YRSLLVIYDPP------RLDPQELLERLRALWEEIEALEAAGIRLIEIPVVYGGEYGPDL 100 Query: 61 TRFGDWEKNGISID 74 NG+S++ Sbjct: 101 AEVA--RHNGLSVE 112 >gnl|CDD|145701 pfam02682, AHS1, Allophanate hydrolase subunit 1. This family is the first subunit of allophanate hydrolase. Length = 202 Score = 26.3 bits (59), Expect = 1.6 Identities = 17/76 (22%), Positives = 33/76 (43%), Gaps = 12/76 (15%) Query: 1 MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDP 60 R++ ++ L L ++ K L EA +A ++ ++P+ GG G D Sbjct: 49 YRSLLVHFDPL------VIDRAALLALLKALLAEAAAALAAPSRIIEIPVCYGGEFGPDL 102 Query: 61 TRFGDW--EKNGISID 74 + E NG+S++ Sbjct: 103 ----EEVAEHNGLSVE 114 >gnl|CDD|33337 COG3535, COG3535, Uncharacterized conserved protein [Function unknown]. Length = 357 Score = 26.0 bits (57), Expect = 2.1 Identities = 16/51 (31%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Query: 10 GLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDP 60 G+M + P A RA E + DA + IEIGG L P Sbjct: 63 GMMGAPIVGIEKLPNGDEAIRAFEVL-EDYLGKPVDAIISIEIGGINSLIP 112 >gnl|CDD|31674 COG1485, COG1485, Predicted ATPase [General function prediction only]. Length = 367 Score = 25.6 bits (56), Expect = 2.8 Identities = 11/36 (30%), Positives = 18/36 (50%) Query: 21 HDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRK 56 PL + A+ AL++ S +A +EI GR+ Sbjct: 219 LTPLDAEAEAALDKLWAALSDGAPEAAANLEIKGRE 254 >gnl|CDD|113683 pfam04919, DUF655, Protein of unknown function, DUF655. This family includes several uncharacterized archaeal proteins. Length = 181 Score = 23.9 bits (52), Expect = 8.8 Identities = 8/23 (34%), Positives = 13/23 (56%) Query: 17 IKTSHDPLSSIAKRALEEAKQRK 39 +K HDP+ I +R +EE + Sbjct: 151 VKGLHDPVKIIVERIIEELRDPT 173 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.313 0.131 0.371 Gapped Lambda K H 0.267 0.0682 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 819,280 Number of extensions: 30837 Number of successful extensions: 82 Number of sequences better than 10.0: 1 Number of HSP's gapped: 81 Number of HSP's successfully gapped: 17 Length of query: 75 Length of database: 6,263,737 Length adjustment: 46 Effective length of query: 29 Effective length of database: 5,269,723 Effective search space: 152821967 Effective search space used: 152821967 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.1 bits)