RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780408|ref|YP_003064821.1| hypothetical protein CLIBASIA_01465 [Candidatus Liberibacter asiaticus str. psy62] (75 letters) >d1jv1a_ c.68.1.5 (A:) UDP-N-acetylglucosamine pyrophosphorylase {Human (Homo sapiens), AGX1 [TaxId: 9606]} Length = 501 Score = 28.4 bits (63), Expect = 0.19 Identities = 14/53 (26%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Query: 24 LSSIAKRALEEAKQRKSANNKDAK---LPIEIGGRKGLDPTRFGDWEKNGISI 73 L+ ++A+E Q N DA+ +P E+ G D + WE G+ Sbjct: 45 LNFFFQKAIEGFNQSSHQKNVDARMEPVPREVLGSATRDQDQLQAWESEGLFQ 97 >d2bvca2 d.128.1.1 (A:105-478) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 374 Score = 24.1 bits (51), Expect = 3.8 Identities = 6/19 (31%), Positives = 9/19 (47%), Gaps = 1/19 (5%) Query: 20 SHDPLSSIAKRALEEAKQR 38 S DP +IA++A Sbjct: 1 SRDP-RNIARKAENYLIST 18 >d2r9ga1 a.80.1.2 (A:238-423) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]} Length = 186 Score = 22.6 bits (48), Expect = 8.9 Identities = 5/21 (23%), Positives = 10/21 (47%) Query: 48 LPIEIGGRKGLDPTRFGDWEK 68 LP ++ + P G +E+ Sbjct: 152 LPDKLKNAQYYQPKDTGKYEQ 172 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.313 0.131 0.371 Gapped Lambda K H 0.267 0.0589 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 262,808 Number of extensions: 9074 Number of successful extensions: 19 Number of sequences better than 10.0: 1 Number of HSP's gapped: 19 Number of HSP's successfully gapped: 5 Length of query: 75 Length of database: 2,407,596 Length adjustment: 42 Effective length of query: 33 Effective length of database: 1,830,936 Effective search space: 60420888 Effective search space used: 60420888 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.2 bits)