HHsearch alignment for GI: 254780409 and conserved domain: COG0462

>COG0462 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism].
Probab=97.85  E-value=0.00041  Score=47.64  Aligned_cols=138  Identities=25%  Similarity=0.241  Sum_probs=62.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCCEEEEECCCCCCCCCEEECCCCCCCCCEEEEECHHHCCHH----HHHHHHHHHHHCC
Q ss_conf             188516656357899999970997999832676763210000245455742899521320336----6888989875268
Q gi|254780409|r  161 LMVVSPDVGGVVRARALAKRLGCLLAIVDKRREHPGKIEVMNIIGKVEGKDCILIDDIVDTGG----TLCGAADALYEQG  236 (310)
Q Consensus       161 ~vVVaPD~G~~~ra~~~a~~L~~~~~~~~K~R~~~~~v~~~~~~gdV~gr~vIIVDDii~TGg----Ti~~aa~~Lk~~G  236 (310)
T Consensus         5 ~~if~g-~s~~~La~~ia~~l~~~l~~~~~~rF~DGE~~-V~i~EsVrg~dVfI~qs~~~pvnd~lmELLi~idA~k~as   82 (314)
T COG0462           5 MKIFSG-SSNPELAEKIAKRLGIPLGKVEVKRFPDGEIY-VRIEESVRGKDVFIIQSTSPPVNDNLMELLIMIDALKRAS   82 (314)
T ss_pred             EEEEEC-CCCHHHHHHHHHHHCCCCCCCEEEECCCCCEE-EEECCCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             599977-88789999999860998534247786999689-9842652687699990899986889999999999988658


Q ss_pred             CCCEEEEEECC-------CC------CHHH-HHHHHHCCCCEEEECCCCCCCHHHHCCCCEEEEECHHHHHHHHHHHH
Q ss_conf             75217872055-------55------7168-98886369989998178878434740798599811799999999871
Q gi|254780409|r  237 ALSVTAYITHG-------VL------SSSS-IERIEKSKMKELVITDSIQPTDLVKSSAKIRILTIAQLMGEAINRTF  300 (310)
Q Consensus       237 A~~V~~~~THg-------if------s~~a-~e~l~~s~i~~iv~TnTi~~~~~~~~~~ki~visva~llA~aI~~i~  300 (310)
T Consensus        83 A~~It~ViPY~gYARQDk~~~~repIsaklvA~lL~~aG~drv~TvDlH~~qiqgfFdipvdnl~a~p~l~~~~~~~~  160 (314)
T COG0462          83 AKRITAVIPYFGYARQDKAFKPREPISAKLVANLLETAGADRVLTVDLHAPQIQGFFDIPVDNLYAAPLLAEYIREKY  160 (314)
T ss_pred             CCEEEEEEECCHHHCCCCCCCCCCCEEHHHHHHHHHHCCCCEEEEEECCCHHHCCCCCCCCCCCCCHHHHHHHHHHHC
T ss_conf             865899931651322576568999772999999999729986999707865655667884036404599999999736