RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780408|ref|YP_003064821.1| hypothetical protein CLIBASIA_01465 [Candidatus Liberibacter asiaticus str. psy62] (75 letters) >gnl|CDD|149136 pfam07896, DUF1674, Protein of unknown function (DUF1674). The members of this family are sequences derived from hypothetical eukaryotic and bacterial proteins. The region in question is approximately 60 residues long. Length = 41 Score = 66.0 bits (162), Expect = 2e-12 Identities = 23/42 (54%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Query: 34 EAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75 EA++R+ A K A P EIGG KG +PTR+GDWE+ G DF Sbjct: 1 EAEERRPAARK-AVNPGEIGGPKGPEPTRYGDWERKGRVTDF 41 >gnl|CDD|150296 pfam09582, AnfO_nitrog, Iron only nitrogenase protein AnfO (AnfO_nitrog). Proteins in this entry include Anf1 from Rhodobacter capsulatus (Rhodopseudomonas capsulata) and AnfO from Azotobacter vinelandii. They are found exclusively in species which contain the iron-only nitrogenase, and are encoded immediately downstream of the structural genes for the nitrogenase enzyme in these species. Length = 201 Score = 28.4 bits (64), Expect = 0.47 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 5/44 (11%) Query: 21 HDPLSSIAKRALEEAKQRKSA----NNKDAKLPIEIG-GRKGLD 59 D L +A++ EEAK+ + A N D +P+E+G GR LD Sbjct: 96 LDFLDYVAEKEEEEAKKEREAADEPPNFDIPVPLELGDGRFRLD 139 >gnl|CDD|185245 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional. Length = 921 Score = 26.1 bits (58), Expect = 2.3 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Query: 15 STIKTSHDPLSS-IAKR--ALEEAKQRKSANNK 44 T+ +D L + +A+R AL EAKQR NK Sbjct: 364 DTLNEQYDTLENKVAERTQALAEAKQRAEQANK 396 >gnl|CDD|162741 TIGR02170, thyX, thymidylate synthase, flavin-dependent. Two forms of microbial thymidylate synthase are known: ThyA (2.1.1.45) and ThyX (2.1.1.148). This model describes ThyX, a homotetrameric flavoprotein. Both enzymes convert dUMP to dTMP. Under oxygen-limiting conditions, thyX can complement a thyA mutation. Length = 209 Score = 25.4 bits (56), Expect = 3.7 Identities = 11/38 (28%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Query: 3 TVQINIRGLMNNSTIKTSHDPLSSI---AKRALEEAKQ 37 V N R LM+ ++ S+D I A+ L+ K+ Sbjct: 163 VVTGNARALMHFLDLRASNDAQWEIRELAEAMLDIVKE 200 >gnl|CDD|184056 PRK13446, atpC, F0F1 ATP synthase subunit epsilon; Provisional. Length = 136 Score = 24.1 bits (53), Expect = 8.4 Identities = 10/25 (40%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Query: 28 AKRALEEAKQR-KSANNKDAKLPIE 51 A+ ALE A+QR K +D E Sbjct: 94 ARAALERAEQRLKKLTPEDDSARAE 118 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.313 0.131 0.371 Gapped Lambda K H 0.267 0.0709 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,148,543 Number of extensions: 54597 Number of successful extensions: 114 Number of sequences better than 10.0: 1 Number of HSP's gapped: 114 Number of HSP's successfully gapped: 14 Length of query: 75 Length of database: 5,994,473 Length adjustment: 45 Effective length of query: 30 Effective length of database: 5,022,113 Effective search space: 150663390 Effective search space used: 150663390 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.1 bits)